F460190

General Info

Members Datasets Scaffolds Average Seq Length
531 259 531 248

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0154904|Ga0501034_0154904_688_1515
Length 275
Sequence VRGRRQAGAVSTSPALQITKSPTAGITMRLKLKIWRQAGPDSAGRLVDYVADDVSPDMSFLEMLDVVNENLLRKGEEAIAFDSDCREGICGMCSLVVNGIPHGPDRGTTVCQLHMRRFKDGDTITIEPWRARAFPVVKDLVVDRSAFDRIVAAGGYVSINCGGAPDGNAIPIPKEIAELAMDSAQCIACGACVAACKNASAHLFMGAKISQLSLLPQGQVERHRRVLSMIEQADAEGFGSCSNEAECEAVCPKEIPISNIARMTREYVKAILAAK

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
162 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
163 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
185 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
186 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
187 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
188 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.08
Rhizosphere 94.35
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10011144 3300002459 Bacteria 1854
2 Ga0065715_10098936 3300005293 Bacteria 3473
3 Ga0065715_10345576 3300005293 Bacteria 960
4 Ga0070658_10023619 3300005327 Bacteria 4933
5 Ga0070676_10006255 3300005328 Bacteria 6360
6 Ga0070676_10064781 3300005328 Bacteria 2180
7 Ga0070676_10136513 3300005328 Bacteria 1556
8 Ga0070690_100052481 3300005330 Bacteria 2606
9 Ga0070670_100112669 3300005331 Bacteria 2345
10 Ga0070670_100136809 3300005331 Bacteria 2117
11 Ga0070677_10062896 3300005333 Bacteria 1537
12 Ga0068869_100482244 3300005334 Bacteria 1033
13 Ga0070666_10036007 3300005335 Bacteria 3282
14 Ga0070666_10200820 3300005335 Bacteria 1403
15 Ga0070680_100189108 3300005336 Bacteria 1735
16 Ga0068868_100036623 3300005338 Bacteria 3800
17 Ga0068868_100777555 3300005338 Bacteria 862
18 Ga0070689_100142097 3300005340 Bacteria 1931
19 Ga0070689_100246615 3300005340 Bacteria 1473
20 Ga0070691_10001817 3300005341 Bacteria 9302
21 Ga0070692_10054100 3300005345 Bacteria 2095
22 Ga0070692_10288215 3300005345 Bacteria 998
23 Ga0070668_100091013 3300005347 Bacteria 2404
24 Ga0070669_100020427 3300005353 Bacteria 4730
25 Ga0070669_100158574 3300005353 Bacteria 1756
26 Ga0070669_100192244 3300005353 Bacteria 1601
27 Ga0070675_100000055 3300005354 Bacteria 68147
28 Ga0070675_100194031 3300005354 Bacteria 1761
29 Ga0070675_100807327 3300005354 Bacteria 858
30 Ga0070671_100104194 3300005355 Bacteria 2381
31 Ga0070671_100220534 3300005355 Bacteria 1609
32 Ga0070671_100263844 3300005355 Bacteria 1464
33 Ga0070671_100519871 3300005355 Bacteria 1025
34 Ga0070674_100008789 3300005356 Bacteria 6027
35 Ga0070674_100013152 3300005356 Bacteria 5106
36 Ga0070674_100236649 3300005356 Bacteria 1427
37 Ga0070674_100429616 3300005356 Bacteria 1086
38 Ga0070673_100138876 3300005364 Bacteria 2048
39 Ga0070673_100198822 3300005364 Bacteria 1726
40 Ga0070688_100080837 3300005365 Bacteria 2103
41 Ga0070659_100153437 3300005366 Bacteria 1880
42 Ga0070709_10065043 3300005434 Bacteria 2334
43 Ga0070714_100010088 3300005435 Bacteria 7453
44 Ga0070713_100138788 3300005436 Bacteria 2151
45 Ga0070701_10018366 3300005438 Bacteria 3285
46 Ga0070711_100449097 3300005439 Bacteria 1055
47 Ga0070705_100006979 3300005440 Bacteria 5554
48 Ga0070705_100111121 3300005440 Bacteria 1751
49 Ga0070705_100477987 3300005440 Bacteria 941
50 Ga0070700_100008749 3300005441 Bacteria 5525
51 Ga0070700_100114318 3300005441 Bacteria 1799
52 Ga0070694_100013957 3300005444 Bacteria 5023
53 Ga0070694_100206932 3300005444 Bacteria 1465
54 Ga0070708_100101940 3300005445 Bacteria 2629
55 Ga0070662_100184250 3300005457 Bacteria 1648
56 Ga0070681_10004061 3300005458 Bacteria 13821
57 Ga0070681_10075207 3300005458 Bacteria 3337
58 Ga0070681_10246622 3300005458 Bacteria 1699
59 Ga0070681_10284906 3300005458 Bacteria 1563
60 Ga0068867_100013036 3300005459 Bacteria 5883
61 Ga0068867_100487205 3300005459 Bacteria 1058
62 Ga0070706_100440109 3300005467 Bacteria 1213
63 Ga0070707_100208133 3300005468 Bacteria 1907
64 Ga0070698_100114994 3300005471 Bacteria 2655
65 Ga0070698_100575881 3300005471 Bacteria 1066
66 Ga0070699_100297815 3300005518 Bacteria 1447
67 Ga0070699_100306118 3300005518 Bacteria 1426
68 Ga0070699_100507559 3300005518 Bacteria 1096
69 Ga0070679_100032819 3300005530 Bacteria 5139
70 Ga0070679_100154007 3300005530 Bacteria 2274
71 Ga0070672_100174961 3300005543 Bacteria 1787
72 Ga0070686_100000926 3300005544 Bacteria 16872
73 Ga0070686_100025575 3300005544 Bacteria 3553
74 Ga0070695_100039144 3300005545 Bacteria 2995
75 Ga0070696_100009094 3300005546 Bacteria 6654
76 Ga0070696_100136601 3300005546 Bacteria 1788
77 Ga0070665_100007145 3300005548 Bacteria 11355
78 Ga0070665_100030260 3300005548 Bacteria 5449
79 Ga0070665_100426596 3300005548 Bacteria 1335
80 Ga0070704_100036172 3300005549 Bacteria 3362
81 Ga0068855_100329568 3300005563 Bacteria 1685
82 Ga0068854_100011885 3300005578 Bacteria 5687
83 Ga0068854_100036116 3300005578 Bacteria 3463
84 Ga0068854_100097722 3300005578 Bacteria 2196
85 Ga0068856_100104691 3300005614 Bacteria 2824
86 Ga0070702_100008320 3300005615 Bacteria 5017
87 Ga0070702_100287894 3300005615 Bacteria 1131
88 Ga0068852_100405379 3300005616 Bacteria 1342
89 Ga0068859_100042652 3300005617 Bacteria 4558
90 Ga0068859_100124386 3300005617 Bacteria 2647
91 Ga0068864_100022967 3300005618 Bacteria 5234
92 Ga0068864_100093617 3300005618 Bacteria 2654
93 Ga0068864_100268653 3300005618 Bacteria 1589
94 Ga0068866_10039630 3300005718 Bacteria 2327
95 Ga0068866_10309947 3300005718 Bacteria 989
96 Ga0068851_10127531 3300005834 Bacteria 1373
97 Ga0068863_100256964 3300005841 Bacteria 1688
98 Ga0068858_100000761 3300005842 Bacteria 33790
99 Ga0068858_100012172 3300005842 Bacteria 8110
100 Ga0068858_100093738 3300005842 Bacteria 2796
101 Ga0068860_100526005 3300005843 Bacteria 1183
102 Ga0068862_100011518 3300005844 Bacteria 7299
103 Ga0068862_100013148 3300005844 Bacteria 6846
104 Ga0068862_100064039 3300005844 Bacteria 3164
105 Ga0068862_100559551 3300005844 Bacteria 1093
106 Ga0081539_10006667 3300005985 Bacteria 10929
107 Ga0070716_100163231 3300006173 Bacteria 1446
108 Ga0070716_100278807 3300006173 Bacteria 1153
109 Ga0097621_100019394 3300006237 Bacteria 5218
110 Ga0097621_100113756 3300006237 Bacteria 2289
111 Ga0097621_100329518 3300006237 Bacteria 1354
112 Ga0068871_100002863 3300006358 Bacteria 11821
113 Ga0068871_100014197 3300006358 Bacteria 5930
114 Ga0068871_100028927 3300006358 Bacteria 4349
115 Ga0068871_100050250 3300006358 Bacteria 3373
116 Ga0068871_100542807 3300006358 Bacteria 1052
117 Ga0075428_100023790 3300006844 Bacteria 6778
118 Ga0075431_100096671 3300006847 Bacteria 3049
119 Ga0075431_100587193 3300006847 Bacteria 1099
120 Ga0075433_10083754 3300006852 Bacteria 2815
121 Ga0075433_10414204 3300006852 Bacteria 1188
122 Ga0075434_100007565 3300006871 Bacteria 10065
123 Ga0075434_100032315 3300006871 Bacteria 5161
124 Ga0075434_100042544 3300006871 Bacteria 4503
125 Ga0075434_100219087 3300006871 Bacteria 1923
126 Ga0075434_100898293 3300006871 Bacteria 901
127 Ga0075429_100285639 3300006880 Bacteria 1445
128 Ga0068865_100009647 3300006881 Bacteria 5987
129 Ga0068865_100049245 3300006881 Bacteria 2903
130 Ga0075436_100003532 3300006914 Bacteria 10721
131 Ga0075436_100014961 3300006914 Bacteria 5318
132 Ga0075436_100031703 3300006914 Bacteria 3641
133 Ga0075436_100057261 3300006914 Bacteria 2692
134 Ga0075436_100058897 3300006914 Bacteria 2653
135 Ga0097620_100042652 3300006931 Bacteria 4558
136 Ga0097620_100124390 3300006931 Bacteria 2647
137 Ga0075435_100000894 3300007076 Bacteria 18764
138 Ga0075435_100003390 3300007076 Bacteria 10807
139 Ga0075435_100007416 3300007076 Bacteria 7810
140 Ga0075435_100050091 3300007076 Bacteria 3360
141 Ga0075435_100060506 3300007076 Bacteria 3071
142 Ga0075435_100255007 3300007076 Bacteria 1494
143 Ga0075435_100318581 3300007076 Bacteria 1331
144 Ga0075435_100377511 3300007076 Bacteria 1217
145 Ga0105240_10060998 3300009093 Bacteria 4701
146 Ga0105240_10298819 3300009093 Bacteria 1842
147 Ga0105240_10463638 3300009093 Bacteria 1415
148 Ga0111539_10001440 3300009094 Bacteria 31737
149 Ga0111539_10004657 3300009094 Bacteria 17928
150 Ga0111539_10478565 3300009094 Bacteria 1450
151 Ga0111539_11057715 3300009094 Bacteria 943
152 Ga0105245_10035367 3300009098 Bacteria 4433
153 Ga0105245_10251108 3300009098 Bacteria 1718
154 Ga0105245_10269686 3300009098 Bacteria 1659
155 Ga0105245_10337853 3300009098 Bacteria 1488
156 Ga0105245_10375620 3300009098 Bacteria 1414
157 Ga0105245_10901617 3300009098 Bacteria 926
158 Ga0105247_10033321 3300009101 Bacteria 3133
159 Ga0114129_10005698 3300009147 Bacteria 17647
160 Ga0114129_10017539 3300009147 Bacteria 10193
161 Ga0114129_10018144 3300009147 Bacteria 10021
162 Ga0114129_10021621 3300009147 Bacteria 9131
163 Ga0114129_10080039 3300009147 Bacteria 4542
164 Ga0114129_10120934 3300009147 Bacteria 3604
165 Ga0114129_10380370 3300009147 Bacteria 1864
166 Ga0114129_10504499 3300009147 Bacteria 1580
167 Ga0114129_10521936 3300009147 Bacteria 1548
168 Ga0114129_10539314 3300009147 Bacteria 1519
169 Ga0114129_11184628 3300009147 Bacteria 952
170 Ga0105243_10014932 3300009148 Bacteria 5878
171 Ga0105243_10116206 3300009148 Bacteria 2247
172 Ga0105243_10141369 3300009148 Bacteria 2054
173 Ga0105243_10464179 3300009148 Bacteria 1191
174 Ga0105242_10016938 3300009176 Bacteria 5671
175 Ga0105242_10035935 3300009176 Bacteria 3973
176 Ga0105242_10056184 3300009176 Bacteria 3221
177 Ga0105242_10278006 3300009176 Bacteria 1519
178 Ga0105248_10010609 3300009177 Bacteria 10155
179 Ga0105248_10086656 3300009177 Bacteria 3523
180 Ga0105248_10144074 3300009177 Bacteria 2688
181 Ga0105248_10173430 3300009177 Bacteria 2431
182 Ga0105248_10225992 3300009177 Bacteria 2107
183 Ga0105248_10471220 3300009177 Bacteria 1416
184 Ga0105238_10055683 3300009551 Bacteria 3969
185 Ga0105238_10122850 3300009551 Bacteria 2576
186 Ga0105249_10480091 3300009553 Bacteria 1286
187 Ga0105249_10620165 3300009553 Bacteria 1137
188 Ga0157374_10174597 3300013296 Bacteria 2097
189 Ga0163162_10054054 3300013306 Bacteria 4038
190 Ga0163162_10995752 3300013306 Bacteria 947
191 Ga0157375_10121315 3300013308 Bacteria 2724
192 Ga0157375_10238222 3300013308 Bacteria 1979
193 Ga0157375_11129845 3300013308 Bacteria 918
194 Ga0163163_10003074 3300014325 Bacteria 14130
195 Ga0163163_10075540 3300014325 Bacteria 3363
196 Ga0163163_10160984 3300014325 Bacteria 2290
197 Ga0163163_10483625 3300014325 Bacteria 1299
198 Ga0163163_10661061 3300014325 Bacteria 1108
199 Ga0157380_10034411 3300014326 Bacteria 3908
200 Ga0157380_10283421 3300014326 Bacteria 1517
201 Ga0157379_10054969 3300014968 Bacteria 3557
202 Ga0157379_10177399 3300014968 Bacteria 1924
203 Ga0157379_10297347 3300014968 Bacteria 1471
204 Ga0157379_10307349 3300014968 Bacteria 1446
205 Ga0157379_10317828 3300014968 Bacteria 1421
206 Ga0157376_10006652 3300014969 Bacteria 8184
207 Ga0157376_10039331 3300014969 Bacteria 3856
208 Ga0157376_10192833 3300014969 Bacteria 1869
209 Ga0157376_10219183 3300014969 Bacteria 1761
210 Ga0157376_10473175 3300014969 Bacteria 1226
211 Ga0163161_10320298 3300017792 Bacteria 1226
212 Ga0207666_1006632 3300025271 Bacteria 1505
213 Ga0207642_10096783 3300025899 Bacteria 1472
214 Ga0207642_10101813 3300025899 Bacteria 1444
215 Ga0207642_10205402 3300025899 Bacteria 1091
216 Ga0207710_10005045 3300025900 Bacteria 5720
217 Ga0207680_10085159 3300025903 Bacteria 1996
218 Ga0207680_10104903 3300025903 Bacteria 1822
219 Ga0207685_10064368 3300025905 Bacteria 1464
220 Ga0207699_10026006 3300025906 Bacteria 3221
221 Ga0207645_10006009 3300025907 Bacteria 8732
222 Ga0207645_10006324 3300025907 Bacteria 8515
223 Ga0207645_10067745 3300025907 Bacteria 2282
224 Ga0207705_10046296 3300025909 Bacteria 3126
225 Ga0207654_10219741 3300025911 Bacteria 1260
226 Ga0207707_10009702 3300025912 Bacteria 8352
227 Ga0207707_10453123 3300025912 Bacteria 1098
228 Ga0207695_10124830 3300025913 Bacteria 2538
229 Ga0207660_10220743 3300025917 Bacteria 1487
230 Ga0207660_10393425 3300025917 Bacteria 1115
231 Ga0207662_10453221 3300025918 Bacteria 877
232 Ga0207657_10062935 3300025919 Bacteria 3174
233 Ga0207657_10409609 3300025919 Bacteria 1066
234 Ga0207649_10315995 3300025920 Bacteria 1146
235 Ga0207652_10026671 3300025921 Bacteria 4814
236 Ga0207652_10044785 3300025921 Bacteria 3771
237 Ga0207646_10144225 3300025922 Bacteria 2146
238 Ga0207646_10212269 3300025922 Bacteria 1748
239 Ga0207681_10035345 3300025923 Bacteria 3292
240 Ga0207681_10059847 3300025923 Bacteria 2612
241 Ga0207681_10072387 3300025923 Bacteria 2407
242 Ga0207694_10028442 3300025924 Bacteria 4261
243 Ga0207650_10130806 3300025925 Bacteria 1964
244 Ga0207650_10148890 3300025925 Bacteria 1846
245 Ga0207650_10237354 3300025925 Bacteria 1472
246 Ga0207659_10016524 3300025926 Bacteria 4804
247 Ga0207659_10033686 3300025926 Bacteria 3529
248 Ga0207659_10034662 3300025926 Bacteria 3482
249 Ga0207687_10024346 3300025927 Bacteria 4044
250 Ga0207687_10025557 3300025927 Bacteria 3952
251 Ga0207687_10582484 3300025927 Bacteria 941
252 Ga0207700_10058086 3300025928 Bacteria 2921
253 Ga0207700_10147170 3300025928 Bacteria 1943
254 Ga0207664_10074382 3300025929 Bacteria 2745
255 Ga0207644_10039686 3300025931 Bacteria 3324
256 Ga0207706_10068825 3300025933 Bacteria 3114
257 Ga0207706_10236414 3300025933 Bacteria 1597
258 Ga0207706_10243624 3300025933 Bacteria 1571
259 Ga0207706_10529905 3300025933 Bacteria 1015
260 Ga0207686_10050874 3300025934 Bacteria 2578
261 Ga0207686_10079226 3300025934 Bacteria 2139
262 Ga0207686_10127474 3300025934 Bacteria 1741
263 Ga0207686_10282682 3300025934 Bacteria 1225
264 Ga0207686_10411303 3300025934 Bacteria 1033
265 Ga0207709_10023381 3300025935 Bacteria 3517
266 Ga0207709_10052940 3300025935 Bacteria 2496
267 Ga0207670_10036808 3300025936 Bacteria 3186
268 Ga0207670_10130715 3300025936 Bacteria 1839
269 Ga0207670_10524035 3300025936 Bacteria 965
270 Ga0207669_10005445 3300025937 Bacteria 5711
271 Ga0207669_10043537 3300025937 Bacteria 2630
272 Ga0207669_10048881 3300025937 Bacteria 2517
273 Ga0207669_10154204 3300025937 Bacteria 1613
274 Ga0207704_10007412 3300025938 Bacteria 5182
275 Ga0207704_10354821 3300025938 Bacteria 1143
276 Ga0207691_10070971 3300025940 Bacteria 3144
277 Ga0207691_10225017 3300025940 Bacteria 1626
278 Ga0207691_10236733 3300025940 Bacteria 1579
279 Ga0207711_10017096 3300025941 Bacteria 6025
280 Ga0207711_10030248 3300025941 Bacteria 4567
281 Ga0207711_10111170 3300025941 Bacteria 2437
282 Ga0207711_10133113 3300025941 Bacteria 2231
283 Ga0207711_10314522 3300025941 Bacteria 1446
284 Ga0207689_10201565 3300025942 Bacteria 1642
285 Ga0207689_10427135 3300025942 Bacteria 1106
286 Ga0207661_10101252 3300025944 Bacteria 2420
287 Ga0207667_10076643 3300025949 Bacteria 3469
288 Ga0207651_10067185 3300025960 Bacteria 2522
289 Ga0207651_10077779 3300025960 Bacteria 2377
290 Ga0207712_10061429 3300025961 Bacteria 2667
291 Ga0207668_10041866 3300025972 Bacteria 3098
292 Ga0207668_10207359 3300025972 Bacteria 1565
293 Ga0207640_10010279 3300025981 Bacteria 5267
294 Ga0207640_10074736 3300025981 Bacteria 2295
295 Ga0207658_10018525 3300025986 Bacteria 4809
296 Ga0207658_10585320 3300025986 Bacteria 1001
297 Ga0207677_10093111 3300026023 Bacteria 2196
298 Ga0207677_10250165 3300026023 Bacteria 1439
299 Ga0207677_10460145 3300026023 Bacteria 1092
300 Ga0207703_10019414 3300026035 Bacteria 5311
301 Ga0207703_10065396 3300026035 Bacteria 2988
302 Ga0207703_10141179 3300026035 Bacteria 2091
303 Ga0207703_10539900 3300026035 Bacteria 1098
304 Ga0207708_10022453 3300026075 Bacteria 4765
305 Ga0207708_10234779 3300026075 Bacteria 1473
306 Ga0207702_10111114 3300026078 Bacteria 2437
307 Ga0207641_10035902 3300026088 Bacteria 4134
308 Ga0207641_10147286 3300026088 Bacteria 2130
309 Ga0207641_10483715 3300026088 Bacteria 1200
310 Ga0207648_10040162 3300026089 Bacteria 4112
311 Ga0207648_10050763 3300026089 Bacteria 3626
312 Ga0207648_10096952 3300026089 Bacteria 2581
313 Ga0207648_10140991 3300026089 Bacteria 2124
314 Ga0207676_10012077 3300026095 Bacteria 6181
315 Ga0207676_10072541 3300026095 Bacteria 2768
316 Ga0207676_10093749 3300026095 Bacteria 2472
317 Ga0207675_100059063 3300026118 Bacteria 3579
318 Ga0207675_100100460 3300026118 Bacteria 2725
319 Ga0207675_100158695 3300026118 Bacteria 2156
320 Ga0207675_100366124 3300026118 Bacteria 1415
321 Ga0209970_1030532 3300027614 Bacteria 935
322 Ga0209983_1060144 3300027665 Bacteria 839
323 Ga0209966_1052585 3300027695 Bacteria 869
324 Ga0207428_10015437 3300027907 Bacteria 6607
325 Ga0207428_10157424 3300027907 Bacteria 1727
326 Ga0207428_10221108 3300027907 Bacteria 1419
327 Ga0207428_10384762 3300027907 Bacteria 1029
328 Ga0268266_10014138 3300028379 Bacteria 6869
329 Ga0268266_10050461 3300028379 Bacteria 3570
330 Ga0268266_10158569 3300028379 Bacteria 2046
331 Ga0268265_10005659 3300028380 Bacteria 8538
332 Ga0268265_10008952 3300028380 Bacteria 6770
333 Ga0268265_10141024 3300028380 Bacteria 2018
334 Ga0268265_10379527 3300028380 Bacteria 1300
335 Ga0268264_10110219 3300028381 Bacteria 2410
336 Ga0307511_10168033 3300030521 Bacteria 1213
337 Ga0265316_10255161 3300031344 Bacteria 1287
338 Ga0307408_100132347 3300031548 Bacteria 1947
339 Ga0265314_10094341 3300031711 Bacteria 1940
340 Ga0307405_10044578 3300031731 Bacteria 2713
341 Ga0307413_10029767 3300031824 Bacteria 3060
342 Ga0307410_10036232 3300031852 Bacteria 3211
343 Ga0307410_10720221 3300031852 Bacteria 842
344 Ga0307407_10029802 3300031903 Bacteria 2936
345 Ga0307407_10042726 3300031903 Bacteria 2544
346 Ga0307412_10026630 3300031911 Bacteria 3596
347 Ga0307412_10491851 3300031911 Bacteria 1019
348 Ga0307416_100053163 3300032002 Bacteria 3248
349 Ga0307416_100061516 3300032002 Bacteria 3065
350 Ga0307416_100849313 3300032002 Bacteria 1011
351 Ga0307414_10028922 3300032004 Bacteria 3601
352 Ga0307414_10233615 3300032004 Bacteria 1518
353 Ga0307411_10008920 3300032005 Bacteria 5233
354 Ga0307411_10199489 3300032005 Bacteria 1535
355 Ga0307411_10201535 3300032005 Bacteria 1529
356 Ga0307415_100258967 3300032126 Bacteria 1418
357 Ga0373958_0005121 3300034819 Bacteria 1975
358 Ga0373958_0064206 3300034819 Bacteria 802
359 Ga0373926_0108247 3300035083 Bacteria 1043
360 Ga0373928_0003886 3300035084 Bacteria 2850
361 Ga0373929_0000476 3300035085 Bacteria 7687
362 Ga0373934_0025094 3300035086 Bacteria 2307
363 Ga0373940_0013537 3300035088 Bacteria 1976
364 Ga0373952_0002124 3300035092 Bacteria 3561
365 Ga0373923_0065476 3300035111 Bacteria 1551
366 Ga0373932_0000869 3300035112 Bacteria 8931
367 Ga0373939_0002902 3300035114 Bacteria 4030
368 Ga0373941_0000162 3300035115 Bacteria 12194
369 Ga0373941_0142473 3300035115 Bacteria 873
370 Ga0373953_0035314 3300035117 Bacteria 1964
371 Ga0373943_0014498 3300035170 Bacteria 3570
372 Ga0373943_0071261 3300035170 Bacteria 1761
373 Ga0373943_0141145 3300035170 Bacteria 1298
374 Ga0373946_0134067 3300035171 Bacteria 1142
375 Ga0373955_0011602 3300035172 Bacteria 4206
376 Ga0373961_0002875 3300035241 Bacteria 4367
377 Ga0373962_0001294 3300035242 Bacteria 5878
378 Ga0373924_0027127 3300035410 Bacteria 2276
379 Ga0373924_0066840 3300035410 Bacteria 1512
380 Ga0373931_0001425 3300035691 Bacteria 10252
381 Ga0373931_0385259 3300035691 Bacteria 885
382 Ga0373935_0094398 3300035692 Bacteria 1963
383 Ga0373933_0131920 3300035724 Bacteria 1572
384 Ga0373933_0158390 3300035724 Bacteria 1437
385 Ga0373937_0111499 3300036401 Bacteria 2545
386 Ga0373937_0201095 3300036401 Bacteria 1873
387 Ga0373937_0212161 3300036401 Bacteria 1822
388 Ga0373937_0547980 3300036401 Bacteria 1099
389 Ga0373925_0036446 3300037068 Bacteria 3630
390 Ga0373925_0125144 3300037068 Bacteria 1999
391 Ga0373925_0255474 3300037068 Bacteria 1406
392 Ga0395901_0736848 3300038443 Bacteria 980
393 Ga0436365_0196462 3300039437 Bacteria 1159
394 Ga0436365_1477503 3300039437 Bacteria 3169
395 Ga0439441_053999 3300042001 Bacteria 833
396 Ga0450894_001375 3300042131 Bacteria 3516
397 Ga0450896_001990 3300042133 Bacteria 2599
398 Ga0439435_0032138 3300042436 Bacteria 1431
399 Ga0439444_0028252 3300042437 Bacteria 1038
400 Ga0451577_0175182 3300042876 Bacteria 1933
401 Ga0439440_0024555 3300042993 Bacteria 1383
402 Ga0453683_0057214 3300044673 Bacteria 2440
403 Ga0453684_0041993 3300044712 Bacteria 6172
404 Ga0451576_0239178 3300045051 Bacteria 1897
405 Ga0451576_0276138 3300045051 Bacteria 1757
406 Ga0495592_0046686 3300046454 Bacteria 3228
407 Ga0495629_0549387 3300046459 Bacteria 775
408 Ga0495582_0078830 3300046473 Bacteria 1828
409 Ga0495639_0074794 3300046475 Bacteria 1570
410 Ga0495639_0152036 3300046475 Bacteria 1117
411 Ga0495662_0268754 3300046476 Bacteria 839
412 Ga0495608_0077000 3300046511 Bacteria 2171
413 Ga0495618_0262316 3300046514 Bacteria 1082
414 Ga0495628_0189513 3300046516 Bacteria 1553
415 Ga0495630_0065438 3300046517 Bacteria 2732
416 Ga0495652_0235221 3300046529 Bacteria 1367
417 Ga0495640_0061808 3300046533 Bacteria 2543
418 Ga0495640_0278053 3300046533 Bacteria 1043
419 Ga0495586_0362430 3300046535 Bacteria 833
420 Ga0495587_0198759 3300046536 Bacteria 1134
421 Ga0495621_0022242 3300046539 Bacteria 2100
422 Ga0495645_0004545 3300046543 Bacteria 9467
423 Ga0495645_0093654 3300046543 Bacteria 2143
424 Ga0495667_0092973 3300046559 Bacteria 1953
425 Ga0495634_0051230 3300046642 Bacteria 2771
426 Ga0495647_0071361 3300046681 Bacteria 1391
427 Ga0495647_0132184 3300046681 Bacteria 1058
428 Ga0495647_0175361 3300046681 Bacteria 930
429 Ga0495647_0190611 3300046681 Bacteria 896
430 Ga0495658_0014786 3300046683 Bacteria 3993
431 Ga0495658_0019658 3300046683 Bacteria 3529
432 Ga0495669_0004751 3300046684 Bacteria 5631
433 Ga0495613_0003530 3300046689 Bacteria 11718
434 Ga0495613_0178398 3300046689 Bacteria 1505
435 Ga0495600_0178298 3300046809 Bacteria 1369
436 Ga0495604_0035813 3300047317 Bacteria 3917
437 Ga0495674_0004626 3300047319 Bacteria 13230
438 Ga0495674_0049820 3300047319 Bacteria 3698
439 Ga0495674_0322592 3300047319 Bacteria 1258
440 Ga0495680_0106070 3300047322 Bacteria 2089
441 Ga0495675_0179514 3300047444 Bacteria 1297
442 Ga0495684_0000682 3300047471 Bacteria 27327
443 Ga0496100_0005884 3300048903 Bacteria 6641
444 Ga0496100_0413813 3300048903 Bacteria 1029
445 Ga0496101_0000222 3300048904 Bacteria 42490
446 Ga0496101_0115492 3300048904 Bacteria 2025
447 Ga0496104_0001478 3300048907 Bacteria 20272
448 Ga0496104_0012796 3300048907 Bacteria 7558
449 Ga0496104_0023018 3300048907 Bacteria 5725
450 Ga0496104_0264515 3300048907 Bacteria 1632
451 Ga0496104_0363191 3300048907 Bacteria 1360
452 Ga0496104_0573568 3300048907 Bacteria 1039
453 Ga0496105_0189990 3300048908 Bacteria 1680
454 Ga0496105_0291401 3300048908 Bacteria 1314
455 Ga0496107_0011835 3300048910 Bacteria 6093
456 Ga0496108_0225264 3300048911 Bacteria 1630
457 Ga0496110_0061241 3300048913 Bacteria 3321
458 Ga0496110_0817344 3300048913 Bacteria 837
459 Ga0496112_0014577 3300048915 Bacteria 7302
460 Ga0496112_0090825 3300048915 Bacteria 3023
461 Ga0496112_0109110 3300048915 Bacteria 2738
462 Ga0496112_0159093 3300048915 Bacteria 2225
463 Ga0496112_0414445 3300048915 Bacteria 1286
464 Ga0496113_0058705 3300048916 Bacteria 2896
465 Ga0496114_0000416 3300048917 Bacteria 31603
466 Ga0496114_0080527 3300048917 Bacteria 2751
467 Ga0496114_0289401 3300048917 Bacteria 1445
468 Ga0496115_0343797 3300048918 Bacteria 1217
469 Ga0496115_0422201 3300048918 Bacteria 1080
470 Ga0501034_0029753 3300049571 Bacteria 5552
471 Ga0501034_0154904 3300049571 Bacteria 2266
472 Ga0501043_0055792 3300049579 Bacteria 3104
473 Ga0501047_0005040 3300049581 Bacteria 12396
474 Ga0501047_0543817 3300049581 Bacteria 986
475 Ga0501067_0238662 3300049583 Bacteria 1012
476 Ga0501068_0253567 3300049584 Bacteria 1122
477 Ga0501069_0250502 3300049585 Bacteria 1033
478 Ga0501072_0299289 3300049588 Bacteria 1279
479 Ga0501073_0000842 3300049589 Bacteria 21848
480 Ga0501073_0140011 3300049589 Bacteria 1677
481 Ga0501074_0664230 3300049590 Bacteria 736
482 Ga0501075_0078051 3300049591 Bacteria 2507
483 Ga0501080_1033309 3300049742 Bacteria 712
484 Ga0501083_0303795 3300049744 Bacteria 1038
485 Ga0501044_0010338 3300049823 Bacteria 10131
486 Ga0501044_0361372 3300049823 Bacteria 1370
487 nmdc:mga05p37_173687_c1 3300050507 Bacteria 2626
488 nmdc:mga05p37_180383_c1 3300050507 Bacteria 2569
489 nmdc:mga05p37_31924_c1 3300050507 Bacteria 6438
490 nmdc:mga05p37_37393_c1 3300050507 Bacteria 5951
491 nmdc:mga05p37_3900_c2 3300050507 Bacteria 9812
492 nmdc:mga05p37_437388_c1 3300050507 Bacteria 1518
493 nmdc:mga05p37_56606_c2 3300050507 Bacteria 4434
494 nmdc:mga09592_255344_c1 3300050508 Bacteria 1519
495 nmdc:mga08y16_106682_c1 3300050511 Bacteria 2916
496 nmdc:mga08y16_18380_c1 3300050511 Bacteria 7369
497 nmdc:mga08y16_24143_c1 3300050511 Bacteria 6419
498 nmdc:mga08y16_506548_c1 3300050511 Bacteria 1226
499 nmdc:mga08y16_810171_c1 3300050511 Bacteria 929
500 nmdc:mga08y16_92293_c1 3300050511 Bacteria 3155
501 nmdc:mga0n895_129287_c1 3300050512 Bacteria 2550
502 nmdc:mga0n895_160033_c1 3300050512 Bacteria 2283
503 nmdc:mga0n895_16738_c1 3300050512 Bacteria 6737
504 nmdc:mga0n895_202086_c1 3300050512 Bacteria 2018
505 nmdc:mga0n895_50367_c1 3300050512 Bacteria 4083
506 nmdc:mga0n895_567_c1 3300050512 Bacteria 25311
507 nmdc:mga0rr50_104537_c1 3300050513 Bacteria 2231
508 nmdc:mga0rr50_114_c1 3300050513 Bacteria 44678
509 nmdc:mga0rr50_203514_c1 3300050513 Bacteria 1628
510 nmdc:mga0rr50_228976_c1 3300050513 Bacteria 1537
511 nmdc:mga0rr50_253177_c1 3300050513 Bacteria 1463
512 nmdc:mga0rr50_4071_c1 3300050513 Bacteria 8533
513 nmdc:mga0rr50_96164_c1 3300050513 Bacteria 2317
514 nmdc:mga08x19_16651_c1 3300050514 Bacteria 4486
515 nmdc:mga08x19_18247_c1 3300050514 Bacteria 4300
516 nmdc:mga08x19_19790_c1 3300050514 Bacteria 4137
517 nmdc:mga08x19_339232_c1 3300050514 Bacteria 1048
518 nmdc:mga08x19_5290_c1 3300050514 Bacteria 7632
519 nmdc:mga0a205_113353_c1 3300050515 Bacteria 2610
520 nmdc:mga0a205_292633_c1 3300050515 Bacteria 1503
521 nmdc:mga0a205_611882_c1 3300050515 Bacteria 942
522 nmdc:mga0a205_79619_c1 3300050515 Bacteria 2507
523 Ga0495601_0003363 3300053077 Bacteria 9157
524 Ga0495612_0081922 3300053078 Bacteria 1357
525 Ga0495595_0063838 3300053084 Bacteria 1730
526 Ga0495619_0001979 3300053085 Bacteria 13653
527 Ga0590071_001549 3300059421 Bacteria 6015
528 Ga0590074_007650 3300059423 Bacteria 1796
529 Ga0590075_000822 3300059424 Bacteria 8164
530 Ga0590075_060135 3300059424 Bacteria 979
531 Ga0590077_001087 3300059426 Bacteria 6731

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046475 Ga0495639_0074794 Ga0495639_0074794_823_1500 225
2 3300046476 Ga0495662_0268754 Ga0495662_0268754_74_751 225
3 3300046683 Ga0495658_0014786 Ga0495658_0014786_2759_3436 225
4 3300049590 Ga0501074_0664230 Ga0501074_0664230_41_721 226
5 3300049742 Ga0501080_1033309 Ga0501080_1033309_13_699 228
6 3300049823 Ga0501044_0361372 Ga0501044_0361372_437_1123 228
7 3300050513 nmdc:mga0rr50_253177_c1 nmdc:mga0rr50_253177_c1_436_1125 229
8 3300006847 Ga0075431_100587193 Ga0075431_1005871931 230
9 3300009147 Ga0114129_10504499 Ga0114129_105044992 230
10 3300025909 Ga0207705_10046296 Ga0207705_100462961 230
11 3300027614 Ga0209970_1030532 Ga0209970_10305322 230
12 3300032005 Ga0307411_10201535 Ga0307411_102015352 230
13 3300050511 nmdc:mga08y16_810171_c1 nmdc:mga08y16_810171_c1_207_899 230
14 3300035115 Ga0373941_0142473 Ga0373941_0142473_23_721 231
15 3300046475 Ga0495639_0152036 Ga0495639_0152036_333_1028 231
16 3300046535 Ga0495586_0362430 Ga0495586_0362430_22_717 231
17 3300048903 Ga0496100_0413813 Ga0496100_0413813_62_778 231
18 3300025923 Ga0207681_10035345 Ga0207681_100353452 232
19 3300050514 nmdc:mga08x19_18247_c1 nmdc:mga08x19_18247_c1_3446_4156 236
20 3300009147 Ga0114129_10539314 Ga0114129_105393142 238
21 3300050507 nmdc:mga05p37_437388_c1 nmdc:mga05p37_437388_c1_407_1156 238
22 3300009148 Ga0105243_10464179 Ga0105243_104641791 239
23 3300025927 Ga0207687_10024346 Ga0207687_100243464 239
24 3300014326 Ga0157380_10034411 Ga0157380_100344113 240
25 3300049584 Ga0501068_0253567 Ga0501068_0253567_212_961 240
26 3300005435 Ga0070714_100010088 Ga0070714_1000100883 242
27 3300025928 Ga0207700_10147170 Ga0207700_101471703 242
28 3300025929 Ga0207664_10074382 Ga0207664_100743822 242
29 3300027695 Ga0209966_1052585 Ga0209966_10525851 243
30 3300042437 Ga0439444_0028252 Ga0439444_0028252_98_847 243
31 3300042993 Ga0439440_0024555 Ga0439440_0024555_329_1078 243
32 3300049581 Ga0501047_0543817 Ga0501047_0543817_82_831 243
33 3300049589 Ga0501073_0000842 Ga0501073_0000842_11136_11873 245
34 3300005356 Ga0070674_100013152 Ga0070674_1000131522 246
35 3300005444 Ga0070694_100206932 Ga0070694_1002069321 246
36 3300025917 Ga0207660_10220743 Ga0207660_102207432 246
37 3300025937 Ga0207669_10043537 Ga0207669_100435373 246
38 3300031852 Ga0307410_10036232 Ga0307410_100362322 246
39 3300031903 Ga0307407_10042726 Ga0307407_100427263 246
40 3300031911 Ga0307412_10491851 Ga0307412_104918511 246
41 3300032002 Ga0307416_100061516 Ga0307416_1000615163 246
42 3300032005 Ga0307411_10199489 Ga0307411_101994892 246
43 3300049744 Ga0501083_0303795 Ga0501083_0303795_45_899 246
44 3300005328 Ga0070676_10006255 Ga0070676_100062555 247
45 3300005328 Ga0070676_10136513 Ga0070676_101365132 247
46 3300005338 Ga0068868_100777555 Ga0068868_1007775551 247
47 3300005341 Ga0070691_10001817 Ga0070691_100018172 247
48 3300005345 Ga0070692_10288215 Ga0070692_102882151 247
49 3300005353 Ga0070669_100020427 Ga0070669_1000204275 247
50 3300005438 Ga0070701_10018366 Ga0070701_100183661 247
51 3300005440 Ga0070705_100006979 Ga0070705_1000069795 247
52 3300005440 Ga0070705_100477987 Ga0070705_1004779871 247
53 3300005441 Ga0070700_100008749 Ga0070700_1000087495 247
54 3300005441 Ga0070700_100114318 Ga0070700_1001143182 247
55 3300005459 Ga0068867_100013036 Ga0068867_1000130362 247
56 3300005459 Ga0068867_100487205 Ga0068867_1004872051 247
57 3300005545 Ga0070695_100039144 Ga0070695_1000391442 247
58 3300005546 Ga0070696_100009094 Ga0070696_1000090944 247
59 3300005578 Ga0068854_100036116 Ga0068854_1000361162 247
60 3300005615 Ga0070702_100008320 Ga0070702_1000083203 247
61 3300005844 Ga0068862_100013148 Ga0068862_1000131482 247
62 3300006847 Ga0075431_100096671 Ga0075431_1000966713 247
63 3300006852 Ga0075433_10414204 Ga0075433_104142042 247
64 3300006880 Ga0075429_100285639 Ga0075429_1002856392 247
65 3300009147 Ga0114129_10005698 Ga0114129_100056985 247
66 3300009148 Ga0105243_10116206 Ga0105243_101162062 247
67 3300009177 Ga0105248_10225992 Ga0105248_102259922 247
68 3300014325 Ga0163163_10003074 Ga0163163_100030748 247
69 3300014969 Ga0157376_10192833 Ga0157376_101928332 247
70 3300025271 Ga0207666_1006632 Ga0207666_10066322 247
71 3300025907 Ga0207645_10006324 Ga0207645_100063245 247
72 3300025907 Ga0207645_10067745 Ga0207645_100677452 247
73 3300025923 Ga0207681_10059847 Ga0207681_100598472 247
74 3300025925 Ga0207650_10148890 Ga0207650_101488902 247
75 3300025926 Ga0207659_10034662 Ga0207659_100346622 247
76 3300025933 Ga0207706_10243624 Ga0207706_102436242 247
77 3300025935 Ga0207709_10052940 Ga0207709_100529402 247
78 3300025937 Ga0207669_10048881 Ga0207669_100488814 247
79 3300025972 Ga0207668_10041866 Ga0207668_100418664 247
80 3300026075 Ga0207708_10022453 Ga0207708_100224535 247
81 3300026088 Ga0207641_10147286 Ga0207641_101472862 247
82 3300026118 Ga0207675_100100460 Ga0207675_1001004602 247
83 3300026118 Ga0207675_100158695 Ga0207675_1001586952 247
84 3300028380 Ga0268265_10141024 Ga0268265_101410242 247
85 3300031711 Ga0265314_10094341 Ga0265314_100943412 247
86 3300032002 Ga0307416_100849313 Ga0307416_1008493132 247
87 3300044673 Ga0453683_0057214 Ga0453683_0057214_422_1180 247
88 3300050507 nmdc:mga05p37_31924_c1 nmdc:mga05p37_31924_c1_1822_2565 247
89 3300050508 nmdc:mga09592_255344_c1 nmdc:mga09592_255344_c1_293_1036 247
90 3300050511 nmdc:mga08y16_24143_c1 nmdc:mga08y16_24143_c1_4299_5051 247
91 3300050515 nmdc:mga0a205_113353_c1 nmdc:mga0a205_113353_c1_752_1498 247
92 3300005293 Ga0065715_10345576 Ga0065715_103455761 248
93 3300005327 Ga0070658_10023619 Ga0070658_100236192 248
94 3300005328 Ga0070676_10064781 Ga0070676_100647812 248
95 3300005330 Ga0070690_100052481 Ga0070690_1000524812 248
96 3300005331 Ga0070670_100112669 Ga0070670_1001126692 248
97 3300005331 Ga0070670_100136809 Ga0070670_1001368093 248
98 3300005333 Ga0070677_10062896 Ga0070677_100628962 248
99 3300005335 Ga0070666_10036007 Ga0070666_100360072 248
100 3300005345 Ga0070692_10054100 Ga0070692_100541002 248
101 3300005347 Ga0070668_100091013 Ga0070668_1000910132 248
102 3300005353 Ga0070669_100192244 Ga0070669_1001922441 248
103 3300005354 Ga0070675_100000055 Ga0070675_10000005525 248
104 3300005354 Ga0070675_100194031 Ga0070675_1001940312 248
105 3300005355 Ga0070671_100220534 Ga0070671_1002205342 248
106 3300005356 Ga0070674_100008789 Ga0070674_1000087893 248
107 3300005356 Ga0070674_100236649 Ga0070674_1002366492 248
108 3300005364 Ga0070673_100198822 Ga0070673_1001988222 248
109 3300005365 Ga0070688_100080837 Ga0070688_1000808372 248
110 3300005434 Ga0070709_10065043 Ga0070709_100650432 248
111 3300005457 Ga0070662_100184250 Ga0070662_1001842502 248
112 3300005458 Ga0070681_10075207 Ga0070681_100752074 248
113 3300005458 Ga0070681_10284906 Ga0070681_102849062 248
114 3300005467 Ga0070706_100440109 Ga0070706_1004401091 248
115 3300005530 Ga0070679_100154007 Ga0070679_1001540073 248
116 3300005544 Ga0070686_100000926 Ga0070686_10000092615 248
117 3300005546 Ga0070696_100136601 Ga0070696_1001366012 248
118 3300005548 Ga0070665_100030260 Ga0070665_1000302604 248
119 3300005548 Ga0070665_100426596 Ga0070665_1004265962 248
120 3300005563 Ga0068855_100329568 Ga0068855_1003295682 248
121 3300005578 Ga0068854_100011885 Ga0068854_1000118854 248
122 3300005578 Ga0068854_100097722 Ga0068854_1000977222 248
123 3300005616 Ga0068852_100405379 Ga0068852_1004053792 248
124 3300005718 Ga0068866_10039630 Ga0068866_100396302 248
125 3300005843 Ga0068860_100526005 Ga0068860_1005260052 248
126 3300005844 Ga0068862_100064039 Ga0068862_1000640392 248
127 3300005985 Ga0081539_10006667 Ga0081539_100066672 248
128 3300006173 Ga0070716_100163231 Ga0070716_1001632312 248
129 3300006173 Ga0070716_100278807 Ga0070716_1002788072 248
130 3300006237 Ga0097621_100113756 Ga0097621_1001137562 248
131 3300006358 Ga0068871_100028927 Ga0068871_1000289272 248
132 3300006358 Ga0068871_100542807 Ga0068871_1005428071 248
133 3300006871 Ga0075434_100007565 Ga0075434_1000075657 248
134 3300006871 Ga0075434_100042544 Ga0075434_1000425442 248
135 3300006871 Ga0075434_100219087 Ga0075434_1002190872 248
136 3300006871 Ga0075434_100898293 Ga0075434_1008982931 248
137 3300006881 Ga0068865_100049245 Ga0068865_1000492452 248
138 3300006914 Ga0075436_100003532 Ga0075436_1000035325 248
139 3300006914 Ga0075436_100031703 Ga0075436_1000317033 248
140 3300006914 Ga0075436_100057261 Ga0075436_1000572612 248
141 3300007076 Ga0075435_100000894 Ga0075435_1000008942 248
142 3300007076 Ga0075435_100050091 Ga0075435_1000500914 248
143 3300007076 Ga0075435_100060506 Ga0075435_1000605062 248
144 3300007076 Ga0075435_100318581 Ga0075435_1003185812 248
145 3300009093 Ga0105240_10463638 Ga0105240_104636382 248
146 3300009094 Ga0111539_10001440 Ga0111539_100014407 248
147 3300009094 Ga0111539_10004657 Ga0111539_100046572 248
148 3300009098 Ga0105245_10035367 Ga0105245_100353673 248
149 3300009148 Ga0105243_10014932 Ga0105243_100149322 248
150 3300009148 Ga0105243_10141369 Ga0105243_101413692 248
151 3300009176 Ga0105242_10035935 Ga0105242_100359353 248
152 3300009177 Ga0105248_10173430 Ga0105248_101734302 248
153 3300009551 Ga0105238_10055683 Ga0105238_100556834 248
154 3300009551 Ga0105238_10122850 Ga0105238_101228503 248
155 3300013308 Ga0157375_10121315 Ga0157375_101213152 248
156 3300014968 Ga0157379_10297347 Ga0157379_102973471 248
157 3300014969 Ga0157376_10006652 Ga0157376_100066525 248
158 3300017792 Ga0163161_10320298 Ga0163161_103202981 248
159 3300025899 Ga0207642_10096783 Ga0207642_100967831 248
160 3300025899 Ga0207642_10205402 Ga0207642_102054022 248
161 3300025903 Ga0207680_10085159 Ga0207680_100851591 248
162 3300025907 Ga0207645_10006009 Ga0207645_100060092 248
163 3300025911 Ga0207654_10219741 Ga0207654_102197411 248
164 3300025919 Ga0207657_10062935 Ga0207657_100629353 248
165 3300025920 Ga0207649_10315995 Ga0207649_103159951 248
166 3300025921 Ga0207652_10026671 Ga0207652_100266715 248
167 3300025922 Ga0207646_10144225 Ga0207646_101442252 248
168 3300025924 Ga0207694_10028442 Ga0207694_100284423 248
169 3300025925 Ga0207650_10130806 Ga0207650_101308063 248
170 3300025925 Ga0207650_10237354 Ga0207650_102373542 248
171 3300025926 Ga0207659_10016524 Ga0207659_100165244 248
172 3300025926 Ga0207659_10033686 Ga0207659_100336863 248
173 3300025927 Ga0207687_10025557 Ga0207687_100255572 248
174 3300025933 Ga0207706_10068825 Ga0207706_100688256 248
175 3300025933 Ga0207706_10529905 Ga0207706_105299051 248
176 3300025934 Ga0207686_10127474 Ga0207686_101274742 248
177 3300025935 Ga0207709_10023381 Ga0207709_100233814 248
178 3300025937 Ga0207669_10005445 Ga0207669_100054454 248
179 3300025937 Ga0207669_10154204 Ga0207669_101542042 248
180 3300025938 Ga0207704_10007412 Ga0207704_100074122 248
181 3300025940 Ga0207691_10070971 Ga0207691_100709712 248
182 3300025940 Ga0207691_10236733 Ga0207691_102367332 248
183 3300025941 Ga0207711_10111170 Ga0207711_101111702 248
184 3300025941 Ga0207711_10133113 Ga0207711_101331131 248
185 3300025949 Ga0207667_10076643 Ga0207667_100766432 248
186 3300025960 Ga0207651_10077779 Ga0207651_100777792 248
187 3300025961 Ga0207712_10061429 Ga0207712_100614292 248
188 3300025972 Ga0207668_10207359 Ga0207668_102073592 248
189 3300025981 Ga0207640_10010279 Ga0207640_100102792 248
190 3300025981 Ga0207640_10074736 Ga0207640_100747362 248
191 3300026023 Ga0207677_10250165 Ga0207677_102501652 248
192 3300026075 Ga0207708_10234779 Ga0207708_102347792 248
193 3300026088 Ga0207641_10483715 Ga0207641_104837152 248
194 3300026089 Ga0207648_10040162 Ga0207648_100401623 248
195 3300026089 Ga0207648_10096952 Ga0207648_100969522 248
196 3300026089 Ga0207648_10140991 Ga0207648_101409912 248
197 3300026118 Ga0207675_100059063 Ga0207675_1000590631 248
198 3300027907 Ga0207428_10015437 Ga0207428_100154376 248
199 3300027907 Ga0207428_10157424 Ga0207428_101574242 248
200 3300028379 Ga0268266_10050461 Ga0268266_100504613 248
201 3300028379 Ga0268266_10158569 Ga0268266_101585692 248
202 3300028380 Ga0268265_10005659 Ga0268265_100056596 248
203 3300030521 Ga0307511_10168033 Ga0307511_101680331 248
204 3300034819 Ga0373958_0005121 Ga0373958_0005121_990_1736 248
205 3300035084 Ga0373928_0003886 Ga0373928_0003886_83_829 248
206 3300035085 Ga0373929_0000476 Ga0373929_0000476_3227_3973 248
207 3300035088 Ga0373940_0013537 Ga0373940_0013537_240_986 248
208 3300035092 Ga0373952_0002124 Ga0373952_0002124_1764_2510 248
209 3300035112 Ga0373932_0000869 Ga0373932_0000869_197_943 248
210 3300035114 Ga0373939_0002902 Ga0373939_0002902_25_771 248
211 3300035115 Ga0373941_0000162 Ga0373941_0000162_8210_8956 248
212 3300035117 Ga0373953_0035314 Ga0373953_0035314_1087_1833 248
213 3300035241 Ga0373961_0002875 Ga0373961_0002875_2410_3156 248
214 3300035242 Ga0373962_0001294 Ga0373962_0001294_5069_5815 248
215 3300035691 Ga0373931_0001425 Ga0373931_0001425_2411_3157 248
216 3300038443 Ga0395901_0736848 Ga0395901_0736848_187_933 248
217 3300039437 Ga0436365_0196462 Ga0436365_0196462_393_1139 248
218 3300042131 Ga0450894_001375 Ga0450894_001375_1197_1958 248
219 3300042133 Ga0450896_001990 Ga0450896_001990_1734_2495 248
220 3300045051 Ga0451576_0239178 Ga0451576_0239178_586_1332 248
221 3300045051 Ga0451576_0276138 Ga0451576_0276138_328_1074 248
222 3300046533 Ga0495640_0278053 Ga0495640_0278053_177_923 248
223 3300046681 Ga0495647_0190611 Ga0495647_0190611_61_807 248
224 3300046689 Ga0495613_0178398 Ga0495613_0178398_372_1118 248
225 3300048907 Ga0496104_0573568 Ga0496104_0573568_128_874 248
226 3300048911 Ga0496108_0225264 Ga0496108_0225264_856_1602 248
227 3300048915 Ga0496112_0109110 Ga0496112_0109110_1899_2645 248
228 3300048917 Ga0496114_0080527 Ga0496114_0080527_1498_2244 248
229 3300049571 Ga0501034_0154904 Ga0501034_0154904_688_1515 248
230 3300049579 Ga0501043_0055792 Ga0501043_0055792_1932_2759 248
231 3300049581 Ga0501047_0005040 Ga0501047_0005040_774_1601 248
232 3300049583 Ga0501067_0238662 Ga0501067_0238662_71_817 248
233 3300049588 Ga0501072_0299289 Ga0501072_0299289_14_760 248
234 3300049591 Ga0501075_0078051 Ga0501075_0078051_206_952 248
235 3300049823 Ga0501044_0010338 Ga0501044_0010338_9159_9986 248
236 3300050511 nmdc:mga08y16_106682_c1 nmdc:mga08y16_106682_c1_1312_2058 248
237 3300050511 nmdc:mga08y16_18380_c1 nmdc:mga08y16_18380_c1_43_792 248
238 3300050512 nmdc:mga0n895_50367_c1 nmdc:mga0n895_50367_c1_1664_2410 248
239 3300050512 nmdc:mga0n895_567_c1 nmdc:mga0n895_567_c1_9922_10668 248
240 3300050513 nmdc:mga0rr50_104537_c1 nmdc:mga0rr50_104537_c1_33_779 248
241 3300050513 nmdc:mga0rr50_114_c1 nmdc:mga0rr50_114_c1_18844_19590 248
242 3300050513 nmdc:mga0rr50_96164_c1 nmdc:mga0rr50_96164_c1_1170_1916 248
243 3300050514 nmdc:mga08x19_19790_c1 nmdc:mga08x19_19790_c1_1401_2147 248
244 3300050514 nmdc:mga08x19_339232_c1 nmdc:mga08x19_339232_c1_50_796 248
245 3300050514 nmdc:mga08x19_5290_c1 nmdc:mga08x19_5290_c1_5329_6075 248
246 3300002459 JGI24751J29686_10011144 JGI24751J29686_100111441 249
247 3300005293 Ga0065715_10098936 Ga0065715_100989362 249
248 3300005334 Ga0068869_100482244 Ga0068869_1004822442 249
249 3300005335 Ga0070666_10200820 Ga0070666_102008202 249
250 3300005336 Ga0070680_100189108 Ga0070680_1001891082 249
251 3300005338 Ga0068868_100036623 Ga0068868_1000366234 249
252 3300005340 Ga0070689_100142097 Ga0070689_1001420972 249
253 3300005340 Ga0070689_100246615 Ga0070689_1002466152 249
254 3300005353 Ga0070669_100158574 Ga0070669_1001585742 249
255 3300005354 Ga0070675_100807327 Ga0070675_1008073271 249
256 3300005355 Ga0070671_100104194 Ga0070671_1001041942 249
257 3300005355 Ga0070671_100263844 Ga0070671_1002638442 249
258 3300005355 Ga0070671_100519871 Ga0070671_1005198712 249
259 3300005356 Ga0070674_100429616 Ga0070674_1004296162 249
260 3300005364 Ga0070673_100138876 Ga0070673_1001388762 249
261 3300005366 Ga0070659_100153437 Ga0070659_1001534372 249
262 3300005436 Ga0070713_100138788 Ga0070713_1001387882 249
263 3300005439 Ga0070711_100449097 Ga0070711_1004490972 249
264 3300005440 Ga0070705_100111121 Ga0070705_1001111212 249
265 3300005444 Ga0070694_100013957 Ga0070694_1000139575 249
266 3300005445 Ga0070708_100101940 Ga0070708_1001019402 249
267 3300005458 Ga0070681_10004061 Ga0070681_100040615 249
268 3300005458 Ga0070681_10246622 Ga0070681_102466222 249
269 3300005468 Ga0070707_100208133 Ga0070707_1002081332 249
270 3300005471 Ga0070698_100114994 Ga0070698_1001149942 249
271 3300005471 Ga0070698_100575881 Ga0070698_1005758812 249
272 3300005518 Ga0070699_100297815 Ga0070699_1002978152 249
273 3300005518 Ga0070699_100306118 Ga0070699_1003061182 249
274 3300005518 Ga0070699_100507559 Ga0070699_1005075592 249
275 3300005530 Ga0070679_100032819 Ga0070679_1000328193 249
276 3300005543 Ga0070672_100174961 Ga0070672_1001749612 249
277 3300005544 Ga0070686_100025575 Ga0070686_1000255754 249
278 3300005548 Ga0070665_100007145 Ga0070665_1000071454 249
279 3300005549 Ga0070704_100036172 Ga0070704_1000361721 249
280 3300005614 Ga0068856_100104691 Ga0068856_1001046912 249
281 3300005615 Ga0070702_100287894 Ga0070702_1002878941 249
282 3300005617 Ga0068859_100042652 Ga0068859_1000426524 249
283 3300005617 Ga0068859_100124386 Ga0068859_1001243863 249
284 3300005618 Ga0068864_100022967 Ga0068864_1000229674 249
285 3300005618 Ga0068864_100093617 Ga0068864_1000936173 249
286 3300005618 Ga0068864_100268653 Ga0068864_1002686532 249
287 3300005718 Ga0068866_10309947 Ga0068866_103099471 249
288 3300005834 Ga0068851_10127531 Ga0068851_101275311 249
289 3300005841 Ga0068863_100256964 Ga0068863_1002569642 249
290 3300005842 Ga0068858_100000761 Ga0068858_1000007615 249
291 3300005842 Ga0068858_100012172 Ga0068858_1000121722 249
292 3300005842 Ga0068858_100093738 Ga0068858_1000937384 249
293 3300005844 Ga0068862_100011518 Ga0068862_1000115182 249
294 3300005844 Ga0068862_100559551 Ga0068862_1005595512 249
295 3300006237 Ga0097621_100019394 Ga0097621_1000193946 249
296 3300006237 Ga0097621_100329518 Ga0097621_1003295182 249
297 3300006358 Ga0068871_100002863 Ga0068871_1000028635 249
298 3300006358 Ga0068871_100014197 Ga0068871_1000141972 249
299 3300006358 Ga0068871_100050250 Ga0068871_1000502502 249
300 3300006844 Ga0075428_100023790 Ga0075428_1000237902 249
301 3300006852 Ga0075433_10083754 Ga0075433_100837543 249
302 3300006871 Ga0075434_100032315 Ga0075434_1000323153 249
303 3300006881 Ga0068865_100009647 Ga0068865_1000096473 249
304 3300006914 Ga0075436_100014961 Ga0075436_1000149612 249
305 3300006914 Ga0075436_100058897 Ga0075436_1000588972 249
306 3300006931 Ga0097620_100042652 Ga0097620_1000426522 249
307 3300006931 Ga0097620_100124390 Ga0097620_1001243903 249
308 3300007076 Ga0075435_100003390 Ga0075435_1000033904 249
309 3300007076 Ga0075435_100007416 Ga0075435_1000074165 249
310 3300007076 Ga0075435_100255007 Ga0075435_1002550072 249
311 3300007076 Ga0075435_100377511 Ga0075435_1003775112 249
312 3300009093 Ga0105240_10060998 Ga0105240_100609982 249
313 3300009093 Ga0105240_10298819 Ga0105240_102988192 249
314 3300009094 Ga0111539_10478565 Ga0111539_104785652 249
315 3300009094 Ga0111539_11057715 Ga0111539_110577152 249
316 3300009098 Ga0105245_10251108 Ga0105245_102511082 249
317 3300009098 Ga0105245_10269686 Ga0105245_102696862 249
318 3300009098 Ga0105245_10337853 Ga0105245_103378532 249
319 3300009098 Ga0105245_10375620 Ga0105245_103756201 249
320 3300009098 Ga0105245_10901617 Ga0105245_109016171 249
321 3300009101 Ga0105247_10033321 Ga0105247_100333212 249
322 3300009147 Ga0114129_10017539 Ga0114129_100175392 249
323 3300009147 Ga0114129_10018144 Ga0114129_100181447 249
324 3300009147 Ga0114129_10021621 Ga0114129_100216216 249
325 3300009147 Ga0114129_10080039 Ga0114129_100800394 249
326 3300009147 Ga0114129_10120934 Ga0114129_101209342 249
327 3300009147 Ga0114129_10380370 Ga0114129_103803702 249
328 3300009147 Ga0114129_10521936 Ga0114129_105219362 249
329 3300009147 Ga0114129_11184628 Ga0114129_111846282 249
330 3300009176 Ga0105242_10016938 Ga0105242_100169386 249
331 3300009176 Ga0105242_10056184 Ga0105242_100561844 249
332 3300009176 Ga0105242_10278006 Ga0105242_102780062 249
333 3300009177 Ga0105248_10010609 Ga0105248_100106092 249
334 3300009177 Ga0105248_10086656 Ga0105248_100866562 249
335 3300009177 Ga0105248_10144074 Ga0105248_101440742 249
336 3300009177 Ga0105248_10471220 Ga0105248_104712201 249
337 3300009553 Ga0105249_10480091 Ga0105249_104800912 249
338 3300009553 Ga0105249_10620165 Ga0105249_106201652 249
339 3300013296 Ga0157374_10174597 Ga0157374_101745972 249
340 3300013306 Ga0163162_10054054 Ga0163162_100540543 249
341 3300013306 Ga0163162_10995752 Ga0163162_109957521 249
342 3300013308 Ga0157375_10238222 Ga0157375_102382222 249
343 3300013308 Ga0157375_11129845 Ga0157375_111298452 249
344 3300014325 Ga0163163_10075540 Ga0163163_100755403 249
345 3300014325 Ga0163163_10160984 Ga0163163_101609843 249
346 3300014325 Ga0163163_10483625 Ga0163163_104836251 249
347 3300014325 Ga0163163_10661061 Ga0163163_106610612 249
348 3300014326 Ga0157380_10283421 Ga0157380_102834212 249
349 3300014968 Ga0157379_10054969 Ga0157379_100549692 249
350 3300014968 Ga0157379_10177399 Ga0157379_101773992 249
351 3300014968 Ga0157379_10307349 Ga0157379_103073492 249
352 3300014968 Ga0157379_10317828 Ga0157379_103178282 249
353 3300014969 Ga0157376_10039331 Ga0157376_100393313 249
354 3300014969 Ga0157376_10219183 Ga0157376_102191831 249
355 3300014969 Ga0157376_10473175 Ga0157376_104731752 249
356 3300025899 Ga0207642_10101813 Ga0207642_101018131 249
357 3300025900 Ga0207710_10005045 Ga0207710_100050452 249
358 3300025903 Ga0207680_10104903 Ga0207680_101049032 249
359 3300025905 Ga0207685_10064368 Ga0207685_100643682 249
360 3300025906 Ga0207699_10026006 Ga0207699_100260063 249
361 3300025912 Ga0207707_10009702 Ga0207707_100097021 249
362 3300025912 Ga0207707_10453123 Ga0207707_104531232 249
363 3300025913 Ga0207695_10124830 Ga0207695_101248302 249
364 3300025917 Ga0207660_10393425 Ga0207660_103934252 249
365 3300025918 Ga0207662_10453221 Ga0207662_104532211 249
366 3300025919 Ga0207657_10409609 Ga0207657_104096091 249
367 3300025921 Ga0207652_10044785 Ga0207652_100447852 249
368 3300025922 Ga0207646_10212269 Ga0207646_102122692 249
369 3300025923 Ga0207681_10072387 Ga0207681_100723872 249
370 3300025927 Ga0207687_10582484 Ga0207687_105824841 249
371 3300025928 Ga0207700_10058086 Ga0207700_100580864 249
372 3300025931 Ga0207644_10039686 Ga0207644_100396862 249
373 3300025933 Ga0207706_10236414 Ga0207706_102364142 249
374 3300025934 Ga0207686_10050874 Ga0207686_100508741 249
375 3300025934 Ga0207686_10079226 Ga0207686_100792262 249
376 3300025934 Ga0207686_10282682 Ga0207686_102826822 249
377 3300025934 Ga0207686_10411303 Ga0207686_104113031 249
378 3300025936 Ga0207670_10036808 Ga0207670_100368082 249
379 3300025936 Ga0207670_10130715 Ga0207670_101307152 249
380 3300025936 Ga0207670_10524035 Ga0207670_105240352 249
381 3300025938 Ga0207704_10354821 Ga0207704_103548211 249
382 3300025940 Ga0207691_10225017 Ga0207691_102250172 249
383 3300025941 Ga0207711_10017096 Ga0207711_100170966 249
384 3300025941 Ga0207711_10030248 Ga0207711_100302484 249
385 3300025941 Ga0207711_10314522 Ga0207711_103145222 249
386 3300025942 Ga0207689_10201565 Ga0207689_102015651 249
387 3300025942 Ga0207689_10427135 Ga0207689_104271352 249
388 3300025944 Ga0207661_10101252 Ga0207661_101012521 249
389 3300025960 Ga0207651_10067185 Ga0207651_100671852 249
390 3300025986 Ga0207658_10018525 Ga0207658_100185252 249
391 3300025986 Ga0207658_10585320 Ga0207658_105853202 249
392 3300026023 Ga0207677_10093111 Ga0207677_100931112 249
393 3300026023 Ga0207677_10460145 Ga0207677_104601452 249
394 3300026035 Ga0207703_10019414 Ga0207703_100194142 249
395 3300026035 Ga0207703_10065396 Ga0207703_100653962 249
396 3300026035 Ga0207703_10141179 Ga0207703_101411792 249
397 3300026035 Ga0207703_10539900 Ga0207703_105399001 249
398 3300026078 Ga0207702_10111114 Ga0207702_101111143 249
399 3300026088 Ga0207641_10035902 Ga0207641_100359023 249
400 3300026089 Ga0207648_10050763 Ga0207648_100507634 249
401 3300026095 Ga0207676_10012077 Ga0207676_100120775 249
402 3300026095 Ga0207676_10072541 Ga0207676_100725412 249
403 3300026095 Ga0207676_10093749 Ga0207676_100937492 249
404 3300026118 Ga0207675_100366124 Ga0207675_1003661242 249
405 3300027665 Ga0209983_1060144 Ga0209983_10601441 249
406 3300027907 Ga0207428_10221108 Ga0207428_102211082 249
407 3300027907 Ga0207428_10384762 Ga0207428_103847622 249
408 3300028379 Ga0268266_10014138 Ga0268266_100141384 249
409 3300028380 Ga0268265_10008952 Ga0268265_100089522 249
410 3300028380 Ga0268265_10379527 Ga0268265_103795272 249
411 3300028381 Ga0268264_10110219 Ga0268264_101102192 249
412 3300031344 Ga0265316_10255161 Ga0265316_102551612 249
413 3300031548 Ga0307408_100132347 Ga0307408_1001323472 249
414 3300031731 Ga0307405_10044578 Ga0307405_100445781 249
415 3300031824 Ga0307413_10029767 Ga0307413_100297672 249
416 3300031852 Ga0307410_10720221 Ga0307410_107202211 249
417 3300031903 Ga0307407_10029802 Ga0307407_100298022 249
418 3300031911 Ga0307412_10026630 Ga0307412_100266303 249
419 3300032002 Ga0307416_100053163 Ga0307416_1000531632 249
420 3300032004 Ga0307414_10028922 Ga0307414_100289223 249
421 3300032004 Ga0307414_10233615 Ga0307414_102336152 249
422 3300032005 Ga0307411_10008920 Ga0307411_100089203 249
423 3300032126 Ga0307415_100258967 Ga0307415_1002589672 249
424 3300034819 Ga0373958_0064206 Ga0373958_0064206_10_762 249
425 3300035083 Ga0373926_0108247 Ga0373926_0108247_135_884 249
426 3300035086 Ga0373934_0025094 Ga0373934_0025094_1474_2223 249
427 3300035111 Ga0373923_0065476 Ga0373923_0065476_475_1224 249
428 3300035170 Ga0373943_0014498 Ga0373943_0014498_1956_2705 249
429 3300035170 Ga0373943_0071261 Ga0373943_0071261_88_837 249
430 3300035170 Ga0373943_0141145 Ga0373943_0141145_434_1183 249
431 3300035171 Ga0373946_0134067 Ga0373946_0134067_101_850 249
432 3300035172 Ga0373955_0011602 Ga0373955_0011602_681_1430 249
433 3300035410 Ga0373924_0027127 Ga0373924_0027127_670_1419 249
434 3300035410 Ga0373924_0066840 Ga0373924_0066840_400_1149 249
435 3300035691 Ga0373931_0385259 Ga0373931_0385259_36_785 249
436 3300035692 Ga0373935_0094398 Ga0373935_0094398_753_1502 249
437 3300035724 Ga0373933_0131920 Ga0373933_0131920_330_1079 249
438 3300035724 Ga0373933_0158390 Ga0373933_0158390_80_829 249
439 3300036401 Ga0373937_0111499 Ga0373937_0111499_632_1381 249
440 3300036401 Ga0373937_0201095 Ga0373937_0201095_437_1189 249
441 3300036401 Ga0373937_0212161 Ga0373937_0212161_269_1018 249
442 3300036401 Ga0373937_0547980 Ga0373937_0547980_309_1058 249
443 3300037068 Ga0373925_0036446 Ga0373925_0036446_776_1525 249
444 3300037068 Ga0373925_0125144 Ga0373925_0125144_693_1442 249
445 3300037068 Ga0373925_0255474 Ga0373925_0255474_355_1104 249
446 3300039437 Ga0436365_1477503 Ga0436365_1477503_587_1336 249
447 3300042001 Ga0439441_053999 Ga0439441_053999_71_820 249
448 3300042436 Ga0439435_0032138 Ga0439435_0032138_98_847 249
449 3300042876 Ga0451577_0175182 Ga0451577_0175182_976_1737 249
450 3300044712 Ga0453684_0041993 Ga0453684_0041993_2442_3203 249
451 3300046454 Ga0495592_0046686 Ga0495592_0046686_485_1234 249
452 3300046459 Ga0495629_0549387 Ga0495629_0549387_10_759 249
453 3300046473 Ga0495582_0078830 Ga0495582_0078830_1029_1778 249
454 3300046511 Ga0495608_0077000 Ga0495608_0077000_351_1100 249
455 3300046514 Ga0495618_0262316 Ga0495618_0262316_85_834 249
456 3300046516 Ga0495628_0189513 Ga0495628_0189513_480_1229 249
457 3300046517 Ga0495630_0065438 Ga0495630_0065438_1922_2671 249
458 3300046529 Ga0495652_0235221 Ga0495652_0235221_17_766 249
459 3300046533 Ga0495640_0061808 Ga0495640_0061808_939_1688 249
460 3300046536 Ga0495587_0198759 Ga0495587_0198759_222_971 249
461 3300046539 Ga0495621_0022242 Ga0495621_0022242_589_1338 249
462 3300046543 Ga0495645_0004545 Ga0495645_0004545_563_1312 249
463 3300046543 Ga0495645_0093654 Ga0495645_0093654_681_1430 249
464 3300046559 Ga0495667_0092973 Ga0495667_0092973_1162_1911 249
465 3300046642 Ga0495634_0051230 Ga0495634_0051230_1448_2200 249
466 3300046681 Ga0495647_0071361 Ga0495647_0071361_441_1190 249
467 3300046681 Ga0495647_0132184 Ga0495647_0132184_297_1046 249
468 3300046681 Ga0495647_0175361 Ga0495647_0175361_127_876 249
469 3300046683 Ga0495658_0019658 Ga0495658_0019658_2025_2774 249
470 3300046684 Ga0495669_0004751 Ga0495669_0004751_2623_3372 249
471 3300046689 Ga0495613_0003530 Ga0495613_0003530_3455_4204 249
472 3300046809 Ga0495600_0178298 Ga0495600_0178298_398_1147 249
473 3300047317 Ga0495604_0035813 Ga0495604_0035813_2179_2928 249
474 3300047319 Ga0495674_0004626 Ga0495674_0004626_11498_12247 249
475 3300047319 Ga0495674_0049820 Ga0495674_0049820_1734_2483 249
476 3300047319 Ga0495674_0322592 Ga0495674_0322592_260_1009 249
477 3300047322 Ga0495680_0106070 Ga0495680_0106070_77_826 249
478 3300047444 Ga0495675_0179514 Ga0495675_0179514_362_1111 249
479 3300047471 Ga0495684_0000682 Ga0495684_0000682_8514_9263 249
480 3300048903 Ga0496100_0005884 Ga0496100_0005884_1060_1809 249
481 3300048904 Ga0496101_0000222 Ga0496101_0000222_9404_10153 249
482 3300048904 Ga0496101_0115492 Ga0496101_0115492_488_1240 249
483 3300048907 Ga0496104_0001478 Ga0496104_0001478_8687_9436 249
484 3300048907 Ga0496104_0012796 Ga0496104_0012796_1297_2046 249
485 3300048907 Ga0496104_0023018 Ga0496104_0023018_2774_3523 249
486 3300048907 Ga0496104_0264515 Ga0496104_0264515_19_768 249
487 3300048907 Ga0496104_0363191 Ga0496104_0363191_571_1320 249
488 3300048908 Ga0496105_0189990 Ga0496105_0189990_343_1092 249
489 3300048908 Ga0496105_0291401 Ga0496105_0291401_148_897 249
490 3300048910 Ga0496107_0011835 Ga0496107_0011835_209_958 249
491 3300048913 Ga0496110_0061241 Ga0496110_0061241_412_1161 249
492 3300048913 Ga0496110_0817344 Ga0496110_0817344_28_777 249
493 3300048915 Ga0496112_0014577 Ga0496112_0014577_5352_6101 249
494 3300048915 Ga0496112_0090825 Ga0496112_0090825_27_776 249
495 3300048915 Ga0496112_0159093 Ga0496112_0159093_1405_2154 249
496 3300048915 Ga0496112_0414445 Ga0496112_0414445_444_1193 249
497 3300048916 Ga0496113_0058705 Ga0496113_0058705_1163_1912 249
498 3300048917 Ga0496114_0000416 Ga0496114_0000416_16769_17518 249
499 3300048917 Ga0496114_0289401 Ga0496114_0289401_92_841 249
500 3300048918 Ga0496115_0343797 Ga0496115_0343797_417_1166 249
501 3300048918 Ga0496115_0422201 Ga0496115_0422201_80_829 249
502 3300049571 Ga0501034_0029753 Ga0501034_0029753_1743_2492 249
503 3300049585 Ga0501069_0250502 Ga0501069_0250502_57_806 249
504 3300049589 Ga0501073_0140011 Ga0501073_0140011_684_1439 249
505 3300050507 nmdc:mga05p37_173687_c1 nmdc:mga05p37_173687_c1_1096_1845 249
506 3300050507 nmdc:mga05p37_180383_c1 nmdc:mga05p37_180383_c1_1346_2098 249
507 3300050507 nmdc:mga05p37_37393_c1 nmdc:mga05p37_37393_c1_4969_5718 249
508 3300050507 nmdc:mga05p37_3900_c2 nmdc:mga05p37_3900_c2_1192_1941 249
509 3300050507 nmdc:mga05p37_56606_c2 nmdc:mga05p37_56606_c2_851_1600 249
510 3300050511 nmdc:mga08y16_506548_c1 nmdc:mga08y16_506548_c1_138_887 249
511 3300050511 nmdc:mga08y16_92293_c1 nmdc:mga08y16_92293_c1_1755_2507 249
512 3300050512 nmdc:mga0n895_129287_c1 nmdc:mga0n895_129287_c1_1652_2401 249
513 3300050512 nmdc:mga0n895_160033_c1 nmdc:mga0n895_160033_c1_744_1493 249
514 3300050512 nmdc:mga0n895_16738_c1 nmdc:mga0n895_16738_c1_3978_4730 249
515 3300050512 nmdc:mga0n895_202086_c1 nmdc:mga0n895_202086_c1_1206_1955 249
516 3300050513 nmdc:mga0rr50_203514_c1 nmdc:mga0rr50_203514_c1_448_1197 249
517 3300050513 nmdc:mga0rr50_228976_c1 nmdc:mga0rr50_228976_c1_361_1113 249
518 3300050513 nmdc:mga0rr50_4071_c1 nmdc:mga0rr50_4071_c1_5470_6219 249
519 3300050514 nmdc:mga08x19_16651_c1 nmdc:mga08x19_16651_c1_968_1717 249
520 3300050515 nmdc:mga0a205_292633_c1 nmdc:mga0a205_292633_c1_294_1043 249
521 3300050515 nmdc:mga0a205_611882_c1 nmdc:mga0a205_611882_c1_47_796 249
522 3300050515 nmdc:mga0a205_79619_c1 nmdc:mga0a205_79619_c1_880_1629 249
523 3300053077 Ga0495601_0003363 Ga0495601_0003363_2367_3116 249
524 3300053078 Ga0495612_0081922 Ga0495612_0081922_29_778 249
525 3300053084 Ga0495595_0063838 Ga0495595_0063838_162_911 249
526 3300053085 Ga0495619_0001979 Ga0495619_0001979_6220_6969 249
527 3300059421 Ga0590071_001549 Ga0590071_001549_4009_4767 249
528 3300059423 Ga0590074_007650 Ga0590074_007650_673_1431 249
529 3300059424 Ga0590075_000822 Ga0590075_000822_6235_6993 249
530 3300059424 Ga0590075_060135 Ga0590075_060135_28_786 249
531 3300059426 Ga0590077_001087 Ga0590077_001087_3263_4021 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

31

149

0.9

PF13183

Fer4_8

4Fe-4S dicluster domain

182

255

0.58

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kf6-assembly1.cif.gz_B e. coli quinol-fumarate reductase with bound inhibitor hqno 0.6182 1 246
1kf6-assembly1.cif.gz_B e. coli quinol-fumarate reductase with bound inhibitor hqno 0.5921 1 246
2bs3-assembly1.cif.gz_B glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes 0.5905 1 239
2acz-assembly1.cif.gz_B complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.5795 1 243
2bs3-assembly1.cif.gz_B glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes 0.5744 1 239
ID Description Score Start End Superfamily
2wu2F02 Mainly Alpha;Orthogonal Bundle;Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2;Alpha-helical ferredoxin 0.5593 121 247 1.10.1060.10
2wu2F02 Mainly Alpha;Orthogonal Bundle;Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2;Alpha-helical ferredoxin 0.5403 121 247 1.10.1060.10
af_Q9NA80_129_263_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.5159 2 110 3.10.20.90
af_A0A0N7KNQ5_188_268_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.4944 1 98 3.10.20.90
af_A0A0N7KNQ5_188_268_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.468 1 98 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A849G0P9-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.952 1 96 GO:0009055
GO:0009060
GO:0022904
GO:0051537
AF-A0A3M2HB32-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.9488 2 104 GO:0009055
GO:0051537
AF-A0A2D9ZQM6-F1-model_v4 deleted 0.9465 1 98
AF-A0A7X8VMZ1-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.9433 1 103 GO:0009055
GO:0051537
AF-A0A847GCC4-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.942 1 92 GO:0009055
GO:0051537

Feature Viewer

pLDDT pTM Quality
76.78 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map