F460190
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 531 | 259 | 531 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0154904|Ga0501034_0154904_688_1515 |
| Length | 275 |
| Sequence | VRGRRQAGAVSTSPALQITKSPTAGITMRLKLKIWRQAGPDSAGRLVDYVADDVSPDMSFLEMLDVVNENLLRKGEEAIAFDSDCREGICGMCSLVVNGIPHGPDRGTTVCQLHMRRFKDGDTITIEPWRARAFPVVKDLVVDRSAFDRIVAAGGYVSINCGGAPDGNAIPIPKEIAELAMDSAQCIACGACVAACKNASAHLFMGAKISQLSLLPQGQVERHRRVLSMIEQADAEGFGSCSNEAECEAVCPKEIPISNIARMTREYVKAILAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 147 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 154 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 161 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 162 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 163 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 166 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 169 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 176 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 185 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 186 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 187 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 188 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 189 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 190 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 191 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 224 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 225 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 226 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 228 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 229 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 230 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 231 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 232 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 257 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 258 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 259 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.08 |
| Rhizosphere | 94.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10011144 | 3300002459 | Bacteria | 1854 |
| 2 | Ga0065715_10098936 | 3300005293 | Bacteria | 3473 |
| 3 | Ga0065715_10345576 | 3300005293 | Bacteria | 960 |
| 4 | Ga0070658_10023619 | 3300005327 | Bacteria | 4933 |
| 5 | Ga0070676_10006255 | 3300005328 | Bacteria | 6360 |
| 6 | Ga0070676_10064781 | 3300005328 | Bacteria | 2180 |
| 7 | Ga0070676_10136513 | 3300005328 | Bacteria | 1556 |
| 8 | Ga0070690_100052481 | 3300005330 | Bacteria | 2606 |
| 9 | Ga0070670_100112669 | 3300005331 | Bacteria | 2345 |
| 10 | Ga0070670_100136809 | 3300005331 | Bacteria | 2117 |
| 11 | Ga0070677_10062896 | 3300005333 | Bacteria | 1537 |
| 12 | Ga0068869_100482244 | 3300005334 | Bacteria | 1033 |
| 13 | Ga0070666_10036007 | 3300005335 | Bacteria | 3282 |
| 14 | Ga0070666_10200820 | 3300005335 | Bacteria | 1403 |
| 15 | Ga0070680_100189108 | 3300005336 | Bacteria | 1735 |
| 16 | Ga0068868_100036623 | 3300005338 | Bacteria | 3800 |
| 17 | Ga0068868_100777555 | 3300005338 | Bacteria | 862 |
| 18 | Ga0070689_100142097 | 3300005340 | Bacteria | 1931 |
| 19 | Ga0070689_100246615 | 3300005340 | Bacteria | 1473 |
| 20 | Ga0070691_10001817 | 3300005341 | Bacteria | 9302 |
| 21 | Ga0070692_10054100 | 3300005345 | Bacteria | 2095 |
| 22 | Ga0070692_10288215 | 3300005345 | Bacteria | 998 |
| 23 | Ga0070668_100091013 | 3300005347 | Bacteria | 2404 |
| 24 | Ga0070669_100020427 | 3300005353 | Bacteria | 4730 |
| 25 | Ga0070669_100158574 | 3300005353 | Bacteria | 1756 |
| 26 | Ga0070669_100192244 | 3300005353 | Bacteria | 1601 |
| 27 | Ga0070675_100000055 | 3300005354 | Bacteria | 68147 |
| 28 | Ga0070675_100194031 | 3300005354 | Bacteria | 1761 |
| 29 | Ga0070675_100807327 | 3300005354 | Bacteria | 858 |
| 30 | Ga0070671_100104194 | 3300005355 | Bacteria | 2381 |
| 31 | Ga0070671_100220534 | 3300005355 | Bacteria | 1609 |
| 32 | Ga0070671_100263844 | 3300005355 | Bacteria | 1464 |
| 33 | Ga0070671_100519871 | 3300005355 | Bacteria | 1025 |
| 34 | Ga0070674_100008789 | 3300005356 | Bacteria | 6027 |
| 35 | Ga0070674_100013152 | 3300005356 | Bacteria | 5106 |
| 36 | Ga0070674_100236649 | 3300005356 | Bacteria | 1427 |
| 37 | Ga0070674_100429616 | 3300005356 | Bacteria | 1086 |
| 38 | Ga0070673_100138876 | 3300005364 | Bacteria | 2048 |
| 39 | Ga0070673_100198822 | 3300005364 | Bacteria | 1726 |
| 40 | Ga0070688_100080837 | 3300005365 | Bacteria | 2103 |
| 41 | Ga0070659_100153437 | 3300005366 | Bacteria | 1880 |
| 42 | Ga0070709_10065043 | 3300005434 | Bacteria | 2334 |
| 43 | Ga0070714_100010088 | 3300005435 | Bacteria | 7453 |
| 44 | Ga0070713_100138788 | 3300005436 | Bacteria | 2151 |
| 45 | Ga0070701_10018366 | 3300005438 | Bacteria | 3285 |
| 46 | Ga0070711_100449097 | 3300005439 | Bacteria | 1055 |
| 47 | Ga0070705_100006979 | 3300005440 | Bacteria | 5554 |
| 48 | Ga0070705_100111121 | 3300005440 | Bacteria | 1751 |
| 49 | Ga0070705_100477987 | 3300005440 | Bacteria | 941 |
| 50 | Ga0070700_100008749 | 3300005441 | Bacteria | 5525 |
| 51 | Ga0070700_100114318 | 3300005441 | Bacteria | 1799 |
| 52 | Ga0070694_100013957 | 3300005444 | Bacteria | 5023 |
| 53 | Ga0070694_100206932 | 3300005444 | Bacteria | 1465 |
| 54 | Ga0070708_100101940 | 3300005445 | Bacteria | 2629 |
| 55 | Ga0070662_100184250 | 3300005457 | Bacteria | 1648 |
| 56 | Ga0070681_10004061 | 3300005458 | Bacteria | 13821 |
| 57 | Ga0070681_10075207 | 3300005458 | Bacteria | 3337 |
| 58 | Ga0070681_10246622 | 3300005458 | Bacteria | 1699 |
| 59 | Ga0070681_10284906 | 3300005458 | Bacteria | 1563 |
| 60 | Ga0068867_100013036 | 3300005459 | Bacteria | 5883 |
| 61 | Ga0068867_100487205 | 3300005459 | Bacteria | 1058 |
| 62 | Ga0070706_100440109 | 3300005467 | Bacteria | 1213 |
| 63 | Ga0070707_100208133 | 3300005468 | Bacteria | 1907 |
| 64 | Ga0070698_100114994 | 3300005471 | Bacteria | 2655 |
| 65 | Ga0070698_100575881 | 3300005471 | Bacteria | 1066 |
| 66 | Ga0070699_100297815 | 3300005518 | Bacteria | 1447 |
| 67 | Ga0070699_100306118 | 3300005518 | Bacteria | 1426 |
| 68 | Ga0070699_100507559 | 3300005518 | Bacteria | 1096 |
| 69 | Ga0070679_100032819 | 3300005530 | Bacteria | 5139 |
| 70 | Ga0070679_100154007 | 3300005530 | Bacteria | 2274 |
| 71 | Ga0070672_100174961 | 3300005543 | Bacteria | 1787 |
| 72 | Ga0070686_100000926 | 3300005544 | Bacteria | 16872 |
| 73 | Ga0070686_100025575 | 3300005544 | Bacteria | 3553 |
| 74 | Ga0070695_100039144 | 3300005545 | Bacteria | 2995 |
| 75 | Ga0070696_100009094 | 3300005546 | Bacteria | 6654 |
| 76 | Ga0070696_100136601 | 3300005546 | Bacteria | 1788 |
| 77 | Ga0070665_100007145 | 3300005548 | Bacteria | 11355 |
| 78 | Ga0070665_100030260 | 3300005548 | Bacteria | 5449 |
| 79 | Ga0070665_100426596 | 3300005548 | Bacteria | 1335 |
| 80 | Ga0070704_100036172 | 3300005549 | Bacteria | 3362 |
| 81 | Ga0068855_100329568 | 3300005563 | Bacteria | 1685 |
| 82 | Ga0068854_100011885 | 3300005578 | Bacteria | 5687 |
| 83 | Ga0068854_100036116 | 3300005578 | Bacteria | 3463 |
| 84 | Ga0068854_100097722 | 3300005578 | Bacteria | 2196 |
| 85 | Ga0068856_100104691 | 3300005614 | Bacteria | 2824 |
| 86 | Ga0070702_100008320 | 3300005615 | Bacteria | 5017 |
| 87 | Ga0070702_100287894 | 3300005615 | Bacteria | 1131 |
| 88 | Ga0068852_100405379 | 3300005616 | Bacteria | 1342 |
| 89 | Ga0068859_100042652 | 3300005617 | Bacteria | 4558 |
| 90 | Ga0068859_100124386 | 3300005617 | Bacteria | 2647 |
| 91 | Ga0068864_100022967 | 3300005618 | Bacteria | 5234 |
| 92 | Ga0068864_100093617 | 3300005618 | Bacteria | 2654 |
| 93 | Ga0068864_100268653 | 3300005618 | Bacteria | 1589 |
| 94 | Ga0068866_10039630 | 3300005718 | Bacteria | 2327 |
| 95 | Ga0068866_10309947 | 3300005718 | Bacteria | 989 |
| 96 | Ga0068851_10127531 | 3300005834 | Bacteria | 1373 |
| 97 | Ga0068863_100256964 | 3300005841 | Bacteria | 1688 |
| 98 | Ga0068858_100000761 | 3300005842 | Bacteria | 33790 |
| 99 | Ga0068858_100012172 | 3300005842 | Bacteria | 8110 |
| 100 | Ga0068858_100093738 | 3300005842 | Bacteria | 2796 |
| 101 | Ga0068860_100526005 | 3300005843 | Bacteria | 1183 |
| 102 | Ga0068862_100011518 | 3300005844 | Bacteria | 7299 |
| 103 | Ga0068862_100013148 | 3300005844 | Bacteria | 6846 |
| 104 | Ga0068862_100064039 | 3300005844 | Bacteria | 3164 |
| 105 | Ga0068862_100559551 | 3300005844 | Bacteria | 1093 |
| 106 | Ga0081539_10006667 | 3300005985 | Bacteria | 10929 |
| 107 | Ga0070716_100163231 | 3300006173 | Bacteria | 1446 |
| 108 | Ga0070716_100278807 | 3300006173 | Bacteria | 1153 |
| 109 | Ga0097621_100019394 | 3300006237 | Bacteria | 5218 |
| 110 | Ga0097621_100113756 | 3300006237 | Bacteria | 2289 |
| 111 | Ga0097621_100329518 | 3300006237 | Bacteria | 1354 |
| 112 | Ga0068871_100002863 | 3300006358 | Bacteria | 11821 |
| 113 | Ga0068871_100014197 | 3300006358 | Bacteria | 5930 |
| 114 | Ga0068871_100028927 | 3300006358 | Bacteria | 4349 |
| 115 | Ga0068871_100050250 | 3300006358 | Bacteria | 3373 |
| 116 | Ga0068871_100542807 | 3300006358 | Bacteria | 1052 |
| 117 | Ga0075428_100023790 | 3300006844 | Bacteria | 6778 |
| 118 | Ga0075431_100096671 | 3300006847 | Bacteria | 3049 |
| 119 | Ga0075431_100587193 | 3300006847 | Bacteria | 1099 |
| 120 | Ga0075433_10083754 | 3300006852 | Bacteria | 2815 |
| 121 | Ga0075433_10414204 | 3300006852 | Bacteria | 1188 |
| 122 | Ga0075434_100007565 | 3300006871 | Bacteria | 10065 |
| 123 | Ga0075434_100032315 | 3300006871 | Bacteria | 5161 |
| 124 | Ga0075434_100042544 | 3300006871 | Bacteria | 4503 |
| 125 | Ga0075434_100219087 | 3300006871 | Bacteria | 1923 |
| 126 | Ga0075434_100898293 | 3300006871 | Bacteria | 901 |
| 127 | Ga0075429_100285639 | 3300006880 | Bacteria | 1445 |
| 128 | Ga0068865_100009647 | 3300006881 | Bacteria | 5987 |
| 129 | Ga0068865_100049245 | 3300006881 | Bacteria | 2903 |
| 130 | Ga0075436_100003532 | 3300006914 | Bacteria | 10721 |
| 131 | Ga0075436_100014961 | 3300006914 | Bacteria | 5318 |
| 132 | Ga0075436_100031703 | 3300006914 | Bacteria | 3641 |
| 133 | Ga0075436_100057261 | 3300006914 | Bacteria | 2692 |
| 134 | Ga0075436_100058897 | 3300006914 | Bacteria | 2653 |
| 135 | Ga0097620_100042652 | 3300006931 | Bacteria | 4558 |
| 136 | Ga0097620_100124390 | 3300006931 | Bacteria | 2647 |
| 137 | Ga0075435_100000894 | 3300007076 | Bacteria | 18764 |
| 138 | Ga0075435_100003390 | 3300007076 | Bacteria | 10807 |
| 139 | Ga0075435_100007416 | 3300007076 | Bacteria | 7810 |
| 140 | Ga0075435_100050091 | 3300007076 | Bacteria | 3360 |
| 141 | Ga0075435_100060506 | 3300007076 | Bacteria | 3071 |
| 142 | Ga0075435_100255007 | 3300007076 | Bacteria | 1494 |
| 143 | Ga0075435_100318581 | 3300007076 | Bacteria | 1331 |
| 144 | Ga0075435_100377511 | 3300007076 | Bacteria | 1217 |
| 145 | Ga0105240_10060998 | 3300009093 | Bacteria | 4701 |
| 146 | Ga0105240_10298819 | 3300009093 | Bacteria | 1842 |
| 147 | Ga0105240_10463638 | 3300009093 | Bacteria | 1415 |
| 148 | Ga0111539_10001440 | 3300009094 | Bacteria | 31737 |
| 149 | Ga0111539_10004657 | 3300009094 | Bacteria | 17928 |
| 150 | Ga0111539_10478565 | 3300009094 | Bacteria | 1450 |
| 151 | Ga0111539_11057715 | 3300009094 | Bacteria | 943 |
| 152 | Ga0105245_10035367 | 3300009098 | Bacteria | 4433 |
| 153 | Ga0105245_10251108 | 3300009098 | Bacteria | 1718 |
| 154 | Ga0105245_10269686 | 3300009098 | Bacteria | 1659 |
| 155 | Ga0105245_10337853 | 3300009098 | Bacteria | 1488 |
| 156 | Ga0105245_10375620 | 3300009098 | Bacteria | 1414 |
| 157 | Ga0105245_10901617 | 3300009098 | Bacteria | 926 |
| 158 | Ga0105247_10033321 | 3300009101 | Bacteria | 3133 |
| 159 | Ga0114129_10005698 | 3300009147 | Bacteria | 17647 |
| 160 | Ga0114129_10017539 | 3300009147 | Bacteria | 10193 |
| 161 | Ga0114129_10018144 | 3300009147 | Bacteria | 10021 |
| 162 | Ga0114129_10021621 | 3300009147 | Bacteria | 9131 |
| 163 | Ga0114129_10080039 | 3300009147 | Bacteria | 4542 |
| 164 | Ga0114129_10120934 | 3300009147 | Bacteria | 3604 |
| 165 | Ga0114129_10380370 | 3300009147 | Bacteria | 1864 |
| 166 | Ga0114129_10504499 | 3300009147 | Bacteria | 1580 |
| 167 | Ga0114129_10521936 | 3300009147 | Bacteria | 1548 |
| 168 | Ga0114129_10539314 | 3300009147 | Bacteria | 1519 |
| 169 | Ga0114129_11184628 | 3300009147 | Bacteria | 952 |
| 170 | Ga0105243_10014932 | 3300009148 | Bacteria | 5878 |
| 171 | Ga0105243_10116206 | 3300009148 | Bacteria | 2247 |
| 172 | Ga0105243_10141369 | 3300009148 | Bacteria | 2054 |
| 173 | Ga0105243_10464179 | 3300009148 | Bacteria | 1191 |
| 174 | Ga0105242_10016938 | 3300009176 | Bacteria | 5671 |
| 175 | Ga0105242_10035935 | 3300009176 | Bacteria | 3973 |
| 176 | Ga0105242_10056184 | 3300009176 | Bacteria | 3221 |
| 177 | Ga0105242_10278006 | 3300009176 | Bacteria | 1519 |
| 178 | Ga0105248_10010609 | 3300009177 | Bacteria | 10155 |
| 179 | Ga0105248_10086656 | 3300009177 | Bacteria | 3523 |
| 180 | Ga0105248_10144074 | 3300009177 | Bacteria | 2688 |
| 181 | Ga0105248_10173430 | 3300009177 | Bacteria | 2431 |
| 182 | Ga0105248_10225992 | 3300009177 | Bacteria | 2107 |
| 183 | Ga0105248_10471220 | 3300009177 | Bacteria | 1416 |
| 184 | Ga0105238_10055683 | 3300009551 | Bacteria | 3969 |
| 185 | Ga0105238_10122850 | 3300009551 | Bacteria | 2576 |
| 186 | Ga0105249_10480091 | 3300009553 | Bacteria | 1286 |
| 187 | Ga0105249_10620165 | 3300009553 | Bacteria | 1137 |
| 188 | Ga0157374_10174597 | 3300013296 | Bacteria | 2097 |
| 189 | Ga0163162_10054054 | 3300013306 | Bacteria | 4038 |
| 190 | Ga0163162_10995752 | 3300013306 | Bacteria | 947 |
| 191 | Ga0157375_10121315 | 3300013308 | Bacteria | 2724 |
| 192 | Ga0157375_10238222 | 3300013308 | Bacteria | 1979 |
| 193 | Ga0157375_11129845 | 3300013308 | Bacteria | 918 |
| 194 | Ga0163163_10003074 | 3300014325 | Bacteria | 14130 |
| 195 | Ga0163163_10075540 | 3300014325 | Bacteria | 3363 |
| 196 | Ga0163163_10160984 | 3300014325 | Bacteria | 2290 |
| 197 | Ga0163163_10483625 | 3300014325 | Bacteria | 1299 |
| 198 | Ga0163163_10661061 | 3300014325 | Bacteria | 1108 |
| 199 | Ga0157380_10034411 | 3300014326 | Bacteria | 3908 |
| 200 | Ga0157380_10283421 | 3300014326 | Bacteria | 1517 |
| 201 | Ga0157379_10054969 | 3300014968 | Bacteria | 3557 |
| 202 | Ga0157379_10177399 | 3300014968 | Bacteria | 1924 |
| 203 | Ga0157379_10297347 | 3300014968 | Bacteria | 1471 |
| 204 | Ga0157379_10307349 | 3300014968 | Bacteria | 1446 |
| 205 | Ga0157379_10317828 | 3300014968 | Bacteria | 1421 |
| 206 | Ga0157376_10006652 | 3300014969 | Bacteria | 8184 |
| 207 | Ga0157376_10039331 | 3300014969 | Bacteria | 3856 |
| 208 | Ga0157376_10192833 | 3300014969 | Bacteria | 1869 |
| 209 | Ga0157376_10219183 | 3300014969 | Bacteria | 1761 |
| 210 | Ga0157376_10473175 | 3300014969 | Bacteria | 1226 |
| 211 | Ga0163161_10320298 | 3300017792 | Bacteria | 1226 |
| 212 | Ga0207666_1006632 | 3300025271 | Bacteria | 1505 |
| 213 | Ga0207642_10096783 | 3300025899 | Bacteria | 1472 |
| 214 | Ga0207642_10101813 | 3300025899 | Bacteria | 1444 |
| 215 | Ga0207642_10205402 | 3300025899 | Bacteria | 1091 |
| 216 | Ga0207710_10005045 | 3300025900 | Bacteria | 5720 |
| 217 | Ga0207680_10085159 | 3300025903 | Bacteria | 1996 |
| 218 | Ga0207680_10104903 | 3300025903 | Bacteria | 1822 |
| 219 | Ga0207685_10064368 | 3300025905 | Bacteria | 1464 |
| 220 | Ga0207699_10026006 | 3300025906 | Bacteria | 3221 |
| 221 | Ga0207645_10006009 | 3300025907 | Bacteria | 8732 |
| 222 | Ga0207645_10006324 | 3300025907 | Bacteria | 8515 |
| 223 | Ga0207645_10067745 | 3300025907 | Bacteria | 2282 |
| 224 | Ga0207705_10046296 | 3300025909 | Bacteria | 3126 |
| 225 | Ga0207654_10219741 | 3300025911 | Bacteria | 1260 |
| 226 | Ga0207707_10009702 | 3300025912 | Bacteria | 8352 |
| 227 | Ga0207707_10453123 | 3300025912 | Bacteria | 1098 |
| 228 | Ga0207695_10124830 | 3300025913 | Bacteria | 2538 |
| 229 | Ga0207660_10220743 | 3300025917 | Bacteria | 1487 |
| 230 | Ga0207660_10393425 | 3300025917 | Bacteria | 1115 |
| 231 | Ga0207662_10453221 | 3300025918 | Bacteria | 877 |
| 232 | Ga0207657_10062935 | 3300025919 | Bacteria | 3174 |
| 233 | Ga0207657_10409609 | 3300025919 | Bacteria | 1066 |
| 234 | Ga0207649_10315995 | 3300025920 | Bacteria | 1146 |
| 235 | Ga0207652_10026671 | 3300025921 | Bacteria | 4814 |
| 236 | Ga0207652_10044785 | 3300025921 | Bacteria | 3771 |
| 237 | Ga0207646_10144225 | 3300025922 | Bacteria | 2146 |
| 238 | Ga0207646_10212269 | 3300025922 | Bacteria | 1748 |
| 239 | Ga0207681_10035345 | 3300025923 | Bacteria | 3292 |
| 240 | Ga0207681_10059847 | 3300025923 | Bacteria | 2612 |
| 241 | Ga0207681_10072387 | 3300025923 | Bacteria | 2407 |
| 242 | Ga0207694_10028442 | 3300025924 | Bacteria | 4261 |
| 243 | Ga0207650_10130806 | 3300025925 | Bacteria | 1964 |
| 244 | Ga0207650_10148890 | 3300025925 | Bacteria | 1846 |
| 245 | Ga0207650_10237354 | 3300025925 | Bacteria | 1472 |
| 246 | Ga0207659_10016524 | 3300025926 | Bacteria | 4804 |
| 247 | Ga0207659_10033686 | 3300025926 | Bacteria | 3529 |
| 248 | Ga0207659_10034662 | 3300025926 | Bacteria | 3482 |
| 249 | Ga0207687_10024346 | 3300025927 | Bacteria | 4044 |
| 250 | Ga0207687_10025557 | 3300025927 | Bacteria | 3952 |
| 251 | Ga0207687_10582484 | 3300025927 | Bacteria | 941 |
| 252 | Ga0207700_10058086 | 3300025928 | Bacteria | 2921 |
| 253 | Ga0207700_10147170 | 3300025928 | Bacteria | 1943 |
| 254 | Ga0207664_10074382 | 3300025929 | Bacteria | 2745 |
| 255 | Ga0207644_10039686 | 3300025931 | Bacteria | 3324 |
| 256 | Ga0207706_10068825 | 3300025933 | Bacteria | 3114 |
| 257 | Ga0207706_10236414 | 3300025933 | Bacteria | 1597 |
| 258 | Ga0207706_10243624 | 3300025933 | Bacteria | 1571 |
| 259 | Ga0207706_10529905 | 3300025933 | Bacteria | 1015 |
| 260 | Ga0207686_10050874 | 3300025934 | Bacteria | 2578 |
| 261 | Ga0207686_10079226 | 3300025934 | Bacteria | 2139 |
| 262 | Ga0207686_10127474 | 3300025934 | Bacteria | 1741 |
| 263 | Ga0207686_10282682 | 3300025934 | Bacteria | 1225 |
| 264 | Ga0207686_10411303 | 3300025934 | Bacteria | 1033 |
| 265 | Ga0207709_10023381 | 3300025935 | Bacteria | 3517 |
| 266 | Ga0207709_10052940 | 3300025935 | Bacteria | 2496 |
| 267 | Ga0207670_10036808 | 3300025936 | Bacteria | 3186 |
| 268 | Ga0207670_10130715 | 3300025936 | Bacteria | 1839 |
| 269 | Ga0207670_10524035 | 3300025936 | Bacteria | 965 |
| 270 | Ga0207669_10005445 | 3300025937 | Bacteria | 5711 |
| 271 | Ga0207669_10043537 | 3300025937 | Bacteria | 2630 |
| 272 | Ga0207669_10048881 | 3300025937 | Bacteria | 2517 |
| 273 | Ga0207669_10154204 | 3300025937 | Bacteria | 1613 |
| 274 | Ga0207704_10007412 | 3300025938 | Bacteria | 5182 |
| 275 | Ga0207704_10354821 | 3300025938 | Bacteria | 1143 |
| 276 | Ga0207691_10070971 | 3300025940 | Bacteria | 3144 |
| 277 | Ga0207691_10225017 | 3300025940 | Bacteria | 1626 |
| 278 | Ga0207691_10236733 | 3300025940 | Bacteria | 1579 |
| 279 | Ga0207711_10017096 | 3300025941 | Bacteria | 6025 |
| 280 | Ga0207711_10030248 | 3300025941 | Bacteria | 4567 |
| 281 | Ga0207711_10111170 | 3300025941 | Bacteria | 2437 |
| 282 | Ga0207711_10133113 | 3300025941 | Bacteria | 2231 |
| 283 | Ga0207711_10314522 | 3300025941 | Bacteria | 1446 |
| 284 | Ga0207689_10201565 | 3300025942 | Bacteria | 1642 |
| 285 | Ga0207689_10427135 | 3300025942 | Bacteria | 1106 |
| 286 | Ga0207661_10101252 | 3300025944 | Bacteria | 2420 |
| 287 | Ga0207667_10076643 | 3300025949 | Bacteria | 3469 |
| 288 | Ga0207651_10067185 | 3300025960 | Bacteria | 2522 |
| 289 | Ga0207651_10077779 | 3300025960 | Bacteria | 2377 |
| 290 | Ga0207712_10061429 | 3300025961 | Bacteria | 2667 |
| 291 | Ga0207668_10041866 | 3300025972 | Bacteria | 3098 |
| 292 | Ga0207668_10207359 | 3300025972 | Bacteria | 1565 |
| 293 | Ga0207640_10010279 | 3300025981 | Bacteria | 5267 |
| 294 | Ga0207640_10074736 | 3300025981 | Bacteria | 2295 |
| 295 | Ga0207658_10018525 | 3300025986 | Bacteria | 4809 |
| 296 | Ga0207658_10585320 | 3300025986 | Bacteria | 1001 |
| 297 | Ga0207677_10093111 | 3300026023 | Bacteria | 2196 |
| 298 | Ga0207677_10250165 | 3300026023 | Bacteria | 1439 |
| 299 | Ga0207677_10460145 | 3300026023 | Bacteria | 1092 |
| 300 | Ga0207703_10019414 | 3300026035 | Bacteria | 5311 |
| 301 | Ga0207703_10065396 | 3300026035 | Bacteria | 2988 |
| 302 | Ga0207703_10141179 | 3300026035 | Bacteria | 2091 |
| 303 | Ga0207703_10539900 | 3300026035 | Bacteria | 1098 |
| 304 | Ga0207708_10022453 | 3300026075 | Bacteria | 4765 |
| 305 | Ga0207708_10234779 | 3300026075 | Bacteria | 1473 |
| 306 | Ga0207702_10111114 | 3300026078 | Bacteria | 2437 |
| 307 | Ga0207641_10035902 | 3300026088 | Bacteria | 4134 |
| 308 | Ga0207641_10147286 | 3300026088 | Bacteria | 2130 |
| 309 | Ga0207641_10483715 | 3300026088 | Bacteria | 1200 |
| 310 | Ga0207648_10040162 | 3300026089 | Bacteria | 4112 |
| 311 | Ga0207648_10050763 | 3300026089 | Bacteria | 3626 |
| 312 | Ga0207648_10096952 | 3300026089 | Bacteria | 2581 |
| 313 | Ga0207648_10140991 | 3300026089 | Bacteria | 2124 |
| 314 | Ga0207676_10012077 | 3300026095 | Bacteria | 6181 |
| 315 | Ga0207676_10072541 | 3300026095 | Bacteria | 2768 |
| 316 | Ga0207676_10093749 | 3300026095 | Bacteria | 2472 |
| 317 | Ga0207675_100059063 | 3300026118 | Bacteria | 3579 |
| 318 | Ga0207675_100100460 | 3300026118 | Bacteria | 2725 |
| 319 | Ga0207675_100158695 | 3300026118 | Bacteria | 2156 |
| 320 | Ga0207675_100366124 | 3300026118 | Bacteria | 1415 |
| 321 | Ga0209970_1030532 | 3300027614 | Bacteria | 935 |
| 322 | Ga0209983_1060144 | 3300027665 | Bacteria | 839 |
| 323 | Ga0209966_1052585 | 3300027695 | Bacteria | 869 |
| 324 | Ga0207428_10015437 | 3300027907 | Bacteria | 6607 |
| 325 | Ga0207428_10157424 | 3300027907 | Bacteria | 1727 |
| 326 | Ga0207428_10221108 | 3300027907 | Bacteria | 1419 |
| 327 | Ga0207428_10384762 | 3300027907 | Bacteria | 1029 |
| 328 | Ga0268266_10014138 | 3300028379 | Bacteria | 6869 |
| 329 | Ga0268266_10050461 | 3300028379 | Bacteria | 3570 |
| 330 | Ga0268266_10158569 | 3300028379 | Bacteria | 2046 |
| 331 | Ga0268265_10005659 | 3300028380 | Bacteria | 8538 |
| 332 | Ga0268265_10008952 | 3300028380 | Bacteria | 6770 |
| 333 | Ga0268265_10141024 | 3300028380 | Bacteria | 2018 |
| 334 | Ga0268265_10379527 | 3300028380 | Bacteria | 1300 |
| 335 | Ga0268264_10110219 | 3300028381 | Bacteria | 2410 |
| 336 | Ga0307511_10168033 | 3300030521 | Bacteria | 1213 |
| 337 | Ga0265316_10255161 | 3300031344 | Bacteria | 1287 |
| 338 | Ga0307408_100132347 | 3300031548 | Bacteria | 1947 |
| 339 | Ga0265314_10094341 | 3300031711 | Bacteria | 1940 |
| 340 | Ga0307405_10044578 | 3300031731 | Bacteria | 2713 |
| 341 | Ga0307413_10029767 | 3300031824 | Bacteria | 3060 |
| 342 | Ga0307410_10036232 | 3300031852 | Bacteria | 3211 |
| 343 | Ga0307410_10720221 | 3300031852 | Bacteria | 842 |
| 344 | Ga0307407_10029802 | 3300031903 | Bacteria | 2936 |
| 345 | Ga0307407_10042726 | 3300031903 | Bacteria | 2544 |
| 346 | Ga0307412_10026630 | 3300031911 | Bacteria | 3596 |
| 347 | Ga0307412_10491851 | 3300031911 | Bacteria | 1019 |
| 348 | Ga0307416_100053163 | 3300032002 | Bacteria | 3248 |
| 349 | Ga0307416_100061516 | 3300032002 | Bacteria | 3065 |
| 350 | Ga0307416_100849313 | 3300032002 | Bacteria | 1011 |
| 351 | Ga0307414_10028922 | 3300032004 | Bacteria | 3601 |
| 352 | Ga0307414_10233615 | 3300032004 | Bacteria | 1518 |
| 353 | Ga0307411_10008920 | 3300032005 | Bacteria | 5233 |
| 354 | Ga0307411_10199489 | 3300032005 | Bacteria | 1535 |
| 355 | Ga0307411_10201535 | 3300032005 | Bacteria | 1529 |
| 356 | Ga0307415_100258967 | 3300032126 | Bacteria | 1418 |
| 357 | Ga0373958_0005121 | 3300034819 | Bacteria | 1975 |
| 358 | Ga0373958_0064206 | 3300034819 | Bacteria | 802 |
| 359 | Ga0373926_0108247 | 3300035083 | Bacteria | 1043 |
| 360 | Ga0373928_0003886 | 3300035084 | Bacteria | 2850 |
| 361 | Ga0373929_0000476 | 3300035085 | Bacteria | 7687 |
| 362 | Ga0373934_0025094 | 3300035086 | Bacteria | 2307 |
| 363 | Ga0373940_0013537 | 3300035088 | Bacteria | 1976 |
| 364 | Ga0373952_0002124 | 3300035092 | Bacteria | 3561 |
| 365 | Ga0373923_0065476 | 3300035111 | Bacteria | 1551 |
| 366 | Ga0373932_0000869 | 3300035112 | Bacteria | 8931 |
| 367 | Ga0373939_0002902 | 3300035114 | Bacteria | 4030 |
| 368 | Ga0373941_0000162 | 3300035115 | Bacteria | 12194 |
| 369 | Ga0373941_0142473 | 3300035115 | Bacteria | 873 |
| 370 | Ga0373953_0035314 | 3300035117 | Bacteria | 1964 |
| 371 | Ga0373943_0014498 | 3300035170 | Bacteria | 3570 |
| 372 | Ga0373943_0071261 | 3300035170 | Bacteria | 1761 |
| 373 | Ga0373943_0141145 | 3300035170 | Bacteria | 1298 |
| 374 | Ga0373946_0134067 | 3300035171 | Bacteria | 1142 |
| 375 | Ga0373955_0011602 | 3300035172 | Bacteria | 4206 |
| 376 | Ga0373961_0002875 | 3300035241 | Bacteria | 4367 |
| 377 | Ga0373962_0001294 | 3300035242 | Bacteria | 5878 |
| 378 | Ga0373924_0027127 | 3300035410 | Bacteria | 2276 |
| 379 | Ga0373924_0066840 | 3300035410 | Bacteria | 1512 |
| 380 | Ga0373931_0001425 | 3300035691 | Bacteria | 10252 |
| 381 | Ga0373931_0385259 | 3300035691 | Bacteria | 885 |
| 382 | Ga0373935_0094398 | 3300035692 | Bacteria | 1963 |
| 383 | Ga0373933_0131920 | 3300035724 | Bacteria | 1572 |
| 384 | Ga0373933_0158390 | 3300035724 | Bacteria | 1437 |
| 385 | Ga0373937_0111499 | 3300036401 | Bacteria | 2545 |
| 386 | Ga0373937_0201095 | 3300036401 | Bacteria | 1873 |
| 387 | Ga0373937_0212161 | 3300036401 | Bacteria | 1822 |
| 388 | Ga0373937_0547980 | 3300036401 | Bacteria | 1099 |
| 389 | Ga0373925_0036446 | 3300037068 | Bacteria | 3630 |
| 390 | Ga0373925_0125144 | 3300037068 | Bacteria | 1999 |
| 391 | Ga0373925_0255474 | 3300037068 | Bacteria | 1406 |
| 392 | Ga0395901_0736848 | 3300038443 | Bacteria | 980 |
| 393 | Ga0436365_0196462 | 3300039437 | Bacteria | 1159 |
| 394 | Ga0436365_1477503 | 3300039437 | Bacteria | 3169 |
| 395 | Ga0439441_053999 | 3300042001 | Bacteria | 833 |
| 396 | Ga0450894_001375 | 3300042131 | Bacteria | 3516 |
| 397 | Ga0450896_001990 | 3300042133 | Bacteria | 2599 |
| 398 | Ga0439435_0032138 | 3300042436 | Bacteria | 1431 |
| 399 | Ga0439444_0028252 | 3300042437 | Bacteria | 1038 |
| 400 | Ga0451577_0175182 | 3300042876 | Bacteria | 1933 |
| 401 | Ga0439440_0024555 | 3300042993 | Bacteria | 1383 |
| 402 | Ga0453683_0057214 | 3300044673 | Bacteria | 2440 |
| 403 | Ga0453684_0041993 | 3300044712 | Bacteria | 6172 |
| 404 | Ga0451576_0239178 | 3300045051 | Bacteria | 1897 |
| 405 | Ga0451576_0276138 | 3300045051 | Bacteria | 1757 |
| 406 | Ga0495592_0046686 | 3300046454 | Bacteria | 3228 |
| 407 | Ga0495629_0549387 | 3300046459 | Bacteria | 775 |
| 408 | Ga0495582_0078830 | 3300046473 | Bacteria | 1828 |
| 409 | Ga0495639_0074794 | 3300046475 | Bacteria | 1570 |
| 410 | Ga0495639_0152036 | 3300046475 | Bacteria | 1117 |
| 411 | Ga0495662_0268754 | 3300046476 | Bacteria | 839 |
| 412 | Ga0495608_0077000 | 3300046511 | Bacteria | 2171 |
| 413 | Ga0495618_0262316 | 3300046514 | Bacteria | 1082 |
| 414 | Ga0495628_0189513 | 3300046516 | Bacteria | 1553 |
| 415 | Ga0495630_0065438 | 3300046517 | Bacteria | 2732 |
| 416 | Ga0495652_0235221 | 3300046529 | Bacteria | 1367 |
| 417 | Ga0495640_0061808 | 3300046533 | Bacteria | 2543 |
| 418 | Ga0495640_0278053 | 3300046533 | Bacteria | 1043 |
| 419 | Ga0495586_0362430 | 3300046535 | Bacteria | 833 |
| 420 | Ga0495587_0198759 | 3300046536 | Bacteria | 1134 |
| 421 | Ga0495621_0022242 | 3300046539 | Bacteria | 2100 |
| 422 | Ga0495645_0004545 | 3300046543 | Bacteria | 9467 |
| 423 | Ga0495645_0093654 | 3300046543 | Bacteria | 2143 |
| 424 | Ga0495667_0092973 | 3300046559 | Bacteria | 1953 |
| 425 | Ga0495634_0051230 | 3300046642 | Bacteria | 2771 |
| 426 | Ga0495647_0071361 | 3300046681 | Bacteria | 1391 |
| 427 | Ga0495647_0132184 | 3300046681 | Bacteria | 1058 |
| 428 | Ga0495647_0175361 | 3300046681 | Bacteria | 930 |
| 429 | Ga0495647_0190611 | 3300046681 | Bacteria | 896 |
| 430 | Ga0495658_0014786 | 3300046683 | Bacteria | 3993 |
| 431 | Ga0495658_0019658 | 3300046683 | Bacteria | 3529 |
| 432 | Ga0495669_0004751 | 3300046684 | Bacteria | 5631 |
| 433 | Ga0495613_0003530 | 3300046689 | Bacteria | 11718 |
| 434 | Ga0495613_0178398 | 3300046689 | Bacteria | 1505 |
| 435 | Ga0495600_0178298 | 3300046809 | Bacteria | 1369 |
| 436 | Ga0495604_0035813 | 3300047317 | Bacteria | 3917 |
| 437 | Ga0495674_0004626 | 3300047319 | Bacteria | 13230 |
| 438 | Ga0495674_0049820 | 3300047319 | Bacteria | 3698 |
| 439 | Ga0495674_0322592 | 3300047319 | Bacteria | 1258 |
| 440 | Ga0495680_0106070 | 3300047322 | Bacteria | 2089 |
| 441 | Ga0495675_0179514 | 3300047444 | Bacteria | 1297 |
| 442 | Ga0495684_0000682 | 3300047471 | Bacteria | 27327 |
| 443 | Ga0496100_0005884 | 3300048903 | Bacteria | 6641 |
| 444 | Ga0496100_0413813 | 3300048903 | Bacteria | 1029 |
| 445 | Ga0496101_0000222 | 3300048904 | Bacteria | 42490 |
| 446 | Ga0496101_0115492 | 3300048904 | Bacteria | 2025 |
| 447 | Ga0496104_0001478 | 3300048907 | Bacteria | 20272 |
| 448 | Ga0496104_0012796 | 3300048907 | Bacteria | 7558 |
| 449 | Ga0496104_0023018 | 3300048907 | Bacteria | 5725 |
| 450 | Ga0496104_0264515 | 3300048907 | Bacteria | 1632 |
| 451 | Ga0496104_0363191 | 3300048907 | Bacteria | 1360 |
| 452 | Ga0496104_0573568 | 3300048907 | Bacteria | 1039 |
| 453 | Ga0496105_0189990 | 3300048908 | Bacteria | 1680 |
| 454 | Ga0496105_0291401 | 3300048908 | Bacteria | 1314 |
| 455 | Ga0496107_0011835 | 3300048910 | Bacteria | 6093 |
| 456 | Ga0496108_0225264 | 3300048911 | Bacteria | 1630 |
| 457 | Ga0496110_0061241 | 3300048913 | Bacteria | 3321 |
| 458 | Ga0496110_0817344 | 3300048913 | Bacteria | 837 |
| 459 | Ga0496112_0014577 | 3300048915 | Bacteria | 7302 |
| 460 | Ga0496112_0090825 | 3300048915 | Bacteria | 3023 |
| 461 | Ga0496112_0109110 | 3300048915 | Bacteria | 2738 |
| 462 | Ga0496112_0159093 | 3300048915 | Bacteria | 2225 |
| 463 | Ga0496112_0414445 | 3300048915 | Bacteria | 1286 |
| 464 | Ga0496113_0058705 | 3300048916 | Bacteria | 2896 |
| 465 | Ga0496114_0000416 | 3300048917 | Bacteria | 31603 |
| 466 | Ga0496114_0080527 | 3300048917 | Bacteria | 2751 |
| 467 | Ga0496114_0289401 | 3300048917 | Bacteria | 1445 |
| 468 | Ga0496115_0343797 | 3300048918 | Bacteria | 1217 |
| 469 | Ga0496115_0422201 | 3300048918 | Bacteria | 1080 |
| 470 | Ga0501034_0029753 | 3300049571 | Bacteria | 5552 |
| 471 | Ga0501034_0154904 | 3300049571 | Bacteria | 2266 |
| 472 | Ga0501043_0055792 | 3300049579 | Bacteria | 3104 |
| 473 | Ga0501047_0005040 | 3300049581 | Bacteria | 12396 |
| 474 | Ga0501047_0543817 | 3300049581 | Bacteria | 986 |
| 475 | Ga0501067_0238662 | 3300049583 | Bacteria | 1012 |
| 476 | Ga0501068_0253567 | 3300049584 | Bacteria | 1122 |
| 477 | Ga0501069_0250502 | 3300049585 | Bacteria | 1033 |
| 478 | Ga0501072_0299289 | 3300049588 | Bacteria | 1279 |
| 479 | Ga0501073_0000842 | 3300049589 | Bacteria | 21848 |
| 480 | Ga0501073_0140011 | 3300049589 | Bacteria | 1677 |
| 481 | Ga0501074_0664230 | 3300049590 | Bacteria | 736 |
| 482 | Ga0501075_0078051 | 3300049591 | Bacteria | 2507 |
| 483 | Ga0501080_1033309 | 3300049742 | Bacteria | 712 |
| 484 | Ga0501083_0303795 | 3300049744 | Bacteria | 1038 |
| 485 | Ga0501044_0010338 | 3300049823 | Bacteria | 10131 |
| 486 | Ga0501044_0361372 | 3300049823 | Bacteria | 1370 |
| 487 | nmdc:mga05p37_173687_c1 | 3300050507 | Bacteria | 2626 |
| 488 | nmdc:mga05p37_180383_c1 | 3300050507 | Bacteria | 2569 |
| 489 | nmdc:mga05p37_31924_c1 | 3300050507 | Bacteria | 6438 |
| 490 | nmdc:mga05p37_37393_c1 | 3300050507 | Bacteria | 5951 |
| 491 | nmdc:mga05p37_3900_c2 | 3300050507 | Bacteria | 9812 |
| 492 | nmdc:mga05p37_437388_c1 | 3300050507 | Bacteria | 1518 |
| 493 | nmdc:mga05p37_56606_c2 | 3300050507 | Bacteria | 4434 |
| 494 | nmdc:mga09592_255344_c1 | 3300050508 | Bacteria | 1519 |
| 495 | nmdc:mga08y16_106682_c1 | 3300050511 | Bacteria | 2916 |
| 496 | nmdc:mga08y16_18380_c1 | 3300050511 | Bacteria | 7369 |
| 497 | nmdc:mga08y16_24143_c1 | 3300050511 | Bacteria | 6419 |
| 498 | nmdc:mga08y16_506548_c1 | 3300050511 | Bacteria | 1226 |
| 499 | nmdc:mga08y16_810171_c1 | 3300050511 | Bacteria | 929 |
| 500 | nmdc:mga08y16_92293_c1 | 3300050511 | Bacteria | 3155 |
| 501 | nmdc:mga0n895_129287_c1 | 3300050512 | Bacteria | 2550 |
| 502 | nmdc:mga0n895_160033_c1 | 3300050512 | Bacteria | 2283 |
| 503 | nmdc:mga0n895_16738_c1 | 3300050512 | Bacteria | 6737 |
| 504 | nmdc:mga0n895_202086_c1 | 3300050512 | Bacteria | 2018 |
| 505 | nmdc:mga0n895_50367_c1 | 3300050512 | Bacteria | 4083 |
| 506 | nmdc:mga0n895_567_c1 | 3300050512 | Bacteria | 25311 |
| 507 | nmdc:mga0rr50_104537_c1 | 3300050513 | Bacteria | 2231 |
| 508 | nmdc:mga0rr50_114_c1 | 3300050513 | Bacteria | 44678 |
| 509 | nmdc:mga0rr50_203514_c1 | 3300050513 | Bacteria | 1628 |
| 510 | nmdc:mga0rr50_228976_c1 | 3300050513 | Bacteria | 1537 |
| 511 | nmdc:mga0rr50_253177_c1 | 3300050513 | Bacteria | 1463 |
| 512 | nmdc:mga0rr50_4071_c1 | 3300050513 | Bacteria | 8533 |
| 513 | nmdc:mga0rr50_96164_c1 | 3300050513 | Bacteria | 2317 |
| 514 | nmdc:mga08x19_16651_c1 | 3300050514 | Bacteria | 4486 |
| 515 | nmdc:mga08x19_18247_c1 | 3300050514 | Bacteria | 4300 |
| 516 | nmdc:mga08x19_19790_c1 | 3300050514 | Bacteria | 4137 |
| 517 | nmdc:mga08x19_339232_c1 | 3300050514 | Bacteria | 1048 |
| 518 | nmdc:mga08x19_5290_c1 | 3300050514 | Bacteria | 7632 |
| 519 | nmdc:mga0a205_113353_c1 | 3300050515 | Bacteria | 2610 |
| 520 | nmdc:mga0a205_292633_c1 | 3300050515 | Bacteria | 1503 |
| 521 | nmdc:mga0a205_611882_c1 | 3300050515 | Bacteria | 942 |
| 522 | nmdc:mga0a205_79619_c1 | 3300050515 | Bacteria | 2507 |
| 523 | Ga0495601_0003363 | 3300053077 | Bacteria | 9157 |
| 524 | Ga0495612_0081922 | 3300053078 | Bacteria | 1357 |
| 525 | Ga0495595_0063838 | 3300053084 | Bacteria | 1730 |
| 526 | Ga0495619_0001979 | 3300053085 | Bacteria | 13653 |
| 527 | Ga0590071_001549 | 3300059421 | Bacteria | 6015 |
| 528 | Ga0590074_007650 | 3300059423 | Bacteria | 1796 |
| 529 | Ga0590075_000822 | 3300059424 | Bacteria | 8164 |
| 530 | Ga0590075_060135 | 3300059424 | Bacteria | 979 |
| 531 | Ga0590077_001087 | 3300059426 | Bacteria | 6731 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046475 | Ga0495639_0074794 | Ga0495639_0074794_823_1500 | 225 |
| 2 | 3300046476 | Ga0495662_0268754 | Ga0495662_0268754_74_751 | 225 |
| 3 | 3300046683 | Ga0495658_0014786 | Ga0495658_0014786_2759_3436 | 225 |
| 4 | 3300049590 | Ga0501074_0664230 | Ga0501074_0664230_41_721 | 226 |
| 5 | 3300049742 | Ga0501080_1033309 | Ga0501080_1033309_13_699 | 228 |
| 6 | 3300049823 | Ga0501044_0361372 | Ga0501044_0361372_437_1123 | 228 |
| 7 | 3300050513 | nmdc:mga0rr50_253177_c1 | nmdc:mga0rr50_253177_c1_436_1125 | 229 |
| 8 | 3300006847 | Ga0075431_100587193 | Ga0075431_1005871931 | 230 |
| 9 | 3300009147 | Ga0114129_10504499 | Ga0114129_105044992 | 230 |
| 10 | 3300025909 | Ga0207705_10046296 | Ga0207705_100462961 | 230 |
| 11 | 3300027614 | Ga0209970_1030532 | Ga0209970_10305322 | 230 |
| 12 | 3300032005 | Ga0307411_10201535 | Ga0307411_102015352 | 230 |
| 13 | 3300050511 | nmdc:mga08y16_810171_c1 | nmdc:mga08y16_810171_c1_207_899 | 230 |
| 14 | 3300035115 | Ga0373941_0142473 | Ga0373941_0142473_23_721 | 231 |
| 15 | 3300046475 | Ga0495639_0152036 | Ga0495639_0152036_333_1028 | 231 |
| 16 | 3300046535 | Ga0495586_0362430 | Ga0495586_0362430_22_717 | 231 |
| 17 | 3300048903 | Ga0496100_0413813 | Ga0496100_0413813_62_778 | 231 |
| 18 | 3300025923 | Ga0207681_10035345 | Ga0207681_100353452 | 232 |
| 19 | 3300050514 | nmdc:mga08x19_18247_c1 | nmdc:mga08x19_18247_c1_3446_4156 | 236 |
| 20 | 3300009147 | Ga0114129_10539314 | Ga0114129_105393142 | 238 |
| 21 | 3300050507 | nmdc:mga05p37_437388_c1 | nmdc:mga05p37_437388_c1_407_1156 | 238 |
| 22 | 3300009148 | Ga0105243_10464179 | Ga0105243_104641791 | 239 |
| 23 | 3300025927 | Ga0207687_10024346 | Ga0207687_100243464 | 239 |
| 24 | 3300014326 | Ga0157380_10034411 | Ga0157380_100344113 | 240 |
| 25 | 3300049584 | Ga0501068_0253567 | Ga0501068_0253567_212_961 | 240 |
| 26 | 3300005435 | Ga0070714_100010088 | Ga0070714_1000100883 | 242 |
| 27 | 3300025928 | Ga0207700_10147170 | Ga0207700_101471703 | 242 |
| 28 | 3300025929 | Ga0207664_10074382 | Ga0207664_100743822 | 242 |
| 29 | 3300027695 | Ga0209966_1052585 | Ga0209966_10525851 | 243 |
| 30 | 3300042437 | Ga0439444_0028252 | Ga0439444_0028252_98_847 | 243 |
| 31 | 3300042993 | Ga0439440_0024555 | Ga0439440_0024555_329_1078 | 243 |
| 32 | 3300049581 | Ga0501047_0543817 | Ga0501047_0543817_82_831 | 243 |
| 33 | 3300049589 | Ga0501073_0000842 | Ga0501073_0000842_11136_11873 | 245 |
| 34 | 3300005356 | Ga0070674_100013152 | Ga0070674_1000131522 | 246 |
| 35 | 3300005444 | Ga0070694_100206932 | Ga0070694_1002069321 | 246 |
| 36 | 3300025917 | Ga0207660_10220743 | Ga0207660_102207432 | 246 |
| 37 | 3300025937 | Ga0207669_10043537 | Ga0207669_100435373 | 246 |
| 38 | 3300031852 | Ga0307410_10036232 | Ga0307410_100362322 | 246 |
| 39 | 3300031903 | Ga0307407_10042726 | Ga0307407_100427263 | 246 |
| 40 | 3300031911 | Ga0307412_10491851 | Ga0307412_104918511 | 246 |
| 41 | 3300032002 | Ga0307416_100061516 | Ga0307416_1000615163 | 246 |
| 42 | 3300032005 | Ga0307411_10199489 | Ga0307411_101994892 | 246 |
| 43 | 3300049744 | Ga0501083_0303795 | Ga0501083_0303795_45_899 | 246 |
| 44 | 3300005328 | Ga0070676_10006255 | Ga0070676_100062555 | 247 |
| 45 | 3300005328 | Ga0070676_10136513 | Ga0070676_101365132 | 247 |
| 46 | 3300005338 | Ga0068868_100777555 | Ga0068868_1007775551 | 247 |
| 47 | 3300005341 | Ga0070691_10001817 | Ga0070691_100018172 | 247 |
| 48 | 3300005345 | Ga0070692_10288215 | Ga0070692_102882151 | 247 |
| 49 | 3300005353 | Ga0070669_100020427 | Ga0070669_1000204275 | 247 |
| 50 | 3300005438 | Ga0070701_10018366 | Ga0070701_100183661 | 247 |
| 51 | 3300005440 | Ga0070705_100006979 | Ga0070705_1000069795 | 247 |
| 52 | 3300005440 | Ga0070705_100477987 | Ga0070705_1004779871 | 247 |
| 53 | 3300005441 | Ga0070700_100008749 | Ga0070700_1000087495 | 247 |
| 54 | 3300005441 | Ga0070700_100114318 | Ga0070700_1001143182 | 247 |
| 55 | 3300005459 | Ga0068867_100013036 | Ga0068867_1000130362 | 247 |
| 56 | 3300005459 | Ga0068867_100487205 | Ga0068867_1004872051 | 247 |
| 57 | 3300005545 | Ga0070695_100039144 | Ga0070695_1000391442 | 247 |
| 58 | 3300005546 | Ga0070696_100009094 | Ga0070696_1000090944 | 247 |
| 59 | 3300005578 | Ga0068854_100036116 | Ga0068854_1000361162 | 247 |
| 60 | 3300005615 | Ga0070702_100008320 | Ga0070702_1000083203 | 247 |
| 61 | 3300005844 | Ga0068862_100013148 | Ga0068862_1000131482 | 247 |
| 62 | 3300006847 | Ga0075431_100096671 | Ga0075431_1000966713 | 247 |
| 63 | 3300006852 | Ga0075433_10414204 | Ga0075433_104142042 | 247 |
| 64 | 3300006880 | Ga0075429_100285639 | Ga0075429_1002856392 | 247 |
| 65 | 3300009147 | Ga0114129_10005698 | Ga0114129_100056985 | 247 |
| 66 | 3300009148 | Ga0105243_10116206 | Ga0105243_101162062 | 247 |
| 67 | 3300009177 | Ga0105248_10225992 | Ga0105248_102259922 | 247 |
| 68 | 3300014325 | Ga0163163_10003074 | Ga0163163_100030748 | 247 |
| 69 | 3300014969 | Ga0157376_10192833 | Ga0157376_101928332 | 247 |
| 70 | 3300025271 | Ga0207666_1006632 | Ga0207666_10066322 | 247 |
| 71 | 3300025907 | Ga0207645_10006324 | Ga0207645_100063245 | 247 |
| 72 | 3300025907 | Ga0207645_10067745 | Ga0207645_100677452 | 247 |
| 73 | 3300025923 | Ga0207681_10059847 | Ga0207681_100598472 | 247 |
| 74 | 3300025925 | Ga0207650_10148890 | Ga0207650_101488902 | 247 |
| 75 | 3300025926 | Ga0207659_10034662 | Ga0207659_100346622 | 247 |
| 76 | 3300025933 | Ga0207706_10243624 | Ga0207706_102436242 | 247 |
| 77 | 3300025935 | Ga0207709_10052940 | Ga0207709_100529402 | 247 |
| 78 | 3300025937 | Ga0207669_10048881 | Ga0207669_100488814 | 247 |
| 79 | 3300025972 | Ga0207668_10041866 | Ga0207668_100418664 | 247 |
| 80 | 3300026075 | Ga0207708_10022453 | Ga0207708_100224535 | 247 |
| 81 | 3300026088 | Ga0207641_10147286 | Ga0207641_101472862 | 247 |
| 82 | 3300026118 | Ga0207675_100100460 | Ga0207675_1001004602 | 247 |
| 83 | 3300026118 | Ga0207675_100158695 | Ga0207675_1001586952 | 247 |
| 84 | 3300028380 | Ga0268265_10141024 | Ga0268265_101410242 | 247 |
| 85 | 3300031711 | Ga0265314_10094341 | Ga0265314_100943412 | 247 |
| 86 | 3300032002 | Ga0307416_100849313 | Ga0307416_1008493132 | 247 |
| 87 | 3300044673 | Ga0453683_0057214 | Ga0453683_0057214_422_1180 | 247 |
| 88 | 3300050507 | nmdc:mga05p37_31924_c1 | nmdc:mga05p37_31924_c1_1822_2565 | 247 |
| 89 | 3300050508 | nmdc:mga09592_255344_c1 | nmdc:mga09592_255344_c1_293_1036 | 247 |
| 90 | 3300050511 | nmdc:mga08y16_24143_c1 | nmdc:mga08y16_24143_c1_4299_5051 | 247 |
| 91 | 3300050515 | nmdc:mga0a205_113353_c1 | nmdc:mga0a205_113353_c1_752_1498 | 247 |
| 92 | 3300005293 | Ga0065715_10345576 | Ga0065715_103455761 | 248 |
| 93 | 3300005327 | Ga0070658_10023619 | Ga0070658_100236192 | 248 |
| 94 | 3300005328 | Ga0070676_10064781 | Ga0070676_100647812 | 248 |
| 95 | 3300005330 | Ga0070690_100052481 | Ga0070690_1000524812 | 248 |
| 96 | 3300005331 | Ga0070670_100112669 | Ga0070670_1001126692 | 248 |
| 97 | 3300005331 | Ga0070670_100136809 | Ga0070670_1001368093 | 248 |
| 98 | 3300005333 | Ga0070677_10062896 | Ga0070677_100628962 | 248 |
| 99 | 3300005335 | Ga0070666_10036007 | Ga0070666_100360072 | 248 |
| 100 | 3300005345 | Ga0070692_10054100 | Ga0070692_100541002 | 248 |
| 101 | 3300005347 | Ga0070668_100091013 | Ga0070668_1000910132 | 248 |
| 102 | 3300005353 | Ga0070669_100192244 | Ga0070669_1001922441 | 248 |
| 103 | 3300005354 | Ga0070675_100000055 | Ga0070675_10000005525 | 248 |
| 104 | 3300005354 | Ga0070675_100194031 | Ga0070675_1001940312 | 248 |
| 105 | 3300005355 | Ga0070671_100220534 | Ga0070671_1002205342 | 248 |
| 106 | 3300005356 | Ga0070674_100008789 | Ga0070674_1000087893 | 248 |
| 107 | 3300005356 | Ga0070674_100236649 | Ga0070674_1002366492 | 248 |
| 108 | 3300005364 | Ga0070673_100198822 | Ga0070673_1001988222 | 248 |
| 109 | 3300005365 | Ga0070688_100080837 | Ga0070688_1000808372 | 248 |
| 110 | 3300005434 | Ga0070709_10065043 | Ga0070709_100650432 | 248 |
| 111 | 3300005457 | Ga0070662_100184250 | Ga0070662_1001842502 | 248 |
| 112 | 3300005458 | Ga0070681_10075207 | Ga0070681_100752074 | 248 |
| 113 | 3300005458 | Ga0070681_10284906 | Ga0070681_102849062 | 248 |
| 114 | 3300005467 | Ga0070706_100440109 | Ga0070706_1004401091 | 248 |
| 115 | 3300005530 | Ga0070679_100154007 | Ga0070679_1001540073 | 248 |
| 116 | 3300005544 | Ga0070686_100000926 | Ga0070686_10000092615 | 248 |
| 117 | 3300005546 | Ga0070696_100136601 | Ga0070696_1001366012 | 248 |
| 118 | 3300005548 | Ga0070665_100030260 | Ga0070665_1000302604 | 248 |
| 119 | 3300005548 | Ga0070665_100426596 | Ga0070665_1004265962 | 248 |
| 120 | 3300005563 | Ga0068855_100329568 | Ga0068855_1003295682 | 248 |
| 121 | 3300005578 | Ga0068854_100011885 | Ga0068854_1000118854 | 248 |
| 122 | 3300005578 | Ga0068854_100097722 | Ga0068854_1000977222 | 248 |
| 123 | 3300005616 | Ga0068852_100405379 | Ga0068852_1004053792 | 248 |
| 124 | 3300005718 | Ga0068866_10039630 | Ga0068866_100396302 | 248 |
| 125 | 3300005843 | Ga0068860_100526005 | Ga0068860_1005260052 | 248 |
| 126 | 3300005844 | Ga0068862_100064039 | Ga0068862_1000640392 | 248 |
| 127 | 3300005985 | Ga0081539_10006667 | Ga0081539_100066672 | 248 |
| 128 | 3300006173 | Ga0070716_100163231 | Ga0070716_1001632312 | 248 |
| 129 | 3300006173 | Ga0070716_100278807 | Ga0070716_1002788072 | 248 |
| 130 | 3300006237 | Ga0097621_100113756 | Ga0097621_1001137562 | 248 |
| 131 | 3300006358 | Ga0068871_100028927 | Ga0068871_1000289272 | 248 |
| 132 | 3300006358 | Ga0068871_100542807 | Ga0068871_1005428071 | 248 |
| 133 | 3300006871 | Ga0075434_100007565 | Ga0075434_1000075657 | 248 |
| 134 | 3300006871 | Ga0075434_100042544 | Ga0075434_1000425442 | 248 |
| 135 | 3300006871 | Ga0075434_100219087 | Ga0075434_1002190872 | 248 |
| 136 | 3300006871 | Ga0075434_100898293 | Ga0075434_1008982931 | 248 |
| 137 | 3300006881 | Ga0068865_100049245 | Ga0068865_1000492452 | 248 |
| 138 | 3300006914 | Ga0075436_100003532 | Ga0075436_1000035325 | 248 |
| 139 | 3300006914 | Ga0075436_100031703 | Ga0075436_1000317033 | 248 |
| 140 | 3300006914 | Ga0075436_100057261 | Ga0075436_1000572612 | 248 |
| 141 | 3300007076 | Ga0075435_100000894 | Ga0075435_1000008942 | 248 |
| 142 | 3300007076 | Ga0075435_100050091 | Ga0075435_1000500914 | 248 |
| 143 | 3300007076 | Ga0075435_100060506 | Ga0075435_1000605062 | 248 |
| 144 | 3300007076 | Ga0075435_100318581 | Ga0075435_1003185812 | 248 |
| 145 | 3300009093 | Ga0105240_10463638 | Ga0105240_104636382 | 248 |
| 146 | 3300009094 | Ga0111539_10001440 | Ga0111539_100014407 | 248 |
| 147 | 3300009094 | Ga0111539_10004657 | Ga0111539_100046572 | 248 |
| 148 | 3300009098 | Ga0105245_10035367 | Ga0105245_100353673 | 248 |
| 149 | 3300009148 | Ga0105243_10014932 | Ga0105243_100149322 | 248 |
| 150 | 3300009148 | Ga0105243_10141369 | Ga0105243_101413692 | 248 |
| 151 | 3300009176 | Ga0105242_10035935 | Ga0105242_100359353 | 248 |
| 152 | 3300009177 | Ga0105248_10173430 | Ga0105248_101734302 | 248 |
| 153 | 3300009551 | Ga0105238_10055683 | Ga0105238_100556834 | 248 |
| 154 | 3300009551 | Ga0105238_10122850 | Ga0105238_101228503 | 248 |
| 155 | 3300013308 | Ga0157375_10121315 | Ga0157375_101213152 | 248 |
| 156 | 3300014968 | Ga0157379_10297347 | Ga0157379_102973471 | 248 |
| 157 | 3300014969 | Ga0157376_10006652 | Ga0157376_100066525 | 248 |
| 158 | 3300017792 | Ga0163161_10320298 | Ga0163161_103202981 | 248 |
| 159 | 3300025899 | Ga0207642_10096783 | Ga0207642_100967831 | 248 |
| 160 | 3300025899 | Ga0207642_10205402 | Ga0207642_102054022 | 248 |
| 161 | 3300025903 | Ga0207680_10085159 | Ga0207680_100851591 | 248 |
| 162 | 3300025907 | Ga0207645_10006009 | Ga0207645_100060092 | 248 |
| 163 | 3300025911 | Ga0207654_10219741 | Ga0207654_102197411 | 248 |
| 164 | 3300025919 | Ga0207657_10062935 | Ga0207657_100629353 | 248 |
| 165 | 3300025920 | Ga0207649_10315995 | Ga0207649_103159951 | 248 |
| 166 | 3300025921 | Ga0207652_10026671 | Ga0207652_100266715 | 248 |
| 167 | 3300025922 | Ga0207646_10144225 | Ga0207646_101442252 | 248 |
| 168 | 3300025924 | Ga0207694_10028442 | Ga0207694_100284423 | 248 |
| 169 | 3300025925 | Ga0207650_10130806 | Ga0207650_101308063 | 248 |
| 170 | 3300025925 | Ga0207650_10237354 | Ga0207650_102373542 | 248 |
| 171 | 3300025926 | Ga0207659_10016524 | Ga0207659_100165244 | 248 |
| 172 | 3300025926 | Ga0207659_10033686 | Ga0207659_100336863 | 248 |
| 173 | 3300025927 | Ga0207687_10025557 | Ga0207687_100255572 | 248 |
| 174 | 3300025933 | Ga0207706_10068825 | Ga0207706_100688256 | 248 |
| 175 | 3300025933 | Ga0207706_10529905 | Ga0207706_105299051 | 248 |
| 176 | 3300025934 | Ga0207686_10127474 | Ga0207686_101274742 | 248 |
| 177 | 3300025935 | Ga0207709_10023381 | Ga0207709_100233814 | 248 |
| 178 | 3300025937 | Ga0207669_10005445 | Ga0207669_100054454 | 248 |
| 179 | 3300025937 | Ga0207669_10154204 | Ga0207669_101542042 | 248 |
| 180 | 3300025938 | Ga0207704_10007412 | Ga0207704_100074122 | 248 |
| 181 | 3300025940 | Ga0207691_10070971 | Ga0207691_100709712 | 248 |
| 182 | 3300025940 | Ga0207691_10236733 | Ga0207691_102367332 | 248 |
| 183 | 3300025941 | Ga0207711_10111170 | Ga0207711_101111702 | 248 |
| 184 | 3300025941 | Ga0207711_10133113 | Ga0207711_101331131 | 248 |
| 185 | 3300025949 | Ga0207667_10076643 | Ga0207667_100766432 | 248 |
| 186 | 3300025960 | Ga0207651_10077779 | Ga0207651_100777792 | 248 |
| 187 | 3300025961 | Ga0207712_10061429 | Ga0207712_100614292 | 248 |
| 188 | 3300025972 | Ga0207668_10207359 | Ga0207668_102073592 | 248 |
| 189 | 3300025981 | Ga0207640_10010279 | Ga0207640_100102792 | 248 |
| 190 | 3300025981 | Ga0207640_10074736 | Ga0207640_100747362 | 248 |
| 191 | 3300026023 | Ga0207677_10250165 | Ga0207677_102501652 | 248 |
| 192 | 3300026075 | Ga0207708_10234779 | Ga0207708_102347792 | 248 |
| 193 | 3300026088 | Ga0207641_10483715 | Ga0207641_104837152 | 248 |
| 194 | 3300026089 | Ga0207648_10040162 | Ga0207648_100401623 | 248 |
| 195 | 3300026089 | Ga0207648_10096952 | Ga0207648_100969522 | 248 |
| 196 | 3300026089 | Ga0207648_10140991 | Ga0207648_101409912 | 248 |
| 197 | 3300026118 | Ga0207675_100059063 | Ga0207675_1000590631 | 248 |
| 198 | 3300027907 | Ga0207428_10015437 | Ga0207428_100154376 | 248 |
| 199 | 3300027907 | Ga0207428_10157424 | Ga0207428_101574242 | 248 |
| 200 | 3300028379 | Ga0268266_10050461 | Ga0268266_100504613 | 248 |
| 201 | 3300028379 | Ga0268266_10158569 | Ga0268266_101585692 | 248 |
| 202 | 3300028380 | Ga0268265_10005659 | Ga0268265_100056596 | 248 |
| 203 | 3300030521 | Ga0307511_10168033 | Ga0307511_101680331 | 248 |
| 204 | 3300034819 | Ga0373958_0005121 | Ga0373958_0005121_990_1736 | 248 |
| 205 | 3300035084 | Ga0373928_0003886 | Ga0373928_0003886_83_829 | 248 |
| 206 | 3300035085 | Ga0373929_0000476 | Ga0373929_0000476_3227_3973 | 248 |
| 207 | 3300035088 | Ga0373940_0013537 | Ga0373940_0013537_240_986 | 248 |
| 208 | 3300035092 | Ga0373952_0002124 | Ga0373952_0002124_1764_2510 | 248 |
| 209 | 3300035112 | Ga0373932_0000869 | Ga0373932_0000869_197_943 | 248 |
| 210 | 3300035114 | Ga0373939_0002902 | Ga0373939_0002902_25_771 | 248 |
| 211 | 3300035115 | Ga0373941_0000162 | Ga0373941_0000162_8210_8956 | 248 |
| 212 | 3300035117 | Ga0373953_0035314 | Ga0373953_0035314_1087_1833 | 248 |
| 213 | 3300035241 | Ga0373961_0002875 | Ga0373961_0002875_2410_3156 | 248 |
| 214 | 3300035242 | Ga0373962_0001294 | Ga0373962_0001294_5069_5815 | 248 |
| 215 | 3300035691 | Ga0373931_0001425 | Ga0373931_0001425_2411_3157 | 248 |
| 216 | 3300038443 | Ga0395901_0736848 | Ga0395901_0736848_187_933 | 248 |
| 217 | 3300039437 | Ga0436365_0196462 | Ga0436365_0196462_393_1139 | 248 |
| 218 | 3300042131 | Ga0450894_001375 | Ga0450894_001375_1197_1958 | 248 |
| 219 | 3300042133 | Ga0450896_001990 | Ga0450896_001990_1734_2495 | 248 |
| 220 | 3300045051 | Ga0451576_0239178 | Ga0451576_0239178_586_1332 | 248 |
| 221 | 3300045051 | Ga0451576_0276138 | Ga0451576_0276138_328_1074 | 248 |
| 222 | 3300046533 | Ga0495640_0278053 | Ga0495640_0278053_177_923 | 248 |
| 223 | 3300046681 | Ga0495647_0190611 | Ga0495647_0190611_61_807 | 248 |
| 224 | 3300046689 | Ga0495613_0178398 | Ga0495613_0178398_372_1118 | 248 |
| 225 | 3300048907 | Ga0496104_0573568 | Ga0496104_0573568_128_874 | 248 |
| 226 | 3300048911 | Ga0496108_0225264 | Ga0496108_0225264_856_1602 | 248 |
| 227 | 3300048915 | Ga0496112_0109110 | Ga0496112_0109110_1899_2645 | 248 |
| 228 | 3300048917 | Ga0496114_0080527 | Ga0496114_0080527_1498_2244 | 248 |
| 229 | 3300049571 | Ga0501034_0154904 | Ga0501034_0154904_688_1515 | 248 |
| 230 | 3300049579 | Ga0501043_0055792 | Ga0501043_0055792_1932_2759 | 248 |
| 231 | 3300049581 | Ga0501047_0005040 | Ga0501047_0005040_774_1601 | 248 |
| 232 | 3300049583 | Ga0501067_0238662 | Ga0501067_0238662_71_817 | 248 |
| 233 | 3300049588 | Ga0501072_0299289 | Ga0501072_0299289_14_760 | 248 |
| 234 | 3300049591 | Ga0501075_0078051 | Ga0501075_0078051_206_952 | 248 |
| 235 | 3300049823 | Ga0501044_0010338 | Ga0501044_0010338_9159_9986 | 248 |
| 236 | 3300050511 | nmdc:mga08y16_106682_c1 | nmdc:mga08y16_106682_c1_1312_2058 | 248 |
| 237 | 3300050511 | nmdc:mga08y16_18380_c1 | nmdc:mga08y16_18380_c1_43_792 | 248 |
| 238 | 3300050512 | nmdc:mga0n895_50367_c1 | nmdc:mga0n895_50367_c1_1664_2410 | 248 |
| 239 | 3300050512 | nmdc:mga0n895_567_c1 | nmdc:mga0n895_567_c1_9922_10668 | 248 |
| 240 | 3300050513 | nmdc:mga0rr50_104537_c1 | nmdc:mga0rr50_104537_c1_33_779 | 248 |
| 241 | 3300050513 | nmdc:mga0rr50_114_c1 | nmdc:mga0rr50_114_c1_18844_19590 | 248 |
| 242 | 3300050513 | nmdc:mga0rr50_96164_c1 | nmdc:mga0rr50_96164_c1_1170_1916 | 248 |
| 243 | 3300050514 | nmdc:mga08x19_19790_c1 | nmdc:mga08x19_19790_c1_1401_2147 | 248 |
| 244 | 3300050514 | nmdc:mga08x19_339232_c1 | nmdc:mga08x19_339232_c1_50_796 | 248 |
| 245 | 3300050514 | nmdc:mga08x19_5290_c1 | nmdc:mga08x19_5290_c1_5329_6075 | 248 |
| 246 | 3300002459 | JGI24751J29686_10011144 | JGI24751J29686_100111441 | 249 |
| 247 | 3300005293 | Ga0065715_10098936 | Ga0065715_100989362 | 249 |
| 248 | 3300005334 | Ga0068869_100482244 | Ga0068869_1004822442 | 249 |
| 249 | 3300005335 | Ga0070666_10200820 | Ga0070666_102008202 | 249 |
| 250 | 3300005336 | Ga0070680_100189108 | Ga0070680_1001891082 | 249 |
| 251 | 3300005338 | Ga0068868_100036623 | Ga0068868_1000366234 | 249 |
| 252 | 3300005340 | Ga0070689_100142097 | Ga0070689_1001420972 | 249 |
| 253 | 3300005340 | Ga0070689_100246615 | Ga0070689_1002466152 | 249 |
| 254 | 3300005353 | Ga0070669_100158574 | Ga0070669_1001585742 | 249 |
| 255 | 3300005354 | Ga0070675_100807327 | Ga0070675_1008073271 | 249 |
| 256 | 3300005355 | Ga0070671_100104194 | Ga0070671_1001041942 | 249 |
| 257 | 3300005355 | Ga0070671_100263844 | Ga0070671_1002638442 | 249 |
| 258 | 3300005355 | Ga0070671_100519871 | Ga0070671_1005198712 | 249 |
| 259 | 3300005356 | Ga0070674_100429616 | Ga0070674_1004296162 | 249 |
| 260 | 3300005364 | Ga0070673_100138876 | Ga0070673_1001388762 | 249 |
| 261 | 3300005366 | Ga0070659_100153437 | Ga0070659_1001534372 | 249 |
| 262 | 3300005436 | Ga0070713_100138788 | Ga0070713_1001387882 | 249 |
| 263 | 3300005439 | Ga0070711_100449097 | Ga0070711_1004490972 | 249 |
| 264 | 3300005440 | Ga0070705_100111121 | Ga0070705_1001111212 | 249 |
| 265 | 3300005444 | Ga0070694_100013957 | Ga0070694_1000139575 | 249 |
| 266 | 3300005445 | Ga0070708_100101940 | Ga0070708_1001019402 | 249 |
| 267 | 3300005458 | Ga0070681_10004061 | Ga0070681_100040615 | 249 |
| 268 | 3300005458 | Ga0070681_10246622 | Ga0070681_102466222 | 249 |
| 269 | 3300005468 | Ga0070707_100208133 | Ga0070707_1002081332 | 249 |
| 270 | 3300005471 | Ga0070698_100114994 | Ga0070698_1001149942 | 249 |
| 271 | 3300005471 | Ga0070698_100575881 | Ga0070698_1005758812 | 249 |
| 272 | 3300005518 | Ga0070699_100297815 | Ga0070699_1002978152 | 249 |
| 273 | 3300005518 | Ga0070699_100306118 | Ga0070699_1003061182 | 249 |
| 274 | 3300005518 | Ga0070699_100507559 | Ga0070699_1005075592 | 249 |
| 275 | 3300005530 | Ga0070679_100032819 | Ga0070679_1000328193 | 249 |
| 276 | 3300005543 | Ga0070672_100174961 | Ga0070672_1001749612 | 249 |
| 277 | 3300005544 | Ga0070686_100025575 | Ga0070686_1000255754 | 249 |
| 278 | 3300005548 | Ga0070665_100007145 | Ga0070665_1000071454 | 249 |
| 279 | 3300005549 | Ga0070704_100036172 | Ga0070704_1000361721 | 249 |
| 280 | 3300005614 | Ga0068856_100104691 | Ga0068856_1001046912 | 249 |
| 281 | 3300005615 | Ga0070702_100287894 | Ga0070702_1002878941 | 249 |
| 282 | 3300005617 | Ga0068859_100042652 | Ga0068859_1000426524 | 249 |
| 283 | 3300005617 | Ga0068859_100124386 | Ga0068859_1001243863 | 249 |
| 284 | 3300005618 | Ga0068864_100022967 | Ga0068864_1000229674 | 249 |
| 285 | 3300005618 | Ga0068864_100093617 | Ga0068864_1000936173 | 249 |
| 286 | 3300005618 | Ga0068864_100268653 | Ga0068864_1002686532 | 249 |
| 287 | 3300005718 | Ga0068866_10309947 | Ga0068866_103099471 | 249 |
| 288 | 3300005834 | Ga0068851_10127531 | Ga0068851_101275311 | 249 |
| 289 | 3300005841 | Ga0068863_100256964 | Ga0068863_1002569642 | 249 |
| 290 | 3300005842 | Ga0068858_100000761 | Ga0068858_1000007615 | 249 |
| 291 | 3300005842 | Ga0068858_100012172 | Ga0068858_1000121722 | 249 |
| 292 | 3300005842 | Ga0068858_100093738 | Ga0068858_1000937384 | 249 |
| 293 | 3300005844 | Ga0068862_100011518 | Ga0068862_1000115182 | 249 |
| 294 | 3300005844 | Ga0068862_100559551 | Ga0068862_1005595512 | 249 |
| 295 | 3300006237 | Ga0097621_100019394 | Ga0097621_1000193946 | 249 |
| 296 | 3300006237 | Ga0097621_100329518 | Ga0097621_1003295182 | 249 |
| 297 | 3300006358 | Ga0068871_100002863 | Ga0068871_1000028635 | 249 |
| 298 | 3300006358 | Ga0068871_100014197 | Ga0068871_1000141972 | 249 |
| 299 | 3300006358 | Ga0068871_100050250 | Ga0068871_1000502502 | 249 |
| 300 | 3300006844 | Ga0075428_100023790 | Ga0075428_1000237902 | 249 |
| 301 | 3300006852 | Ga0075433_10083754 | Ga0075433_100837543 | 249 |
| 302 | 3300006871 | Ga0075434_100032315 | Ga0075434_1000323153 | 249 |
| 303 | 3300006881 | Ga0068865_100009647 | Ga0068865_1000096473 | 249 |
| 304 | 3300006914 | Ga0075436_100014961 | Ga0075436_1000149612 | 249 |
| 305 | 3300006914 | Ga0075436_100058897 | Ga0075436_1000588972 | 249 |
| 306 | 3300006931 | Ga0097620_100042652 | Ga0097620_1000426522 | 249 |
| 307 | 3300006931 | Ga0097620_100124390 | Ga0097620_1001243903 | 249 |
| 308 | 3300007076 | Ga0075435_100003390 | Ga0075435_1000033904 | 249 |
| 309 | 3300007076 | Ga0075435_100007416 | Ga0075435_1000074165 | 249 |
| 310 | 3300007076 | Ga0075435_100255007 | Ga0075435_1002550072 | 249 |
| 311 | 3300007076 | Ga0075435_100377511 | Ga0075435_1003775112 | 249 |
| 312 | 3300009093 | Ga0105240_10060998 | Ga0105240_100609982 | 249 |
| 313 | 3300009093 | Ga0105240_10298819 | Ga0105240_102988192 | 249 |
| 314 | 3300009094 | Ga0111539_10478565 | Ga0111539_104785652 | 249 |
| 315 | 3300009094 | Ga0111539_11057715 | Ga0111539_110577152 | 249 |
| 316 | 3300009098 | Ga0105245_10251108 | Ga0105245_102511082 | 249 |
| 317 | 3300009098 | Ga0105245_10269686 | Ga0105245_102696862 | 249 |
| 318 | 3300009098 | Ga0105245_10337853 | Ga0105245_103378532 | 249 |
| 319 | 3300009098 | Ga0105245_10375620 | Ga0105245_103756201 | 249 |
| 320 | 3300009098 | Ga0105245_10901617 | Ga0105245_109016171 | 249 |
| 321 | 3300009101 | Ga0105247_10033321 | Ga0105247_100333212 | 249 |
| 322 | 3300009147 | Ga0114129_10017539 | Ga0114129_100175392 | 249 |
| 323 | 3300009147 | Ga0114129_10018144 | Ga0114129_100181447 | 249 |
| 324 | 3300009147 | Ga0114129_10021621 | Ga0114129_100216216 | 249 |
| 325 | 3300009147 | Ga0114129_10080039 | Ga0114129_100800394 | 249 |
| 326 | 3300009147 | Ga0114129_10120934 | Ga0114129_101209342 | 249 |
| 327 | 3300009147 | Ga0114129_10380370 | Ga0114129_103803702 | 249 |
| 328 | 3300009147 | Ga0114129_10521936 | Ga0114129_105219362 | 249 |
| 329 | 3300009147 | Ga0114129_11184628 | Ga0114129_111846282 | 249 |
| 330 | 3300009176 | Ga0105242_10016938 | Ga0105242_100169386 | 249 |
| 331 | 3300009176 | Ga0105242_10056184 | Ga0105242_100561844 | 249 |
| 332 | 3300009176 | Ga0105242_10278006 | Ga0105242_102780062 | 249 |
| 333 | 3300009177 | Ga0105248_10010609 | Ga0105248_100106092 | 249 |
| 334 | 3300009177 | Ga0105248_10086656 | Ga0105248_100866562 | 249 |
| 335 | 3300009177 | Ga0105248_10144074 | Ga0105248_101440742 | 249 |
| 336 | 3300009177 | Ga0105248_10471220 | Ga0105248_104712201 | 249 |
| 337 | 3300009553 | Ga0105249_10480091 | Ga0105249_104800912 | 249 |
| 338 | 3300009553 | Ga0105249_10620165 | Ga0105249_106201652 | 249 |
| 339 | 3300013296 | Ga0157374_10174597 | Ga0157374_101745972 | 249 |
| 340 | 3300013306 | Ga0163162_10054054 | Ga0163162_100540543 | 249 |
| 341 | 3300013306 | Ga0163162_10995752 | Ga0163162_109957521 | 249 |
| 342 | 3300013308 | Ga0157375_10238222 | Ga0157375_102382222 | 249 |
| 343 | 3300013308 | Ga0157375_11129845 | Ga0157375_111298452 | 249 |
| 344 | 3300014325 | Ga0163163_10075540 | Ga0163163_100755403 | 249 |
| 345 | 3300014325 | Ga0163163_10160984 | Ga0163163_101609843 | 249 |
| 346 | 3300014325 | Ga0163163_10483625 | Ga0163163_104836251 | 249 |
| 347 | 3300014325 | Ga0163163_10661061 | Ga0163163_106610612 | 249 |
| 348 | 3300014326 | Ga0157380_10283421 | Ga0157380_102834212 | 249 |
| 349 | 3300014968 | Ga0157379_10054969 | Ga0157379_100549692 | 249 |
| 350 | 3300014968 | Ga0157379_10177399 | Ga0157379_101773992 | 249 |
| 351 | 3300014968 | Ga0157379_10307349 | Ga0157379_103073492 | 249 |
| 352 | 3300014968 | Ga0157379_10317828 | Ga0157379_103178282 | 249 |
| 353 | 3300014969 | Ga0157376_10039331 | Ga0157376_100393313 | 249 |
| 354 | 3300014969 | Ga0157376_10219183 | Ga0157376_102191831 | 249 |
| 355 | 3300014969 | Ga0157376_10473175 | Ga0157376_104731752 | 249 |
| 356 | 3300025899 | Ga0207642_10101813 | Ga0207642_101018131 | 249 |
| 357 | 3300025900 | Ga0207710_10005045 | Ga0207710_100050452 | 249 |
| 358 | 3300025903 | Ga0207680_10104903 | Ga0207680_101049032 | 249 |
| 359 | 3300025905 | Ga0207685_10064368 | Ga0207685_100643682 | 249 |
| 360 | 3300025906 | Ga0207699_10026006 | Ga0207699_100260063 | 249 |
| 361 | 3300025912 | Ga0207707_10009702 | Ga0207707_100097021 | 249 |
| 362 | 3300025912 | Ga0207707_10453123 | Ga0207707_104531232 | 249 |
| 363 | 3300025913 | Ga0207695_10124830 | Ga0207695_101248302 | 249 |
| 364 | 3300025917 | Ga0207660_10393425 | Ga0207660_103934252 | 249 |
| 365 | 3300025918 | Ga0207662_10453221 | Ga0207662_104532211 | 249 |
| 366 | 3300025919 | Ga0207657_10409609 | Ga0207657_104096091 | 249 |
| 367 | 3300025921 | Ga0207652_10044785 | Ga0207652_100447852 | 249 |
| 368 | 3300025922 | Ga0207646_10212269 | Ga0207646_102122692 | 249 |
| 369 | 3300025923 | Ga0207681_10072387 | Ga0207681_100723872 | 249 |
| 370 | 3300025927 | Ga0207687_10582484 | Ga0207687_105824841 | 249 |
| 371 | 3300025928 | Ga0207700_10058086 | Ga0207700_100580864 | 249 |
| 372 | 3300025931 | Ga0207644_10039686 | Ga0207644_100396862 | 249 |
| 373 | 3300025933 | Ga0207706_10236414 | Ga0207706_102364142 | 249 |
| 374 | 3300025934 | Ga0207686_10050874 | Ga0207686_100508741 | 249 |
| 375 | 3300025934 | Ga0207686_10079226 | Ga0207686_100792262 | 249 |
| 376 | 3300025934 | Ga0207686_10282682 | Ga0207686_102826822 | 249 |
| 377 | 3300025934 | Ga0207686_10411303 | Ga0207686_104113031 | 249 |
| 378 | 3300025936 | Ga0207670_10036808 | Ga0207670_100368082 | 249 |
| 379 | 3300025936 | Ga0207670_10130715 | Ga0207670_101307152 | 249 |
| 380 | 3300025936 | Ga0207670_10524035 | Ga0207670_105240352 | 249 |
| 381 | 3300025938 | Ga0207704_10354821 | Ga0207704_103548211 | 249 |
| 382 | 3300025940 | Ga0207691_10225017 | Ga0207691_102250172 | 249 |
| 383 | 3300025941 | Ga0207711_10017096 | Ga0207711_100170966 | 249 |
| 384 | 3300025941 | Ga0207711_10030248 | Ga0207711_100302484 | 249 |
| 385 | 3300025941 | Ga0207711_10314522 | Ga0207711_103145222 | 249 |
| 386 | 3300025942 | Ga0207689_10201565 | Ga0207689_102015651 | 249 |
| 387 | 3300025942 | Ga0207689_10427135 | Ga0207689_104271352 | 249 |
| 388 | 3300025944 | Ga0207661_10101252 | Ga0207661_101012521 | 249 |
| 389 | 3300025960 | Ga0207651_10067185 | Ga0207651_100671852 | 249 |
| 390 | 3300025986 | Ga0207658_10018525 | Ga0207658_100185252 | 249 |
| 391 | 3300025986 | Ga0207658_10585320 | Ga0207658_105853202 | 249 |
| 392 | 3300026023 | Ga0207677_10093111 | Ga0207677_100931112 | 249 |
| 393 | 3300026023 | Ga0207677_10460145 | Ga0207677_104601452 | 249 |
| 394 | 3300026035 | Ga0207703_10019414 | Ga0207703_100194142 | 249 |
| 395 | 3300026035 | Ga0207703_10065396 | Ga0207703_100653962 | 249 |
| 396 | 3300026035 | Ga0207703_10141179 | Ga0207703_101411792 | 249 |
| 397 | 3300026035 | Ga0207703_10539900 | Ga0207703_105399001 | 249 |
| 398 | 3300026078 | Ga0207702_10111114 | Ga0207702_101111143 | 249 |
| 399 | 3300026088 | Ga0207641_10035902 | Ga0207641_100359023 | 249 |
| 400 | 3300026089 | Ga0207648_10050763 | Ga0207648_100507634 | 249 |
| 401 | 3300026095 | Ga0207676_10012077 | Ga0207676_100120775 | 249 |
| 402 | 3300026095 | Ga0207676_10072541 | Ga0207676_100725412 | 249 |
| 403 | 3300026095 | Ga0207676_10093749 | Ga0207676_100937492 | 249 |
| 404 | 3300026118 | Ga0207675_100366124 | Ga0207675_1003661242 | 249 |
| 405 | 3300027665 | Ga0209983_1060144 | Ga0209983_10601441 | 249 |
| 406 | 3300027907 | Ga0207428_10221108 | Ga0207428_102211082 | 249 |
| 407 | 3300027907 | Ga0207428_10384762 | Ga0207428_103847622 | 249 |
| 408 | 3300028379 | Ga0268266_10014138 | Ga0268266_100141384 | 249 |
| 409 | 3300028380 | Ga0268265_10008952 | Ga0268265_100089522 | 249 |
| 410 | 3300028380 | Ga0268265_10379527 | Ga0268265_103795272 | 249 |
| 411 | 3300028381 | Ga0268264_10110219 | Ga0268264_101102192 | 249 |
| 412 | 3300031344 | Ga0265316_10255161 | Ga0265316_102551612 | 249 |
| 413 | 3300031548 | Ga0307408_100132347 | Ga0307408_1001323472 | 249 |
| 414 | 3300031731 | Ga0307405_10044578 | Ga0307405_100445781 | 249 |
| 415 | 3300031824 | Ga0307413_10029767 | Ga0307413_100297672 | 249 |
| 416 | 3300031852 | Ga0307410_10720221 | Ga0307410_107202211 | 249 |
| 417 | 3300031903 | Ga0307407_10029802 | Ga0307407_100298022 | 249 |
| 418 | 3300031911 | Ga0307412_10026630 | Ga0307412_100266303 | 249 |
| 419 | 3300032002 | Ga0307416_100053163 | Ga0307416_1000531632 | 249 |
| 420 | 3300032004 | Ga0307414_10028922 | Ga0307414_100289223 | 249 |
| 421 | 3300032004 | Ga0307414_10233615 | Ga0307414_102336152 | 249 |
| 422 | 3300032005 | Ga0307411_10008920 | Ga0307411_100089203 | 249 |
| 423 | 3300032126 | Ga0307415_100258967 | Ga0307415_1002589672 | 249 |
| 424 | 3300034819 | Ga0373958_0064206 | Ga0373958_0064206_10_762 | 249 |
| 425 | 3300035083 | Ga0373926_0108247 | Ga0373926_0108247_135_884 | 249 |
| 426 | 3300035086 | Ga0373934_0025094 | Ga0373934_0025094_1474_2223 | 249 |
| 427 | 3300035111 | Ga0373923_0065476 | Ga0373923_0065476_475_1224 | 249 |
| 428 | 3300035170 | Ga0373943_0014498 | Ga0373943_0014498_1956_2705 | 249 |
| 429 | 3300035170 | Ga0373943_0071261 | Ga0373943_0071261_88_837 | 249 |
| 430 | 3300035170 | Ga0373943_0141145 | Ga0373943_0141145_434_1183 | 249 |
| 431 | 3300035171 | Ga0373946_0134067 | Ga0373946_0134067_101_850 | 249 |
| 432 | 3300035172 | Ga0373955_0011602 | Ga0373955_0011602_681_1430 | 249 |
| 433 | 3300035410 | Ga0373924_0027127 | Ga0373924_0027127_670_1419 | 249 |
| 434 | 3300035410 | Ga0373924_0066840 | Ga0373924_0066840_400_1149 | 249 |
| 435 | 3300035691 | Ga0373931_0385259 | Ga0373931_0385259_36_785 | 249 |
| 436 | 3300035692 | Ga0373935_0094398 | Ga0373935_0094398_753_1502 | 249 |
| 437 | 3300035724 | Ga0373933_0131920 | Ga0373933_0131920_330_1079 | 249 |
| 438 | 3300035724 | Ga0373933_0158390 | Ga0373933_0158390_80_829 | 249 |
| 439 | 3300036401 | Ga0373937_0111499 | Ga0373937_0111499_632_1381 | 249 |
| 440 | 3300036401 | Ga0373937_0201095 | Ga0373937_0201095_437_1189 | 249 |
| 441 | 3300036401 | Ga0373937_0212161 | Ga0373937_0212161_269_1018 | 249 |
| 442 | 3300036401 | Ga0373937_0547980 | Ga0373937_0547980_309_1058 | 249 |
| 443 | 3300037068 | Ga0373925_0036446 | Ga0373925_0036446_776_1525 | 249 |
| 444 | 3300037068 | Ga0373925_0125144 | Ga0373925_0125144_693_1442 | 249 |
| 445 | 3300037068 | Ga0373925_0255474 | Ga0373925_0255474_355_1104 | 249 |
| 446 | 3300039437 | Ga0436365_1477503 | Ga0436365_1477503_587_1336 | 249 |
| 447 | 3300042001 | Ga0439441_053999 | Ga0439441_053999_71_820 | 249 |
| 448 | 3300042436 | Ga0439435_0032138 | Ga0439435_0032138_98_847 | 249 |
| 449 | 3300042876 | Ga0451577_0175182 | Ga0451577_0175182_976_1737 | 249 |
| 450 | 3300044712 | Ga0453684_0041993 | Ga0453684_0041993_2442_3203 | 249 |
| 451 | 3300046454 | Ga0495592_0046686 | Ga0495592_0046686_485_1234 | 249 |
| 452 | 3300046459 | Ga0495629_0549387 | Ga0495629_0549387_10_759 | 249 |
| 453 | 3300046473 | Ga0495582_0078830 | Ga0495582_0078830_1029_1778 | 249 |
| 454 | 3300046511 | Ga0495608_0077000 | Ga0495608_0077000_351_1100 | 249 |
| 455 | 3300046514 | Ga0495618_0262316 | Ga0495618_0262316_85_834 | 249 |
| 456 | 3300046516 | Ga0495628_0189513 | Ga0495628_0189513_480_1229 | 249 |
| 457 | 3300046517 | Ga0495630_0065438 | Ga0495630_0065438_1922_2671 | 249 |
| 458 | 3300046529 | Ga0495652_0235221 | Ga0495652_0235221_17_766 | 249 |
| 459 | 3300046533 | Ga0495640_0061808 | Ga0495640_0061808_939_1688 | 249 |
| 460 | 3300046536 | Ga0495587_0198759 | Ga0495587_0198759_222_971 | 249 |
| 461 | 3300046539 | Ga0495621_0022242 | Ga0495621_0022242_589_1338 | 249 |
| 462 | 3300046543 | Ga0495645_0004545 | Ga0495645_0004545_563_1312 | 249 |
| 463 | 3300046543 | Ga0495645_0093654 | Ga0495645_0093654_681_1430 | 249 |
| 464 | 3300046559 | Ga0495667_0092973 | Ga0495667_0092973_1162_1911 | 249 |
| 465 | 3300046642 | Ga0495634_0051230 | Ga0495634_0051230_1448_2200 | 249 |
| 466 | 3300046681 | Ga0495647_0071361 | Ga0495647_0071361_441_1190 | 249 |
| 467 | 3300046681 | Ga0495647_0132184 | Ga0495647_0132184_297_1046 | 249 |
| 468 | 3300046681 | Ga0495647_0175361 | Ga0495647_0175361_127_876 | 249 |
| 469 | 3300046683 | Ga0495658_0019658 | Ga0495658_0019658_2025_2774 | 249 |
| 470 | 3300046684 | Ga0495669_0004751 | Ga0495669_0004751_2623_3372 | 249 |
| 471 | 3300046689 | Ga0495613_0003530 | Ga0495613_0003530_3455_4204 | 249 |
| 472 | 3300046809 | Ga0495600_0178298 | Ga0495600_0178298_398_1147 | 249 |
| 473 | 3300047317 | Ga0495604_0035813 | Ga0495604_0035813_2179_2928 | 249 |
| 474 | 3300047319 | Ga0495674_0004626 | Ga0495674_0004626_11498_12247 | 249 |
| 475 | 3300047319 | Ga0495674_0049820 | Ga0495674_0049820_1734_2483 | 249 |
| 476 | 3300047319 | Ga0495674_0322592 | Ga0495674_0322592_260_1009 | 249 |
| 477 | 3300047322 | Ga0495680_0106070 | Ga0495680_0106070_77_826 | 249 |
| 478 | 3300047444 | Ga0495675_0179514 | Ga0495675_0179514_362_1111 | 249 |
| 479 | 3300047471 | Ga0495684_0000682 | Ga0495684_0000682_8514_9263 | 249 |
| 480 | 3300048903 | Ga0496100_0005884 | Ga0496100_0005884_1060_1809 | 249 |
| 481 | 3300048904 | Ga0496101_0000222 | Ga0496101_0000222_9404_10153 | 249 |
| 482 | 3300048904 | Ga0496101_0115492 | Ga0496101_0115492_488_1240 | 249 |
| 483 | 3300048907 | Ga0496104_0001478 | Ga0496104_0001478_8687_9436 | 249 |
| 484 | 3300048907 | Ga0496104_0012796 | Ga0496104_0012796_1297_2046 | 249 |
| 485 | 3300048907 | Ga0496104_0023018 | Ga0496104_0023018_2774_3523 | 249 |
| 486 | 3300048907 | Ga0496104_0264515 | Ga0496104_0264515_19_768 | 249 |
| 487 | 3300048907 | Ga0496104_0363191 | Ga0496104_0363191_571_1320 | 249 |
| 488 | 3300048908 | Ga0496105_0189990 | Ga0496105_0189990_343_1092 | 249 |
| 489 | 3300048908 | Ga0496105_0291401 | Ga0496105_0291401_148_897 | 249 |
| 490 | 3300048910 | Ga0496107_0011835 | Ga0496107_0011835_209_958 | 249 |
| 491 | 3300048913 | Ga0496110_0061241 | Ga0496110_0061241_412_1161 | 249 |
| 492 | 3300048913 | Ga0496110_0817344 | Ga0496110_0817344_28_777 | 249 |
| 493 | 3300048915 | Ga0496112_0014577 | Ga0496112_0014577_5352_6101 | 249 |
| 494 | 3300048915 | Ga0496112_0090825 | Ga0496112_0090825_27_776 | 249 |
| 495 | 3300048915 | Ga0496112_0159093 | Ga0496112_0159093_1405_2154 | 249 |
| 496 | 3300048915 | Ga0496112_0414445 | Ga0496112_0414445_444_1193 | 249 |
| 497 | 3300048916 | Ga0496113_0058705 | Ga0496113_0058705_1163_1912 | 249 |
| 498 | 3300048917 | Ga0496114_0000416 | Ga0496114_0000416_16769_17518 | 249 |
| 499 | 3300048917 | Ga0496114_0289401 | Ga0496114_0289401_92_841 | 249 |
| 500 | 3300048918 | Ga0496115_0343797 | Ga0496115_0343797_417_1166 | 249 |
| 501 | 3300048918 | Ga0496115_0422201 | Ga0496115_0422201_80_829 | 249 |
| 502 | 3300049571 | Ga0501034_0029753 | Ga0501034_0029753_1743_2492 | 249 |
| 503 | 3300049585 | Ga0501069_0250502 | Ga0501069_0250502_57_806 | 249 |
| 504 | 3300049589 | Ga0501073_0140011 | Ga0501073_0140011_684_1439 | 249 |
| 505 | 3300050507 | nmdc:mga05p37_173687_c1 | nmdc:mga05p37_173687_c1_1096_1845 | 249 |
| 506 | 3300050507 | nmdc:mga05p37_180383_c1 | nmdc:mga05p37_180383_c1_1346_2098 | 249 |
| 507 | 3300050507 | nmdc:mga05p37_37393_c1 | nmdc:mga05p37_37393_c1_4969_5718 | 249 |
| 508 | 3300050507 | nmdc:mga05p37_3900_c2 | nmdc:mga05p37_3900_c2_1192_1941 | 249 |
| 509 | 3300050507 | nmdc:mga05p37_56606_c2 | nmdc:mga05p37_56606_c2_851_1600 | 249 |
| 510 | 3300050511 | nmdc:mga08y16_506548_c1 | nmdc:mga08y16_506548_c1_138_887 | 249 |
| 511 | 3300050511 | nmdc:mga08y16_92293_c1 | nmdc:mga08y16_92293_c1_1755_2507 | 249 |
| 512 | 3300050512 | nmdc:mga0n895_129287_c1 | nmdc:mga0n895_129287_c1_1652_2401 | 249 |
| 513 | 3300050512 | nmdc:mga0n895_160033_c1 | nmdc:mga0n895_160033_c1_744_1493 | 249 |
| 514 | 3300050512 | nmdc:mga0n895_16738_c1 | nmdc:mga0n895_16738_c1_3978_4730 | 249 |
| 515 | 3300050512 | nmdc:mga0n895_202086_c1 | nmdc:mga0n895_202086_c1_1206_1955 | 249 |
| 516 | 3300050513 | nmdc:mga0rr50_203514_c1 | nmdc:mga0rr50_203514_c1_448_1197 | 249 |
| 517 | 3300050513 | nmdc:mga0rr50_228976_c1 | nmdc:mga0rr50_228976_c1_361_1113 | 249 |
| 518 | 3300050513 | nmdc:mga0rr50_4071_c1 | nmdc:mga0rr50_4071_c1_5470_6219 | 249 |
| 519 | 3300050514 | nmdc:mga08x19_16651_c1 | nmdc:mga08x19_16651_c1_968_1717 | 249 |
| 520 | 3300050515 | nmdc:mga0a205_292633_c1 | nmdc:mga0a205_292633_c1_294_1043 | 249 |
| 521 | 3300050515 | nmdc:mga0a205_611882_c1 | nmdc:mga0a205_611882_c1_47_796 | 249 |
| 522 | 3300050515 | nmdc:mga0a205_79619_c1 | nmdc:mga0a205_79619_c1_880_1629 | 249 |
| 523 | 3300053077 | Ga0495601_0003363 | Ga0495601_0003363_2367_3116 | 249 |
| 524 | 3300053078 | Ga0495612_0081922 | Ga0495612_0081922_29_778 | 249 |
| 525 | 3300053084 | Ga0495595_0063838 | Ga0495595_0063838_162_911 | 249 |
| 526 | 3300053085 | Ga0495619_0001979 | Ga0495619_0001979_6220_6969 | 249 |
| 527 | 3300059421 | Ga0590071_001549 | Ga0590071_001549_4009_4767 | 249 |
| 528 | 3300059423 | Ga0590074_007650 | Ga0590074_007650_673_1431 | 249 |
| 529 | 3300059424 | Ga0590075_000822 | Ga0590075_000822_6235_6993 | 249 |
| 530 | 3300059424 | Ga0590075_060135 | Ga0590075_060135_28_786 | 249 |
| 531 | 3300059426 | Ga0590077_001087 | Ga0590077_001087_3263_4021 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kf6-assembly1.cif.gz_B | e. coli quinol-fumarate reductase with bound inhibitor hqno | 0.6182 | 1 | 246 |
| 1kf6-assembly1.cif.gz_B | e. coli quinol-fumarate reductase with bound inhibitor hqno | 0.5921 | 1 | 246 |
| 2bs3-assembly1.cif.gz_B | glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes | 0.5905 | 1 | 239 |
| 2acz-assembly1.cif.gz_B | complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site | 0.5795 | 1 | 243 |
| 2bs3-assembly1.cif.gz_B | glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes | 0.5744 | 1 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2wu2F02 | Mainly Alpha;Orthogonal Bundle;Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2;Alpha-helical ferredoxin | 0.5593 | 121 | 247 | 1.10.1060.10 |
| 2wu2F02 | Mainly Alpha;Orthogonal Bundle;Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2;Alpha-helical ferredoxin | 0.5403 | 121 | 247 | 1.10.1060.10 |
| af_Q9NA80_129_263_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.5159 | 2 | 110 | 3.10.20.90 |
| af_A0A0N7KNQ5_188_268_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.4944 | 1 | 98 | 3.10.20.90 |
| af_A0A0N7KNQ5_188_268_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.468 | 1 | 98 | 3.10.20.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849G0P9-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.952 | 1 | 96 |
GO:0009055
GO:0009060 GO:0022904 GO:0051537 |
| AF-A0A3M2HB32-F1-model_v4 | Succinate dehydrogenase/fumarate reductase iron-sulfur subunit | 0.9488 | 2 | 104 |
GO:0009055
GO:0051537 |
| AF-A0A2D9ZQM6-F1-model_v4 | deleted | 0.9465 | 1 | 98 |
|
| AF-A0A7X8VMZ1-F1-model_v4 | Succinate dehydrogenase/fumarate reductase iron-sulfur subunit | 0.9433 | 1 | 103 |
GO:0009055
GO:0051537 |
| AF-A0A847GCC4-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.942 | 1 | 92 |
GO:0009055
GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar