F460185

General Info

Members Datasets Scaffolds Average Seq Length
531 251 1062 149

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0000035|Ga0496116_0000035_31464_31952
Length 162
Sequence MSQANTGAAAPKGTIKAKHQRLVLLVVALVVLIGAGLLAAWALRNQASYFYVPAEIVAKLPEPGRAVRLGGMVARGSLRTEADGVTIAFAVEDGKARVPVRFRGIVPSLFVEGSGVVAEGHMGADGTFVADNLLAKHDENYVPREMKDMSREQAEQVMRETK

Samples

Sample ID Description Type Environment
1 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
134 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
135 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
136 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
143 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
144 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
145 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
148 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
211 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
212 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
215 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
216 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
217 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
218 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
219 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
220 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
221 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
223 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
224 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
225 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
226 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
227 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
228 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
231 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
232 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
233 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
234 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
235 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
236 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
237 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
238 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
239 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
240 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
241 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
242 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
243 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
244 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
245 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
246 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
247 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
248 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
249 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
250 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
251 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 0
Isolates 3.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.3
Nodule 0
Rhizoplane 6.21
Rhizosphere 71.19
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496116_0000035 3300048919 Bacteria 402424
2 SwRhRL2b_contig_1843142 2162886007 Bacteria 25559
3 SwRhRL2b_contig_3651366 2162886007 Bacteria 6229
4 JGI24748J21848_1010770 3300002074 Bacteria 1076
5 JGI24751J29686_10000113 3300002459 Bacteria 42221
6 Ga0065704_10017573 3300005289 Bacteria 1755
7 Ga0065704_10070220 3300005289 Bacteria 67739
8 Ga0065704_10071310 3300005289 Bacteria 11803
9 Ga0065704_10261777 3300005289 Bacteria 963
10 Ga0070658_10000652 3300005327 Bacteria 29975
11 Ga0070658_10029428 3300005327 Bacteria 4412
12 Ga0070658_10038879 3300005327 Bacteria 3837
13 Ga0070658_10298398 3300005327 Bacteria 1374
14 Ga0070683_100042459 3300005329 Bacteria 4187
15 Ga0070683_100665140 3300005329 Bacteria 997
16 Ga0070670_100160735 3300005331 Bacteria 1947
17 Ga0070666_10060034 3300005335 Bacteria 2573
18 Ga0070680_100108284 3300005336 Bacteria 2312
19 Ga0070680_100512379 3300005336 Bacteria 1027
20 Ga0070680_100740024 3300005336 Bacteria 846
21 Ga0070660_100001861 3300005339 Bacteria 14527
22 Ga0070660_100317848 3300005339 Bacteria 1278
23 Ga0070660_100667197 3300005339 Bacteria 871
24 Ga0070660_101131540 3300005339 Bacteria 663
25 Ga0070661_100000985 3300005344 Bacteria 20160
26 Ga0070661_100543403 3300005344 Bacteria 934
27 Ga0070661_101086271 3300005344 Bacteria 666
28 Ga0070668_100011227 3300005347 Bacteria 6670
29 Ga0070668_100012744 3300005347 Bacteria 6257
30 Ga0070668_100124411 3300005347 Bacteria 2065
31 Ga0070668_100362601 3300005347 Bacteria 1229
32 Ga0070668_100638156 3300005347 Bacteria 935
33 Ga0070668_101435293 3300005347 Bacteria 630
34 Ga0070669_100000062 3300005353 Bacteria 107705
35 Ga0070669_100002056 3300005353 Bacteria 14558
36 Ga0070669_100002134 3300005353 Bacteria 14303
37 Ga0070669_100516921 3300005353 Bacteria 992
38 Ga0070671_100000914 3300005355 Bacteria 21551
39 Ga0070671_100007099 3300005355 Bacteria 8961
40 Ga0070671_100020944 3300005355 Bacteria 5335
41 Ga0070671_100064768 3300005355 Bacteria 3044
42 Ga0070688_101082686 3300005365 Bacteria 640
43 Ga0070659_100027882 3300005366 Bacteria 4355
44 Ga0070659_100179264 3300005366 Bacteria 1738
45 Ga0070659_100522164 3300005366 Bacteria 1014
46 Ga0070659_101672310 3300005366 Bacteria 569
47 Ga0070667_100000763 3300005367 Bacteria 30599
48 Ga0070667_100034468 3300005367 Bacteria 4235
49 Ga0070667_100037248 3300005367 Bacteria 4078
50 Ga0070667_100136298 3300005367 Bacteria 2147
51 Ga0070667_100212022 3300005367 Bacteria 1722
52 Ga0070663_100015742 3300005455 Bacteria 4892
53 Ga0070663_100326159 3300005455 Bacteria 1236
54 Ga0070662_100000786 3300005457 Bacteria 19464
55 Ga0070662_100003681 3300005457 Bacteria 9581
56 Ga0070662_100079741 3300005457 Bacteria 2435
57 Ga0070681_10113906 3300005458 Bacteria 2643
58 Ga0070685_10539288 3300005466 Bacteria 831
59 Ga0070679_100257228 3300005530 Bacteria 1701
60 Ga0070679_100279669 3300005530 Bacteria 1622
61 Ga0070679_101065181 3300005530 Bacteria 753
62 Ga0070684_100033155 3300005535 Bacteria 4407
63 Ga0070684_100343228 3300005535 Bacteria 1373
64 Ga0068853_100014582 3300005539 Bacteria 6443
65 Ga0068853_100080709 3300005539 Bacteria 2847
66 Ga0068853_100607415 3300005539 Bacteria 1039
67 Ga0070672_101044620 3300005543 Bacteria 725
68 Ga0070696_101284993 3300005546 Bacteria 621
69 Ga0070665_100001346 3300005548 Bacteria 29176
70 Ga0070665_100010491 3300005548 Bacteria 9375
71 Ga0070665_100102277 3300005548 Bacteria 2868
72 Ga0068855_100012551 3300005563 Bacteria 10226
73 Ga0068855_100070712 3300005563 Bacteria 4059
74 Ga0068855_100152364 3300005563 Bacteria 2628
75 Ga0068855_100603168 3300005563 Bacteria 1184
76 Ga0070664_100009676 3300005564 Bacteria 7821
77 Ga0070664_100315006 3300005564 Bacteria 1416
78 Ga0070664_100577770 3300005564 Bacteria 1041
79 Ga0068857_100063193 3300005577 Bacteria 3291
80 Ga0068857_100069250 3300005577 Bacteria 3142
81 Ga0068854_100000469 3300005578 Bacteria 24902
82 Ga0068854_100003362 3300005578 Bacteria 9964
83 Ga0068854_100008248 3300005578 Bacteria 6689
84 Ga0068854_100292878 3300005578 Bacteria 1314
85 Ga0068856_100012503 3300005614 Bacteria 8217
86 Ga0068856_100310105 3300005614 Bacteria 1595
87 Ga0068852_100017888 3300005616 Bacteria 5572
88 Ga0068852_100194804 3300005616 Bacteria 1914
89 Ga0068852_100258931 3300005616 Bacteria 1670
90 Ga0068852_100353236 3300005616 Bacteria 1436
91 Ga0068852_100427178 3300005616 Bacteria 1308
92 Ga0068852_100690916 3300005616 Bacteria 1030
93 Ga0068852_101749664 3300005616 Bacteria 644
94 Ga0068859_100003919 3300005617 Bacteria 15197
95 Ga0068859_100082152 3300005617 Bacteria 3265
96 Ga0068859_100206719 3300005617 Bacteria 2048
97 Ga0068864_100087440 3300005618 Bacteria 2744
98 Ga0068864_102188029 3300005618 Bacteria 559
99 Ga0068870_10874256 3300005840 Bacteria 633
100 Ga0068863_100007404 3300005841 Bacteria 10742
101 Ga0068863_100041914 3300005841 Bacteria 4351
102 Ga0068863_100079671 3300005841 Bacteria 3102
103 Ga0068863_101298669 3300005841 Bacteria 734
104 Ga0068863_102087401 3300005841 Bacteria 577
105 Ga0068858_100026501 3300005842 Bacteria 5384
106 Ga0068858_100027618 3300005842 Bacteria 5272
107 Ga0068858_100040014 3300005842 Bacteria 4347
108 Ga0068858_100212524 3300005842 Bacteria 1831
109 Ga0068860_100047026 3300005843 Bacteria 4113
110 Ga0068860_100108644 3300005843 Bacteria 2651
111 Ga0068860_100166041 3300005843 Bacteria 2131
112 Ga0068860_100188476 3300005843 Bacteria 1995
113 Ga0068862_100006597 3300005844 Bacteria 9624
114 Ga0068862_100113733 3300005844 Bacteria 2378
115 Ga0075368_10000096 3300006042 Bacteria 22180
116 Ga0075363_100000887 3300006048 Bacteria 10536
117 Ga0075363_100010277 3300006048 Bacteria 4435
118 Ga0075364_10019446 3300006051 Bacteria 4263
119 Ga0075364_10034760 3300006051 Bacteria 3255
120 Ga0075432_10018325 3300006058 Bacteria 2388
121 Ga0075362_10000096 3300006177 Bacteria 24783
122 Ga0075362_10000884 3300006177 Bacteria 9088
123 Ga0075362_10142809 3300006177 Bacteria 1145
124 Ga0075369_10005036 3300006186 Bacteria 4921
125 Ga0075369_10005141 3300006186 Bacteria 4874
126 Ga0075369_10050491 3300006186 Bacteria 1799
127 Ga0075366_10000425 3300006195 Bacteria 19753
128 Ga0075370_10000003 3300006353 Bacteria 133163
129 Ga0075370_10109004 3300006353 Bacteria 1607
130 Ga0075370_10166257 3300006353 Bacteria 1296
131 Ga0097620_100003919 3300006931 Bacteria 15197
132 Ga0097620_100082152 3300006931 Bacteria 3265
133 Ga0097620_100206714 3300006931 Bacteria 2048
134 Ga0105251_10000528 3300009011 Bacteria 36047
135 Ga0105251_10015188 3300009011 Bacteria 4220
136 Ga0105250_10005950 3300009092 Bacteria 5390
137 Ga0105240_10079593 3300009093 Bacteria 4032
138 Ga0111539_10202047 3300009094 Bacteria 2317
139 Ga0105247_10062199 3300009101 Bacteria 2315
140 Ga0105247_10553353 3300009101 Bacteria 846
141 Ga0114129_11284325 3300009147 Bacteria 908
142 Ga0105243_10023056 3300009148 Bacteria 4736
143 Ga0105241_10628220 3300009174 Bacteria 973
144 Ga0105248_10003448 3300009177 Bacteria 17558
145 Ga0105248_10063561 3300009177 Bacteria 4143
146 Ga0105248_10249484 3300009177 Bacteria 1998
147 Ga0105248_10262198 3300009177 Bacteria 1945
148 Ga0105237_11736336 3300009545 Bacteria 631
149 Ga0105238_10096973 3300009551 Bacteria 2934
150 Ga0105249_12707114 3300009553 Bacteria 568
151 Ga0105246_10000103 3300011119 Bacteria 37033
152 Ga0157373_10260191 3300013100 Bacteria 1228
153 Ga0157371_10005523 3300013102 Bacteria 10641
154 Ga0157371_10016044 3300013102 Bacteria 5601
155 Ga0157371_10115713 3300013102 Bacteria 1905
156 Ga0157371_10480381 3300013102 Bacteria 916
157 Ga0157370_10005079 3300013104 Bacteria 14842
158 Ga0157370_11072479 3300013104 Bacteria 728
159 Ga0157369_10033224 3300013105 Bacteria 5671
160 Ga0157374_10795236 3300013296 Bacteria 961
161 Ga0163162_10521915 3300013306 Bacteria 1317
162 Ga0163162_10601955 3300013306 Bacteria 1225
163 Ga0157372_10027621 3300013307 Bacteria 6183
164 Ga0157372_10115862 3300013307 Bacteria 3072
165 Ga0157375_10433102 3300013308 Bacteria 1481
166 Ga0157375_12443195 3300013308 Bacteria 624
167 Ga0157380_11267268 3300014326 Bacteria 783
168 Ga0157379_10347782 3300014968 Bacteria 1357
169 Ga0163161_10025927 3300017792 Bacteria 4150
170 Ga0209050_1000119 3300025298 Bacteria 200661
171 Ga0207713_1002344 3300025735 Bacteria 13899
172 Ga0207713_1010702 3300025735 Bacteria 5053
173 Ga0207710_10017590 3300025900 Bacteria 3032
174 Ga0207710_10025255 3300025900 Bacteria 2563
175 Ga0207710_10383917 3300025900 Bacteria 719
176 Ga0207680_10447887 3300025903 Bacteria 916
177 Ga0207647_10015636 3300025904 Bacteria 5195
178 Ga0207705_10000023 3300025909 Bacteria 301755
179 Ga0207705_10020483 3300025909 Bacteria 4724
180 Ga0207705_10039289 3300025909 Bacteria 3391
181 Ga0207705_10295957 3300025909 Bacteria 1240
182 Ga0207705_10318140 3300025909 Bacteria 1195
183 Ga0207705_10940883 3300025909 Bacteria 669
184 Ga0207707_10100224 3300025912 Bacteria 2531
185 Ga0207695_10026492 3300025913 Bacteria 6471
186 Ga0207660_10147368 3300025917 Bacteria 1805
187 Ga0207657_10000081 3300025919 Bacteria 90714
188 Ga0207657_10018242 3300025919 Bacteria 6710
189 Ga0207657_10313408 3300025919 Bacteria 1241
190 Ga0207657_10425631 3300025919 Bacteria 1043
191 Ga0207649_10189211 3300025920 Bacteria 1446
192 Ga0207649_10442580 3300025920 Bacteria 979
193 Ga0207652_10002119 3300025921 Bacteria 17031
194 Ga0207652_10104402 3300025921 Bacteria 2507
195 Ga0207652_10135524 3300025921 Bacteria 2199
196 Ga0207652_10705625 3300025921 Bacteria 900
197 Ga0207652_10849206 3300025921 Bacteria 809
198 Ga0207681_10000441 3300025923 Bacteria 29051
199 Ga0207681_10000968 3300025923 Bacteria 18725
200 Ga0207681_10002663 3300025923 Bacteria 11318
201 Ga0207694_10107459 3300025924 Bacteria 2217
202 Ga0207650_10382418 3300025925 Bacteria 1162
203 Ga0207650_10665213 3300025925 Bacteria 878
204 Ga0207644_10000003 3300025931 Bacteria 585905
205 Ga0207644_10000963 3300025931 Bacteria 18367
206 Ga0207644_10004863 3300025931 Bacteria 8746
207 Ga0207644_10067139 3300025931 Bacteria 2613
208 Ga0207644_11789281 3300025931 Bacteria 514
209 Ga0207690_10012575 3300025932 Bacteria 5066
210 Ga0207690_10240162 3300025932 Bacteria 1395
211 Ga0207690_10362625 3300025932 Bacteria 1148
212 Ga0207690_11037161 3300025932 Bacteria 683
213 Ga0207706_10000112 3300025933 Bacteria 87100
214 Ga0207706_10030012 3300025933 Bacteria 4852
215 Ga0207706_10041101 3300025933 Bacteria 4100
216 Ga0207711_10003944 3300025941 Bacteria 12763
217 Ga0207711_10208629 3300025941 Bacteria 1784
218 Ga0207711_11082185 3300025941 Bacteria 742
219 Ga0207661_10149298 3300025944 Bacteria 2019
220 Ga0207679_10049535 3300025945 Bacteria 3065
221 Ga0207667_10019917 3300025949 Bacteria 7476
222 Ga0207667_10028160 3300025949 Bacteria 6103
223 Ga0207667_10051456 3300025949 Bacteria 4342
224 Ga0207667_10064908 3300025949 Bacteria 3809
225 Ga0207667_10229194 3300025949 Bacteria 1903
226 Ga0207712_10000109 3300025961 Bacteria 92018
227 Ga0207712_10262132 3300025961 Bacteria 1402
228 Ga0207712_11585569 3300025961 Bacteria 587
229 Ga0207668_10002601 3300025972 Bacteria 10560
230 Ga0207668_10004669 3300025972 Bacteria 8061
231 Ga0207668_10754146 3300025972 Bacteria 859
232 Ga0207668_11448926 3300025972 Bacteria 619
233 Ga0207668_11838115 3300025972 Bacteria 546
234 Ga0207640_10000394 3300025981 Bacteria 27805
235 Ga0207640_10000980 3300025981 Bacteria 15853
236 Ga0207640_10022065 3300025981 Bacteria 3805
237 Ga0207640_10639739 3300025981 Bacteria 905
238 Ga0207658_10000247 3300025986 Bacteria 56367
239 Ga0207658_10001670 3300025986 Bacteria 16897
240 Ga0207658_10007062 3300025986 Bacteria 7646
241 Ga0207658_10106481 3300025986 Bacteria 2208
242 Ga0207703_10018420 3300026035 Bacteria 5453
243 Ga0207703_10027509 3300026035 Bacteria 4479
244 Ga0207703_10087642 3300026035 Bacteria 2610
245 Ga0207639_10012185 3300026041 Bacteria 5983
246 Ga0207639_10070966 3300026041 Bacteria 2723
247 Ga0207639_10238228 3300026041 Bacteria 1581
248 Ga0207678_10008026 3300026067 Bacteria 9304
249 Ga0207678_10077872 3300026067 Bacteria 2840
250 Ga0207678_10375781 3300026067 Bacteria 1228
251 Ga0207702_10019818 3300026078 Bacteria 5570
252 Ga0207702_10876381 3300026078 Bacteria 889
253 Ga0207641_10005987 3300026088 Bacteria 10307
254 Ga0207641_10026854 3300026088 Bacteria 4754
255 Ga0207641_11615105 3300026088 Bacteria 650
256 Ga0207676_10399535 3300026095 Bacteria 1284
257 Ga0207674_10089460 3300026116 Bacteria 3071
258 Ga0207674_10116854 3300026116 Bacteria 2638
259 Ga0207674_10251790 3300026116 Bacteria 1713
260 Ga0207698_10000141 3300026142 Bacteria 45510
261 Ga0207698_10353771 3300026142 Bacteria 1388
262 Ga0207698_10384142 3300026142 Bacteria 1337
263 Ga0207698_10443806 3300026142 Bacteria 1251
264 Ga0207698_10599189 3300026142 Bacteria 1086
265 Ga0207698_10710774 3300026142 Bacteria 1001
266 Ga0207698_10954742 3300026142 Bacteria 866
267 Ga0209999_1025986 3300027543 Bacteria 1082
268 Ga0209983_1017576 3300027665 Bacteria 1481
269 Ga0209813_10000013 3300027866 Bacteria 89768
270 Ga0209974_10002037 3300027876 Bacteria 7383
271 Ga0207428_10075692 3300027907 Bacteria 2637
272 Ga0207428_10230132 3300027907 Bacteria 1387
273 Ga0268266_10000888 3300028379 Bacteria 38725
274 Ga0268266_10036781 3300028379 Bacteria 4170
275 Ga0268266_10568651 3300028379 Bacteria 1087
276 Ga0268265_10000082 3300028380 Bacteria 120835
277 Ga0268265_10004102 3300028380 Bacteria 10240
278 Ga0268265_10036925 3300028380 Bacteria 3582
279 Ga0268265_10058803 3300028380 Bacteria 2937
280 Ga0268264_10007612 3300028381 Bacteria 9030
281 Ga0268264_10018729 3300028381 Bacteria 5662
282 Ga0268264_10020062 3300028381 Bacteria 5462
283 Ga0268264_10132922 3300028381 Bacteria 2209
284 Ga0265326_10044594 3300028558 Bacteria 1258
285 Ga0265334_10129652 3300028573 Bacteria 898
286 Ga0265327_10034268 3300031251 Bacteria 2820
287 Ga0307408_100006324 3300031548 Bacteria 7863
288 Ga0307408_100269467 3300031548 Bacteria 1413
289 Ga0307405_10089334 3300031731 Bacteria 2035
290 Ga0307405_10135792 3300031731 Bacteria 1707
291 Ga0307405_10635229 3300031731 Bacteria 876
292 Ga0307405_11191134 3300031731 Bacteria 658
293 Ga0316577_10152849 3300031733 Bacteria 1301
294 Ga0307413_10062972 3300031824 Bacteria 2298
295 Ga0307413_10304416 3300031824 Bacteria 1210
296 Ga0307413_10368022 3300031824 Bacteria 1115
297 Ga0307413_10681758 3300031824 Bacteria 851
298 Ga0307410_10153229 3300031852 Bacteria 1718
299 Ga0307406_10066802 3300031901 Bacteria 2342
300 Ga0307406_10075557 3300031901 Bacteria 2223
301 Ga0307406_10613457 3300031901 Bacteria 898
302 Ga0307406_10822737 3300031901 Bacteria 785
303 Ga0307407_10025397 3300031903 Bacteria 3121
304 Ga0307412_10062513 3300031911 Bacteria 2507
305 Ga0307412_10131776 3300031911 Bacteria 1817
306 Ga0307412_10346920 3300031911 Bacteria 1190
307 Ga0307412_10806729 3300031911 Bacteria 815
308 Ga0307412_11043374 3300031911 Bacteria 724
309 Ga0307409_100104252 3300031995 Bacteria 2361
310 Ga0307409_100149019 3300031995 Bacteria 2028
311 Ga0307409_100595087 3300031995 Bacteria 1092
312 Ga0307416_100080212 3300032002 Bacteria 2753
313 Ga0307416_100118638 3300032002 Bacteria 2351
314 Ga0307416_100262144 3300032002 Bacteria 1690
315 Ga0307416_100684546 3300032002 Bacteria 1113
316 Ga0307416_101045322 3300032002 Bacteria 920
317 Ga0307416_101599058 3300032002 Bacteria 757
318 Ga0307416_101748795 3300032002 Bacteria 726
319 Ga0307416_102834104 3300032002 Bacteria 580
320 Ga0307414_10037439 3300032004 Bacteria 3248
321 Ga0307414_10181768 3300032004 Bacteria 1692
322 Ga0307414_10475571 3300032004 Bacteria 1101
323 Ga0307414_10542495 3300032004 Bacteria 1035
324 Ga0307414_10910172 3300032004 Bacteria 807
325 Ga0307411_10017044 3300032005 Bacteria 4126
326 Ga0307411_10190824 3300032005 Bacteria 1564
327 Ga0307411_10264341 3300032005 Bacteria 1360
328 Ga0307411_10374553 3300032005 Bacteria 1169
329 Ga0307411_10535215 3300032005 Bacteria 997
330 Ga0307411_11033239 3300032005 Bacteria 737
331 Ga0307415_100090140 3300032126 Bacteria 2217
332 Ga0307415_100108718 3300032126 Bacteria 2052
333 Ga0307415_100138619 3300032126 Bacteria 1854
334 Ga0307415_100256749 3300032126 Bacteria 1423
335 Ga0307415_101095170 3300032126 Bacteria 745
336 Ga0316583_10000951 3300032133 Bacteria 9324
337 Ga0373948_0028629 3300034817 Bacteria 1110
338 Ga0373928_0046337 3300035084 Bacteria 1014
339 Ga0373952_0024201 3300035092 Bacteria 1303
340 Ga0373932_0104166 3300035112 Bacteria 927
341 Ga0373962_0012660 3300035242 Bacteria 2129
342 Ga0373931_0025551 3300035691 Bacteria 3000
343 Ga0316582_0011932 3300036647 Bacteria 4828
344 Ga0316582_0319511 3300036647 Bacteria 1067
345 Ga0316584_0070878 3300036712 Bacteria 2612
346 Ga0316584_0101702 3300036712 Bacteria 2152
347 Ga0316584_0116444 3300036712 Bacteria 1999
348 Ga0439453_0009165 3300041408 Bacteria 1607
349 Ga0451837_0024481 3300041494 Bacteria 607
350 Ga0451837_0999491 3300041494 Bacteria 533
351 Ga0451841_0879509 3300041498 Bacteria 710
352 Ga0451855_0403470 3300041511 Bacteria 1086
353 Ga0451853_2193999 3300041512 Bacteria 665
354 Ga0451853_3878695 3300041512 Bacteria 861
355 Ga0439432_006611 3300042006 Bacteria 4131
356 Ga0450912_004097 3300042116 Bacteria 1068
357 Ga0450912_005521 3300042116 Bacteria 976
358 Ga0453684_0044010 3300044712 Bacteria 5986
359 Ga0495627_000599 3300046453 Bacteria 28763
360 Ga0495650_0000285 3300046471 Bacteria 95260
361 Ga0495639_0523860 3300046475 Bacteria 606
362 Ga0495585_0217250 3300046492 Bacteria 966
363 Ga0495596_0000621 3300046500 Bacteria 22273
364 Ga0495596_0002827 3300046500 Bacteria 9071
365 Ga0495607_0003651 3300046501 Bacteria 11685
366 Ga0495583_0364442 3300046506 Bacteria 569
367 Ga0495606_0047762 3300046507 Bacteria 2821
368 Ga0495610_0000020 3300046512 Bacteria 344007
369 Ga0495610_0000600 3300046512 Bacteria 35676
370 Ga0495620_0011522 3300046515 Bacteria 4611
371 Ga0495620_0031170 3300046515 Bacteria 2446
372 Ga0495632_0000915 3300046519 Bacteria 25910
373 Ga0495632_0081170 3300046519 Bacteria 1546
374 Ga0495643_0000351 3300046522 Bacteria 62687
375 Ga0495643_0003886 3300046522 Bacteria 10729
376 Ga0495643_0084084 3300046522 Bacteria 1651
377 Ga0495663_0262707 3300046525 Bacteria 615
378 Ga0495654_0062156 3300046530 Bacteria 1791
379 Ga0495609_0006701 3300046538 Bacteria 5841
380 Ga0495625_0011502 3300046660 Bacteria 7211
381 Ga0495625_0104400 3300046660 Bacteria 1943
382 Ga0495681_0000052 3300047470 Bacteria 106939
383 Ga0495686_0137229 3300047472 Bacteria 1446
384 Ga0495615_0000078 3300048090 Bacteria 29620
385 Ga0495626_0000450 3300048091 Bacteria 41919
386 Ga0496100_0006093 3300048903 Bacteria 6554
387 Ga0496101_0003045 3300048904 Bacteria 10341
388 Ga0496101_0543437 3300048904 Bacteria 918
389 Ga0496101_0996246 3300048904 Bacteria 659
390 Ga0496102_0000106 3300048905 Bacteria 118841
391 Ga0496102_0014312 3300048905 Bacteria 6894
392 Ga0496102_0169891 3300048905 Bacteria 2053
393 Ga0496102_0528633 3300048905 Bacteria 1102
394 Ga0496103_0000095 3300048906 Bacteria 98260
395 Ga0496103_0003597 3300048906 Bacteria 9457
396 Ga0496103_0171822 3300048906 Bacteria 1392
397 Ga0496104_0000060 3300048907 Bacteria 117966
398 Ga0496104_0037015 3300048907 Bacteria 4563
399 Ga0496104_0092450 3300048907 Bacteria 2892
400 Ga0496105_0000122 3300048908 Bacteria 52475
401 Ga0496105_0000751 3300048908 Bacteria 22003
402 Ga0496105_0194993 3300048908 Bacteria 1655
403 Ga0496106_0000950 3300048909 Bacteria 21126
404 Ga0496106_0247579 3300048909 Bacteria 1425
405 Ga0496107_0002226 3300048910 Bacteria 12479
406 Ga0496107_0025721 3300048910 Bacteria 4168
407 Ga0496108_0505003 3300048911 Bacteria 1056
408 Ga0496110_0027951 3300048913 Bacteria 4839
409 Ga0496110_0250907 3300048913 Bacteria 1610
410 Ga0496111_0102635 3300048914 Bacteria 2103
411 Ga0496112_0027217 3300048915 Bacteria 5514
412 Ga0496112_0525723 3300048915 Bacteria 1117
413 Ga0496112_1131798 3300048915 Bacteria 700
414 Ga0496113_0000260 3300048916 Bacteria 25008
415 Ga0496113_0002130 3300048916 Bacteria 11418
416 Ga0496114_0018945 3300048917 Bacteria 5575
417 Ga0496114_0542025 3300048917 Bacteria 1028
418 Ga0496115_0638152 3300048918 Bacteria 843
419 Ga0496116_0018872 3300048919 Bacteria 5297
420 Ga0496117_0003116 3300048920 Bacteria 19798
421 Ga0496117_0060870 3300048920 Bacteria 2599
422 Ga0496117_0070598 3300048920 Bacteria 2345
423 Ga0496117_0182103 3300048920 Bacteria 1206
424 Ga0496118_0110866 3300048921 Bacteria 1821
425 Ga0496118_0365225 3300048921 Bacteria 763
426 Ga0496119_0000222 3300048922 Bacteria 79824
427 Ga0496119_0097295 3300048922 Bacteria 1659
428 Ga0496119_0107629 3300048922 Bacteria 1554
429 Ga0496120_0001728 3300048923 Bacteria 24842
430 Ga0496121_0000022 3300048924 Bacteria 472849
431 Ga0496121_0000312 3300048924 Bacteria 101230
432 Ga0496121_0001702 3300048924 Bacteria 36100
433 Ga0496121_0002209 3300048924 Bacteria 30388
434 Ga0496121_0009760 3300048924 Bacteria 10977
435 Ga0496121_0452629 3300048924 Bacteria 827
436 Ga0496122_0001902 3300048925 Bacteria 31581
437 Ga0496122_0003824 3300048925 Bacteria 19369
438 Ga0496123_0002409 3300048926 Bacteria 23351
439 Ga0496123_0005132 3300048926 Bacteria 13352
440 Ga0496123_0008987 3300048926 Bacteria 9068
441 Ga0496123_0083693 3300048926 Bacteria 1928
442 Ga0496124_0001019 3300048927 Bacteria 44416
443 Ga0496124_0012893 3300048927 Bacteria 8206
444 Ga0496124_0031206 3300048927 Bacteria 4720
445 Ga0496124_0033968 3300048927 Bacteria 4482
446 Ga0496124_0147150 3300048927 Bacteria 1852
447 Ga0496124_0542826 3300048927 Bacteria 769
448 Ga0496124_0545673 3300048927 Bacteria 766
449 Ga0496125_0018983 3300048928 Bacteria 6506
450 Ga0496125_0032050 3300048928 Bacteria 4674
451 Ga0496125_0092459 3300048928 Bacteria 2262
452 Ga0496125_0120192 3300048928 Bacteria 1876
453 Ga0496125_0221021 3300048928 Bacteria 1220
454 Ga0496125_0762171 3300048928 Bacteria 505
455 Ga0496126_0000084 3300048929 Bacteria 217111
456 Ga0496126_0000294 3300048929 Bacteria 106327
457 Ga0496126_0008503 3300048929 Bacteria 11060
458 Ga0496126_0183765 3300048929 Bacteria 1774
459 Ga0496126_0233643 3300048929 Bacteria 1539
460 Ga0496126_0597431 3300048929 Bacteria 870
461 Ga0501034_0722963 3300049571 Bacteria 893
462 Ga0501036_0926414 3300049572 Bacteria 715
463 Ga0501047_0604064 3300049581 Bacteria 918
464 Ga0501070_0231723 3300049586 Bacteria 1513
465 Ga0501035_0423689 3300049822 Bacteria 1105
466 Ga0501035_1310196 3300049822 Bacteria 558
467 Ga0501044_0357064 3300049823 Bacteria 1380
468 Ga0501044_0402145 3300049823 Bacteria 1282
469 nmdc:mga03683_2413_c1 3300050489 Bacteria 5802
470 nmdc:mga03683_30_c1 3300050489 Bacteria 71765
471 nmdc:mga03n38_781_c1 3300050490 Bacteria 8455
472 nmdc:mga00v17_216408_c1 3300050491 Bacteria 1240
473 nmdc:mga00v17_5585_c1 3300050491 Bacteria 6631
474 nmdc:mga00v17_594811_c1 3300050491 Bacteria 713
475 nmdc:mga0yw44_247593_c1 3300050492 Bacteria 1186
476 nmdc:mga0k408_3_c1 3300050493 Bacteria 243777
477 nmdc:mga0k408_44678_c1 3300050493 Bacteria 2555
478 nmdc:mga0k408_634548_c1 3300050493 Unclassified 629
479 nmdc:mga0k408_79996_c1 3300050493 Bacteria 1913
480 nmdc:mga06z11_49_c1 3300050494 Bacteria 50406
481 nmdc:mga04h51_979_c1 3300050495 Bacteria 6603
482 nmdc:mga07m45_16_c1 3300050496 Bacteria 151695
483 nmdc:mga07m45_20733_c2 3300050496 Bacteria 3216
484 nmdc:mga07m45_6_c1 3300050496 Bacteria 260521
485 nmdc:mga08y16_453805_c1 3300050511 Bacteria 1307
486 nmdc:mga08y16_827820_c1 3300050511 Bacteria 916
487 nmdc:mga0sz30_23939_c2 3300050516 Bacteria 1799
488 nmdc:mga0sz30_4905_c1 3300050516 Bacteria 4874
489 nmdc:mga0sz30_638_c1 3300050516 Bacteria 12975
490 Ga0500643_000001 3300053087 Bacteria 1440111
491 Ga0500647_0112522 3300053091 Bacteria 1293
492 Ga0500651_0576363 3300053093 Bacteria 613
493 Ga0500641_0024063 3300053096 Bacteria 2346
494 Ga0500562_062367 3300053108 Bacteria 1002
495 Ga0500572_213960 3300053111 Bacteria 631
496 Ga0500593_161403 3300053117 Bacteria 856
497 Ga0500607_000442 3300053121 Bacteria 39777
498 Ga0500608_272295 3300053122 Bacteria 646
499 Ga0500614_021586 3300053123 Bacteria 1495
500 Ga0500618_002611 3300053125 Bacteria 6639
501 Ga0500559_0072849 3300053136 Bacteria 1549
502 Ga0500559_0140196 3300053136 Bacteria 1132
503 Ga0500564_000556 3300053138 Bacteria 11222
504 Ga0500573_0022590 3300053140 Bacteria 3609
505 Ga0500577_0077329 3300053142 Bacteria 1319
506 Ga0500588_0179584 3300053146 Bacteria 778
507 Ga0500590_021528 3300053148 Bacteria 3347
508 Ga0500604_0236431 3300053151 Bacteria 631
509 Ga0500616_0218561 3300053153 Bacteria 832
510 Ga0500630_048597 3300053159 Bacteria 2055
511 Ga0500567_000268 3300053723 Bacteria 16135
512 Ga0500625_000041 3300053729 Bacteria 35224
513 Ga0500645_008868 3300053730 Bacteria 3405
514 2511126145 2510917021 Bacteria 5705459
515 2643949651 2643221588 Bacteria 3692460
516 2738712544 2738541275 Bacteria 4830863
517 2738850968 2738541301 Bacteria 4834102
518 2738866698 2738541304 Bacteria 4833665
519 2739299215 2738543022 Bacteria 4835059
520 2739360894 2738543033 Bacteria 4833336
521 2739650398 2739367664 Bacteria 4114334
522 2740028871 2739367865 Bacteria 4114482
523 2819552709 2818991438 Bacteria 5793701
524 2848298430 2848297114 Bacteria 3608511
525 2896184522 2896184354 Bacteria 3258548
526 2896256599 2896253425 Bacteria 3418029
527 2919139943 2919138771 Bacteria 5281312
528 2928103852 2928100450 Bacteria 4837635
529 2928961781 2928959182 Bacteria 4725774
530 3000865475 3000865235 Bacteria 3106258
531 8054302931 8054302542 Bacteria 5698134
532 Ga0496116_0000035
533 SwRhRL2b_contig_1843142
534 SwRhRL2b_contig_3651366
535 JGI24748J21848_1010770
536 JGI24751J29686_10000113
537 Ga0065704_10017573
538 Ga0065704_10070220
539 Ga0065704_10071310
540 Ga0065704_10261777
541 Ga0070658_10000652
542 Ga0070658_10029428
543 Ga0070658_10038879
544 Ga0070658_10298398
545 Ga0070683_100042459
546 Ga0070683_100665140
547 Ga0070670_100160735
548 Ga0070666_10060034
549 Ga0070680_100108284
550 Ga0070680_100512379
551 Ga0070680_100740024
552 Ga0070660_100001861
553 Ga0070660_100317848
554 Ga0070660_100667197
555 Ga0070660_101131540
556 Ga0070661_100000985
557 Ga0070661_100543403
558 Ga0070661_101086271
559 Ga0070668_100011227
560 Ga0070668_100012744
561 Ga0070668_100124411
562 Ga0070668_100362601
563 Ga0070668_100638156
564 Ga0070668_101435293
565 Ga0070669_100000062
566 Ga0070669_100002056
567 Ga0070669_100002134
568 Ga0070669_100516921
569 Ga0070671_100000914
570 Ga0070671_100007099
571 Ga0070671_100020944
572 Ga0070671_100064768
573 Ga0070688_101082686
574 Ga0070659_100027882
575 Ga0070659_100179264
576 Ga0070659_100522164
577 Ga0070659_101672310
578 Ga0070667_100000763
579 Ga0070667_100034468
580 Ga0070667_100037248
581 Ga0070667_100136298
582 Ga0070667_100212022
583 Ga0070663_100015742
584 Ga0070663_100326159
585 Ga0070662_100000786
586 Ga0070662_100003681
587 Ga0070662_100079741
588 Ga0070681_10113906
589 Ga0070685_10539288
590 Ga0070679_100257228
591 Ga0070679_100279669
592 Ga0070679_101065181
593 Ga0070684_100033155
594 Ga0070684_100343228
595 Ga0068853_100014582
596 Ga0068853_100080709
597 Ga0068853_100607415
598 Ga0070672_101044620
599 Ga0070696_101284993
600 Ga0070665_100001346
601 Ga0070665_100010491
602 Ga0070665_100102277
603 Ga0068855_100012551
604 Ga0068855_100070712
605 Ga0068855_100152364
606 Ga0068855_100603168
607 Ga0070664_100009676
608 Ga0070664_100315006
609 Ga0070664_100577770
610 Ga0068857_100063193
611 Ga0068857_100069250
612 Ga0068854_100000469
613 Ga0068854_100003362
614 Ga0068854_100008248
615 Ga0068854_100292878
616 Ga0068856_100012503
617 Ga0068856_100310105
618 Ga0068852_100017888
619 Ga0068852_100194804
620 Ga0068852_100258931
621 Ga0068852_100353236
622 Ga0068852_100427178
623 Ga0068852_100690916
624 Ga0068852_101749664
625 Ga0068859_100003919
626 Ga0068859_100082152
627 Ga0068859_100206719
628 Ga0068864_100087440
629 Ga0068864_102188029
630 Ga0068870_10874256
631 Ga0068863_100007404
632 Ga0068863_100041914
633 Ga0068863_100079671
634 Ga0068863_101298669
635 Ga0068863_102087401
636 Ga0068858_100026501
637 Ga0068858_100027618
638 Ga0068858_100040014
639 Ga0068858_100212524
640 Ga0068860_100047026
641 Ga0068860_100108644
642 Ga0068860_100166041
643 Ga0068860_100188476
644 Ga0068862_100006597
645 Ga0068862_100113733
646 Ga0075368_10000096
647 Ga0075363_100000887
648 Ga0075363_100010277
649 Ga0075364_10019446
650 Ga0075364_10034760
651 Ga0075432_10018325
652 Ga0075362_10000096
653 Ga0075362_10000884
654 Ga0075362_10142809
655 Ga0075369_10005036
656 Ga0075369_10005141
657 Ga0075369_10050491
658 Ga0075366_10000425
659 Ga0075370_10000003
660 Ga0075370_10109004
661 Ga0075370_10166257
662 Ga0097620_100003919
663 Ga0097620_100082152
664 Ga0097620_100206714
665 Ga0105251_10000528
666 Ga0105251_10015188
667 Ga0105250_10005950
668 Ga0105240_10079593
669 Ga0111539_10202047
670 Ga0105247_10062199
671 Ga0105247_10553353
672 Ga0114129_11284325
673 Ga0105243_10023056
674 Ga0105241_10628220
675 Ga0105248_10003448
676 Ga0105248_10063561
677 Ga0105248_10249484
678 Ga0105248_10262198
679 Ga0105237_11736336
680 Ga0105238_10096973
681 Ga0105249_12707114
682 Ga0105246_10000103
683 Ga0157373_10260191
684 Ga0157371_10005523
685 Ga0157371_10016044
686 Ga0157371_10115713
687 Ga0157371_10480381
688 Ga0157370_10005079
689 Ga0157370_11072479
690 Ga0157369_10033224
691 Ga0157374_10795236
692 Ga0163162_10521915
693 Ga0163162_10601955
694 Ga0157372_10027621
695 Ga0157372_10115862
696 Ga0157375_10433102
697 Ga0157375_12443195
698 Ga0157380_11267268
699 Ga0157379_10347782
700 Ga0163161_10025927
701 Ga0209050_1000119
702 Ga0207713_1002344
703 Ga0207713_1010702
704 Ga0207710_10017590
705 Ga0207710_10025255
706 Ga0207710_10383917
707 Ga0207680_10447887
708 Ga0207647_10015636
709 Ga0207705_10000023
710 Ga0207705_10020483
711 Ga0207705_10039289
712 Ga0207705_10295957
713 Ga0207705_10318140
714 Ga0207705_10940883
715 Ga0207707_10100224
716 Ga0207695_10026492
717 Ga0207660_10147368
718 Ga0207657_10000081
719 Ga0207657_10018242
720 Ga0207657_10313408
721 Ga0207657_10425631
722 Ga0207649_10189211
723 Ga0207649_10442580
724 Ga0207652_10002119
725 Ga0207652_10104402
726 Ga0207652_10135524
727 Ga0207652_10705625
728 Ga0207652_10849206
729 Ga0207681_10000441
730 Ga0207681_10000968
731 Ga0207681_10002663
732 Ga0207694_10107459
733 Ga0207650_10382418
734 Ga0207650_10665213
735 Ga0207644_10000003
736 Ga0207644_10000963
737 Ga0207644_10004863
738 Ga0207644_10067139
739 Ga0207644_11789281
740 Ga0207690_10012575
741 Ga0207690_10240162
742 Ga0207690_10362625
743 Ga0207690_11037161
744 Ga0207706_10000112
745 Ga0207706_10030012
746 Ga0207706_10041101
747 Ga0207711_10003944
748 Ga0207711_10208629
749 Ga0207711_11082185
750 Ga0207661_10149298
751 Ga0207679_10049535
752 Ga0207667_10019917
753 Ga0207667_10028160
754 Ga0207667_10051456
755 Ga0207667_10064908
756 Ga0207667_10229194
757 Ga0207712_10000109
758 Ga0207712_10262132
759 Ga0207712_11585569
760 Ga0207668_10002601
761 Ga0207668_10004669
762 Ga0207668_10754146
763 Ga0207668_11448926
764 Ga0207668_11838115
765 Ga0207640_10000394
766 Ga0207640_10000980
767 Ga0207640_10022065
768 Ga0207640_10639739
769 Ga0207658_10000247
770 Ga0207658_10001670
771 Ga0207658_10007062
772 Ga0207658_10106481
773 Ga0207703_10018420
774 Ga0207703_10027509
775 Ga0207703_10087642
776 Ga0207639_10012185
777 Ga0207639_10070966
778 Ga0207639_10238228
779 Ga0207678_10008026
780 Ga0207678_10077872
781 Ga0207678_10375781
782 Ga0207702_10019818
783 Ga0207702_10876381
784 Ga0207641_10005987
785 Ga0207641_10026854
786 Ga0207641_11615105
787 Ga0207676_10399535
788 Ga0207674_10089460
789 Ga0207674_10116854
790 Ga0207674_10251790
791 Ga0207698_10000141
792 Ga0207698_10353771
793 Ga0207698_10384142
794 Ga0207698_10443806
795 Ga0207698_10599189
796 Ga0207698_10710774
797 Ga0207698_10954742
798 Ga0209999_1025986
799 Ga0209983_1017576
800 Ga0209813_10000013
801 Ga0209974_10002037
802 Ga0207428_10075692
803 Ga0207428_10230132
804 Ga0268266_10000888
805 Ga0268266_10036781
806 Ga0268266_10568651
807 Ga0268265_10000082
808 Ga0268265_10004102
809 Ga0268265_10036925
810 Ga0268265_10058803
811 Ga0268264_10007612
812 Ga0268264_10018729
813 Ga0268264_10020062
814 Ga0268264_10132922
815 Ga0265326_10044594
816 Ga0265334_10129652
817 Ga0265327_10034268
818 Ga0307408_100006324
819 Ga0307408_100269467
820 Ga0307405_10089334
821 Ga0307405_10135792
822 Ga0307405_10635229
823 Ga0307405_11191134
824 Ga0316577_10152849
825 Ga0307413_10062972
826 Ga0307413_10304416
827 Ga0307413_10368022
828 Ga0307413_10681758
829 Ga0307410_10153229
830 Ga0307406_10066802
831 Ga0307406_10075557
832 Ga0307406_10613457
833 Ga0307406_10822737
834 Ga0307407_10025397
835 Ga0307412_10062513
836 Ga0307412_10131776
837 Ga0307412_10346920
838 Ga0307412_10806729
839 Ga0307412_11043374
840 Ga0307409_100104252
841 Ga0307409_100149019
842 Ga0307409_100595087
843 Ga0307416_100080212
844 Ga0307416_100118638
845 Ga0307416_100262144
846 Ga0307416_100684546
847 Ga0307416_101045322
848 Ga0307416_101599058
849 Ga0307416_101748795
850 Ga0307416_102834104
851 Ga0307414_10037439
852 Ga0307414_10181768
853 Ga0307414_10475571
854 Ga0307414_10542495
855 Ga0307414_10910172
856 Ga0307411_10017044
857 Ga0307411_10190824
858 Ga0307411_10264341
859 Ga0307411_10374553
860 Ga0307411_10535215
861 Ga0307411_11033239
862 Ga0307415_100090140
863 Ga0307415_100108718
864 Ga0307415_100138619
865 Ga0307415_100256749
866 Ga0307415_101095170
867 Ga0316583_10000951
868 Ga0373948_0028629
869 Ga0373928_0046337
870 Ga0373952_0024201
871 Ga0373932_0104166
872 Ga0373962_0012660
873 Ga0373931_0025551
874 Ga0316582_0011932
875 Ga0316582_0319511
876 Ga0316584_0070878
877 Ga0316584_0101702
878 Ga0316584_0116444
879 Ga0439453_0009165
880 Ga0451837_0024481
881 Ga0451837_0999491
882 Ga0451841_0879509
883 Ga0451855_0403470
884 Ga0451853_2193999
885 Ga0451853_3878695
886 Ga0439432_006611
887 Ga0450912_004097
888 Ga0450912_005521
889 Ga0453684_0044010
890 Ga0495627_000599
891 Ga0495650_0000285
892 Ga0495639_0523860
893 Ga0495585_0217250
894 Ga0495596_0000621
895 Ga0495596_0002827
896 Ga0495607_0003651
897 Ga0495583_0364442
898 Ga0495606_0047762
899 Ga0495610_0000020
900 Ga0495610_0000600
901 Ga0495620_0011522
902 Ga0495620_0031170
903 Ga0495632_0000915
904 Ga0495632_0081170
905 Ga0495643_0000351
906 Ga0495643_0003886
907 Ga0495643_0084084
908 Ga0495663_0262707
909 Ga0495654_0062156
910 Ga0495609_0006701
911 Ga0495625_0011502
912 Ga0495625_0104400
913 Ga0495681_0000052
914 Ga0495686_0137229
915 Ga0495615_0000078
916 Ga0495626_0000450
917 Ga0496100_0006093
918 Ga0496101_0003045
919 Ga0496101_0543437
920 Ga0496101_0996246
921 Ga0496102_0000106
922 Ga0496102_0014312
923 Ga0496102_0169891
924 Ga0496102_0528633
925 Ga0496103_0000095
926 Ga0496103_0003597
927 Ga0496103_0171822
928 Ga0496104_0000060
929 Ga0496104_0037015
930 Ga0496104_0092450
931 Ga0496105_0000122
932 Ga0496105_0000751
933 Ga0496105_0194993
934 Ga0496106_0000950
935 Ga0496106_0247579
936 Ga0496107_0002226
937 Ga0496107_0025721
938 Ga0496108_0505003
939 Ga0496110_0027951
940 Ga0496110_0250907
941 Ga0496111_0102635
942 Ga0496112_0027217
943 Ga0496112_0525723
944 Ga0496112_1131798
945 Ga0496113_0000260
946 Ga0496113_0002130
947 Ga0496114_0018945
948 Ga0496114_0542025
949 Ga0496115_0638152
950 Ga0496116_0018872
951 Ga0496117_0003116
952 Ga0496117_0060870
953 Ga0496117_0070598
954 Ga0496117_0182103
955 Ga0496118_0110866
956 Ga0496118_0365225
957 Ga0496119_0000222
958 Ga0496119_0097295
959 Ga0496119_0107629
960 Ga0496120_0001728
961 Ga0496121_0000022
962 Ga0496121_0000312
963 Ga0496121_0001702
964 Ga0496121_0002209
965 Ga0496121_0009760
966 Ga0496121_0452629
967 Ga0496122_0001902
968 Ga0496122_0003824
969 Ga0496123_0002409
970 Ga0496123_0005132
971 Ga0496123_0008987
972 Ga0496123_0083693
973 Ga0496124_0001019
974 Ga0496124_0012893
975 Ga0496124_0031206
976 Ga0496124_0033968
977 Ga0496124_0147150
978 Ga0496124_0542826
979 Ga0496124_0545673
980 Ga0496125_0018983
981 Ga0496125_0032050
982 Ga0496125_0092459
983 Ga0496125_0120192
984 Ga0496125_0221021
985 Ga0496125_0762171
986 Ga0496126_0000084
987 Ga0496126_0000294
988 Ga0496126_0008503
989 Ga0496126_0183765
990 Ga0496126_0233643
991 Ga0496126_0597431
992 Ga0501034_0722963
993 Ga0501036_0926414
994 Ga0501047_0604064
995 Ga0501070_0231723
996 Ga0501035_0423689
997 Ga0501035_1310196
998 Ga0501044_0357064
999 Ga0501044_0402145
1000 nmdc:mga03683_2413_c1
1001 nmdc:mga03683_30_c1
1002 nmdc:mga03n38_781_c1
1003 nmdc:mga00v17_216408_c1
1004 nmdc:mga00v17_5585_c1
1005 nmdc:mga00v17_594811_c1
1006 nmdc:mga0yw44_247593_c1
1007 nmdc:mga0k408_3_c1
1008 nmdc:mga0k408_44678_c1
1009 nmdc:mga0k408_634548_c1
1010 nmdc:mga0k408_79996_c1
1011 nmdc:mga06z11_49_c1
1012 nmdc:mga04h51_979_c1
1013 nmdc:mga07m45_16_c1
1014 nmdc:mga07m45_20733_c2
1015 nmdc:mga07m45_6_c1
1016 nmdc:mga08y16_453805_c1
1017 nmdc:mga08y16_827820_c1
1018 nmdc:mga0sz30_23939_c2
1019 nmdc:mga0sz30_4905_c1
1020 nmdc:mga0sz30_638_c1
1021 Ga0500643_000001
1022 Ga0500647_0112522
1023 Ga0500651_0576363
1024 Ga0500641_0024063
1025 Ga0500562_062367
1026 Ga0500572_213960
1027 Ga0500593_161403
1028 Ga0500607_000442
1029 Ga0500608_272295
1030 Ga0500614_021586
1031 Ga0500618_002611
1032 Ga0500559_0072849
1033 Ga0500559_0140196
1034 Ga0500564_000556
1035 Ga0500573_0022590
1036 Ga0500577_0077329
1037 Ga0500588_0179584
1038 Ga0500590_021528
1039 Ga0500604_0236431
1040 Ga0500616_0218561
1041 Ga0500630_048597
1042 Ga0500567_000268
1043 Ga0500625_000041
1044 Ga0500645_008868
1045 2511126145
1046 2643949651
1047 2738712544
1048 2738850968
1049 2738866698
1050 2739299215
1051 2739360894
1052 2739650398
1053 2740028871
1054 2819552709
1055 2848298430
1056 2896184522
1057 2896256599
1058 2919139943
1059 2928103852
1060 2928961781
1061 3000865475
1062 8054302931

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

17

144

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.8808 36 125
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.8257 47 124
1z9f-assembly1.cif.gz_A crystal structure of single stranded dna-binding protein (tm0604) from thermotoga maritima at 2.60 a resolution 0.806 54 125
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.7918 36 125
8c5y-assembly1.cif.gz_B rpa tetrameric supercomplex from pyrococcus abyssi 0.7885 54 125
ID Description Score Start End Superfamily
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8808 36 125 2.40.50.140
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8257 47 124 2.40.50.140
af_P04994_10_103_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8224 54 122 2.40.50.140
1z9fA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.806 54 125 2.40.50.140
af_I1KPU2_29_132_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7941 51 124 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A5W4VQ91-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.9252 32 123 GO:0005886
GO:0017004
GO:0020037
AF-A0A2E9XLC0-F1-model_v4 Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) 0.9188 3 134 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A3A4TUR0-F1-model_v4 Cytochrome c maturation protein CcmE 0.9126 4 129 GO:0005886
GO:0017004
GO:0020037
AF-A0A0F8Z3P8-F1-model_v4 Cytochrome c-type biogenesis protein CcmE 0.9112 34 122 GO:0005886
GO:0017004
GO:0020037
AF-A0A2E1TKX0-F1-model_v4 Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) 0.9023 3 133 GO:0005886
GO:0017004
GO:0020037
GO:0046872

Map