F460264

General Info

Members Datasets Scaffolds Average Seq Length
532 305 1064 186

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10498601|Ga0105249_104986012
Length 212
Sequence MSNSSVVVRLDHETWRSQMRKVHVFDNVSLDGYFTDAKNDMSWAHRQDEEWNAFAGGNASGDGELLFGRVTYEMMAAFWPTPQAAAMLPQVAAGMNRMRKSVFSRTLDSVSWQNTTLVKGDLVAEVEKMKRRPGPDLVIIGSGSIVSQLTEAGLIDEYQIVVNPLVLGKGRTLFETVQRKVGLTLTKTRAFKNGNVVLWYERASPRRGVDDA

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
198 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
199 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
269 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
270 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
271 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
272 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
273 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
274 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
275 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
276 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
277 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
278 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
284 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
285 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
289 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
290 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
304 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.45
Nodule 0
Rhizoplane 1.32
Rhizosphere 90.23
Stem 0
Stem Tuber 0
Unclassified 17.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10498601 3300009553 Bacteria 1262
2 SwRhRL3b_contig_3264281 2162886006 Bacteria 1661
3 SwRhRL2b_contig_3588356 2162886007 Bacteria 998
4 MBSR1b_contig_4902641 2162886012 Bacteria 1190
5 MBSR1b_contig_5893965 2162886012 Bacteria 1162
6 JGI24735J21928_10023417 3300002067 Unclassified 1873
7 rootH1_10151850 3300003323 Bacteria 6623
8 rootH1_10154437 3300003323 Bacteria 2551
9 Ga0065712_10153151 3300005290 Unclassified 1354
10 Ga0065715_10032149 3300005293 Bacteria 1716
11 Ga0065715_10382309 3300005293 Bacteria 905
12 Ga0065707_10092599 3300005295 Unclassified 3746
13 Ga0065707_10121915 3300005295 Bacteria 2089
14 Ga0065707_10305419 3300005295 Bacteria 995
15 Ga0070658_10003308 3300005327 Bacteria 13297
16 Ga0070658_10348609 3300005327 Bacteria 1267
17 Ga0070683_100001155 3300005329 Bacteria 19993
18 Ga0070683_100150815 3300005329 Unclassified 2204
19 Ga0070683_100964488 3300005329 Bacteria 818
20 Ga0070690_100360374 3300005330 Bacteria 1058
21 Ga0070670_100304818 3300005331 Bacteria 1394
22 Ga0068869_100316898 3300005334 Unclassified 1264
23 Ga0070666_10077245 3300005335 Bacteria 2273
24 Ga0070680_100025304 3300005336 Unclassified 4743
25 Ga0070682_100013753 3300005337 Unclassified 4665
26 Ga0068868_100902566 3300005338 Unclassified 803
27 Ga0070660_100112134 3300005339 Bacteria 2171
28 Ga0070689_100043820 3300005340 Bacteria 3441
29 Ga0070661_100539050 3300005344 Bacteria 938
30 Ga0070661_100610960 3300005344 Unclassified 882
31 Ga0070661_100819941 3300005344 Bacteria 764
32 Ga0070675_100296169 3300005354 Bacteria 1424
33 Ga0070671_100229860 3300005355 Bacteria 1574
34 Ga0070671_100313761 3300005355 Bacteria 1336
35 Ga0070673_100004663 3300005364 Bacteria 8702
36 Ga0070673_100441432 3300005364 Bacteria 1169
37 Ga0070688_100008261 3300005365 Bacteria 5643
38 Ga0070688_100420456 3300005365 Bacteria 993
39 Ga0070667_100126902 3300005367 Bacteria 2224
40 Ga0070667_100391371 3300005367 Bacteria 1264
41 Ga0070709_10004567 3300005434 Bacteria 7476
42 Ga0070714_100004779 3300005435 Bacteria 10264
43 Ga0070714_100578636 3300005435 Bacteria 1077
44 Ga0070713_100000888 3300005436 Bacteria 19171
45 Ga0070701_10287637 3300005438 Bacteria 1006
46 Ga0070701_10320998 3300005438 Unclassified 958
47 Ga0070711_100000613 3300005439 Bacteria 18618
48 Ga0070711_100103827 3300005439 Bacteria 2072
49 Ga0070705_100030803 3300005440 Bacteria 2965
50 Ga0070705_100033531 3300005440 Bacteria 2863
51 Ga0070705_101234541 3300005440 Unclassified 617
52 Ga0070700_100000215 3300005441 Bacteria 32331
53 Ga0070694_100244512 3300005444 Bacteria 1355
54 Ga0070708_100014475 3300005445 Bacteria 6491
55 Ga0070708_100017244 3300005445 Bacteria 6016
56 Ga0070708_100060060 3300005445 Bacteria 3392
57 Ga0070708_100528251 3300005445 Unclassified 1113
58 Ga0070708_100704760 3300005445 Bacteria 950
59 Ga0070708_100876691 3300005445 Unclassified 843
60 Ga0070681_10312779 3300005458 Bacteria 1480
61 Ga0070685_10006672 3300005466 Bacteria 5893
62 Ga0070706_100001047 3300005467 Bacteria 30011
63 Ga0070706_100140078 3300005467 Unclassified 2258
64 Ga0070706_100401463 3300005467 Bacteria 1276
65 Ga0070707_100006636 3300005468 Bacteria 10730
66 Ga0070707_100375095 3300005468 Bacteria 1382
67 Ga0070698_100000010 3300005471 Bacteria 117353
68 Ga0070698_100000531 3300005471 Bacteria 40650
69 Ga0070698_100021945 3300005471 Bacteria 6684
70 Ga0070698_100035737 3300005471 Bacteria 5135
71 Ga0070698_100251670 3300005471 Bacteria 1699
72 Ga0070698_100283485 3300005471 Unclassified 1588
73 Ga0070698_100643720 3300005471 Bacteria 1001
74 Ga0070699_100003720 3300005518 Bacteria 13482
75 Ga0070699_100004158 3300005518 Bacteria 12792
76 Ga0070699_100074587 3300005518 Bacteria 2952
77 Ga0070699_100093275 3300005518 Bacteria 2634
78 Ga0070699_100460663 3300005518 Bacteria 1153
79 Ga0070699_100510744 3300005518 Bacteria 1092
80 Ga0070679_100037531 3300005530 Bacteria 4814
81 Ga0070679_100053696 3300005530 Unclassified 4011
82 Ga0070679_100204752 3300005530 Bacteria 1938
83 Ga0070679_100226404 3300005530 Bacteria 1830
84 Ga0070684_100226566 3300005535 Bacteria 1706
85 Ga0070684_100402541 3300005535 Unclassified 1262
86 Ga0070684_101235926 3300005535 Bacteria 703
87 Ga0070697_101067065 3300005536 Unclassified 719
88 Ga0068853_100068238 3300005539 Bacteria 3091
89 Ga0068853_100553694 3300005539 Bacteria 1090
90 Ga0070672_100226053 3300005543 Bacteria 1571
91 Ga0070672_100783595 3300005543 Unclassified 838
92 Ga0070686_100056717 3300005544 Bacteria 2513
93 Ga0070695_100285552 3300005545 Unclassified 1214
94 Ga0070696_100013343 3300005546 Bacteria 5513
95 Ga0070696_100740788 3300005546 Unclassified 804
96 Ga0070693_100183325 3300005547 Bacteria 1349
97 Ga0070693_100183382 3300005547 Bacteria 1349
98 Ga0070693_100300506 3300005547 Bacteria 1082
99 Ga0070665_100021880 3300005548 Bacteria 6431
100 Ga0070665_100047801 3300005548 Bacteria 4294
101 Ga0070665_100100503 3300005548 Bacteria 2896
102 Ga0070665_100312664 3300005548 Bacteria 1575
103 Ga0070665_100839814 3300005548 Bacteria 932
104 Ga0070704_100000386 3300005549 Bacteria 20145
105 Ga0070704_100056073 3300005549 Bacteria 2797
106 Ga0070704_100743122 3300005549 Bacteria 873
107 Ga0070704_101314828 3300005549 Unclassified 662
108 Ga0068855_100134458 3300005563 Bacteria 2821
109 Ga0068855_100409189 3300005563 Bacteria 1485
110 Ga0070664_100118589 3300005564 Bacteria 2315
111 Ga0070664_100411668 3300005564 Bacteria 1237
112 Ga0070664_101478843 3300005564 Unclassified 643
113 Ga0068856_100130276 3300005614 Bacteria 2520
114 Ga0068856_100186576 3300005614 Bacteria 2088
115 Ga0070702_100456099 3300005615 Bacteria 928
116 Ga0070702_100662394 3300005615 Bacteria 791
117 Ga0068852_100359833 3300005616 Unclassified 1423
118 Ga0068852_100442241 3300005616 Bacteria 1286
119 Ga0068852_100903948 3300005616 Bacteria 900
120 Ga0068859_100383151 3300005617 Bacteria 1501
121 Ga0068864_100017929 3300005618 Bacteria 5906
122 Ga0068861_100040505 3300005719 Bacteria 3485
123 Ga0068851_10041190 3300005834 Bacteria 2322
124 Ga0068863_100089907 3300005841 Bacteria 2912
125 Ga0068863_100966132 3300005841 Bacteria 854
126 Ga0068858_100796122 3300005842 Bacteria 922
127 Ga0068858_101267145 3300005842 Unclassified 725
128 Ga0068860_100054096 3300005843 Bacteria 3816
129 Ga0068860_100520276 3300005843 Unclassified 1190
130 Ga0068862_100150821 3300005844 Bacteria 2069
131 Ga0068862_100526708 3300005844 Bacteria 1125
132 Ga0081455_10145659 3300005937 Bacteria 1833
133 Ga0070717_10148098 3300006028 Bacteria 2029
134 Ga0075365_10005358 3300006038 Bacteria 6911
135 Ga0075365_10448745 3300006038 Bacteria 911
136 Ga0075368_10018728 3300006042 Bacteria 2605
137 Ga0075363_100149199 3300006048 Bacteria 1319
138 Ga0075364_10009806 3300006051 Bacteria 5759
139 Ga0075364_10149987 3300006051 Bacteria 1571
140 Ga0070716_100000911 3300006173 Bacteria 12772
141 Ga0070716_100630526 3300006173 Bacteria 810
142 Ga0070712_100000065 3300006175 Bacteria 53344
143 Ga0070712_100009069 3300006175 Bacteria 6264
144 Ga0075362_10163960 3300006177 Bacteria 1071
145 Ga0075367_10040194 3300006178 Bacteria 2730
146 Ga0075367_10041329 3300006178 Unclassified 2695
147 Ga0075367_10122875 3300006178 Bacteria 1600
148 Ga0075367_10202439 3300006178 Bacteria 1240
149 Ga0075366_10036564 3300006195 Bacteria 2895
150 Ga0075366_10141629 3300006195 Bacteria 1454
151 Ga0097621_100095098 3300006237 Bacteria 2498
152 Ga0097621_100232488 3300006237 Bacteria 1610
153 Ga0075370_10004635 3300006353 Bacteria 6710
154 Ga0075370_10056087 3300006353 Bacteria 2238
155 Ga0075370_10094668 3300006353 Unclassified 1725
156 Ga0075370_10282682 3300006353 Bacteria 986
157 Ga0068871_100135177 3300006358 Bacteria 2094
158 Ga0068871_100170481 3300006358 Bacteria 1865
159 Ga0075428_100131138 3300006844 Unclassified 2726
160 Ga0075428_100172899 3300006844 Unclassified 2341
161 Ga0075428_100237482 3300006844 Bacteria 1967
162 Ga0075428_100253049 3300006844 Bacteria 1898
163 Ga0075428_101347078 3300006844 Bacteria 750
164 Ga0075428_101565571 3300006844 Bacteria 689
165 Ga0075430_100010571 3300006846 Bacteria 7815
166 Ga0075430_100044744 3300006846 Bacteria 3742
167 Ga0075430_101043219 3300006846 Unclassified 673
168 Ga0075431_100005349 3300006847 Bacteria 12669
169 Ga0075431_100224139 3300006847 Unclassified 1917
170 Ga0075431_100739407 3300006847 Bacteria 959
171 Ga0075431_100864289 3300006847 Unclassified 875
172 Ga0075431_101295895 3300006847 Unclassified 689
173 Ga0075433_10001869 3300006852 Bacteria 15820
174 Ga0075433_10053790 3300006852 Bacteria 3511
175 Ga0075433_10587059 3300006852 Bacteria 978
176 Ga0075434_100000316 3300006871 Bacteria 34532
177 Ga0075434_100018537 3300006871 Bacteria 6725
178 Ga0075434_100037503 3300006871 Bacteria 4798
179 Ga0075434_100206787 3300006871 Bacteria 1983
180 Ga0075429_100010861 3300006880 Bacteria 7875
181 Ga0075429_100355669 3300006880 Unclassified 1282
182 Ga0075429_100535283 3300006880 Bacteria 1027
183 Ga0075436_100011111 3300006914 Bacteria 6174
184 Ga0097620_100383166 3300006931 Bacteria 1501
185 Ga0075435_100020135 3300007076 Bacteria 5105
186 Ga0075435_100045521 3300007076 Bacteria 3518
187 Ga0075435_100110188 3300007076 Bacteria 2289
188 Ga0099795_10289491 3300007788 Bacteria 717
189 Ga0105240_10006679 3300009093 Bacteria 16914
190 Ga0105240_10061165 3300009093 Bacteria 4693
191 Ga0105240_10105617 3300009093 Bacteria 3418
192 Ga0105240_10118364 3300009093 Bacteria 3192
193 Ga0105240_10170560 3300009093 Bacteria 2578
194 Ga0105240_10620165 3300009093 Unclassified 1189
195 Ga0105240_11406433 3300009093 Unclassified 733
196 Ga0111539_10071221 3300009094 Bacteria 4102
197 Ga0111539_10199748 3300009094 Bacteria 2332
198 Ga0105245_10148203 3300009098 Bacteria 2216
199 Ga0105245_10151334 3300009098 Bacteria 2194
200 Ga0105245_10379086 3300009098 Bacteria 1408
201 Ga0105245_10672920 3300009098 Unclassified 1066
202 Ga0105247_10517416 3300009101 Bacteria 872
203 Ga0114129_10060019 3300009147 Bacteria 5317
204 Ga0114129_10061053 3300009147 Bacteria 5268
205 Ga0114129_10067019 3300009147 Bacteria 5006
206 Ga0114129_10490437 3300009147 Unclassified 1606
207 Ga0114129_10882321 3300009147 Bacteria 1135
208 Ga0105241_10081993 3300009174 Bacteria 2528
209 Ga0105241_10124225 3300009174 Bacteria 2082
210 Ga0105241_10258470 3300009174 Bacteria 1479
211 Ga0105241_11090491 3300009174 Bacteria 751
212 Ga0105242_10361690 3300009176 Bacteria 1343
213 Ga0105242_10959463 3300009176 Unclassified 860
214 Ga0105248_10003792 3300009177 Bacteria 16746
215 Ga0105248_10038222 3300009177 Bacteria 5371
216 Ga0105248_10279953 3300009177 Bacteria 1878
217 Ga0105248_10803189 3300009177 Bacteria 1062
218 Ga0105237_10001004 3300009545 Bacteria 37992
219 Ga0105237_10328683 3300009545 Bacteria 1533
220 Ga0105237_10510401 3300009545 Bacteria 1209
221 Ga0105237_10885263 3300009545 Bacteria 900
222 Ga0105238_10031933 3300009551 Bacteria 5358
223 Ga0105238_10090501 3300009551 Bacteria 3047
224 Ga0105238_10161213 3300009551 Bacteria 2218
225 Ga0105238_10251953 3300009551 Bacteria 1744
226 Ga0105249_10035688 3300009553 Unclassified 4509
227 Ga0105249_10113174 3300009553 Bacteria 2567
228 Ga0105239_10224405 3300010375 Bacteria 2107
229 Ga0105239_10318067 3300010375 Bacteria 1755
230 Ga0105239_10507286 3300010375 Bacteria 1372
231 Ga0105246_10120145 3300011119 Bacteria 1946
232 Ga0105246_10618620 3300011119 Bacteria 938
233 Ga0157370_10105121 3300013104 Bacteria 2643
234 Ga0157369_10066490 3300013105 Bacteria 3878
235 Ga0157369_10303264 3300013105 Bacteria 1661
236 Ga0157369_11707676 3300013105 Unclassified 640
237 Ga0157374_10796614 3300013296 Unclassified 961
238 Ga0157378_10001849 3300013297 Bacteria 19009
239 Ga0157378_10031792 3300013297 Bacteria 4661
240 Ga0157378_10154932 3300013297 Bacteria 2138
241 Ga0157378_10667767 3300013297 Bacteria 1056
242 Ga0157378_10667768 3300013297 Bacteria 1056
243 Ga0163162_10089873 3300013306 Bacteria 3152
244 Ga0157372_10231226 3300013307 Bacteria 2144
245 Ga0157372_10697428 3300013307 Bacteria 1181
246 Ga0157372_10739700 3300013307 Bacteria 1144
247 Ga0157375_10428306 3300013308 Bacteria 1489
248 Ga0157375_10525965 3300013308 Bacteria 1346
249 Ga0163163_10125979 3300014325 Bacteria 2599
250 Ga0163163_10189892 3300014325 Bacteria 2103
251 Ga0163163_10763991 3300014325 Bacteria 1030
252 Ga0157380_10001299 3300014326 Bacteria 16242
253 Ga0157380_10850999 3300014326 Unclassified 934
254 Ga0157380_11089808 3300014326 Bacteria 837
255 Ga0157380_11510325 3300014326 Unclassified 725
256 Ga0157379_10034327 3300014968 Bacteria 4523
257 Ga0157379_10139467 3300014968 Bacteria 2185
258 Ga0157376_10286370 3300014969 Bacteria 1554
259 Ga0157376_10295725 3300014969 Bacteria 1531
260 Ga0157376_11641127 3300014969 Bacteria 677
261 Ga0213876_10015050 3300021384 Bacteria 4100
262 Ga0213875_10067415 3300021388 Bacteria 1672
263 Ga0209758_1083880 3300025297 Bacteria 954
264 Ga0207653_10031777 3300025885 Bacteria 1706
265 Ga0207692_10211911 3300025898 Unclassified 1144
266 Ga0207680_10033812 3300025903 Bacteria 2920
267 Ga0207685_10081314 3300025905 Bacteria 1341
268 Ga0207699_10001465 3300025906 Bacteria 11204
269 Ga0207699_10013464 3300025906 Bacteria 4188
270 Ga0207645_10247689 3300025907 Bacteria 1178
271 Ga0207705_10006442 3300025909 Bacteria 8695
272 Ga0207705_10312076 3300025909 Bacteria 1207
273 Ga0207705_10526009 3300025909 Bacteria 919
274 Ga0207684_10001044 3300025910 Bacteria 30953
275 Ga0207684_10118351 3300025910 Unclassified 2270
276 Ga0207707_10403414 3300025912 Bacteria 1173
277 Ga0207695_10013238 3300025913 Bacteria 9843
278 Ga0207695_10059332 3300025913 Bacteria 3968
279 Ga0207695_10158453 3300025913 Bacteria 2197
280 Ga0207671_10029691 3300025914 Bacteria 4081
281 Ga0207671_10267986 3300025914 Bacteria 1345
282 Ga0207671_10342339 3300025914 Bacteria 1185
283 Ga0207671_10386259 3300025914 Bacteria 1112
284 Ga0207693_10000022 3300025915 Bacteria 127887
285 Ga0207693_10011601 3300025915 Bacteria 7129
286 Ga0207663_10028718 3300025916 Unclassified 3259
287 Ga0207660_10003669 3300025917 Bacteria 10008
288 Ga0207657_10010276 3300025919 Bacteria 9344
289 Ga0207649_10541206 3300025920 Unclassified 890
290 Ga0207646_10008150 3300025922 Bacteria 10540
291 Ga0207646_10375782 3300025922 Bacteria 1284
292 Ga0207694_10000741 3300025924 Bacteria 29353
293 Ga0207694_10048867 3300025924 Bacteria 3274
294 Ga0207694_10459624 3300025924 Bacteria 1063
295 Ga0207659_10691245 3300025926 Bacteria 873
296 Ga0207659_10720566 3300025926 Bacteria 855
297 Ga0207687_10444066 3300025927 Bacteria 1075
298 Ga0207700_10000056 3300025928 Bacteria 71553
299 Ga0207664_10007547 3300025929 Bacteria 7545
300 Ga0207664_10629395 3300025929 Bacteria 964
301 Ga0207665_10000385 3300025939 Bacteria 30257
302 Ga0207711_10004950 3300025941 Bacteria 11309
303 Ga0207711_10275865 3300025941 Bacteria 1547
304 Ga0207711_10618500 3300025941 Unclassified 1011
305 Ga0207661_10011512 3300025944 Bacteria 6413
306 Ga0207661_10072701 3300025944 Bacteria 2814
307 Ga0207661_10187855 3300025944 Unclassified 1810
308 Ga0207661_10877382 3300025944 Bacteria 826
309 Ga0207679_10105811 3300025945 Bacteria 2210
310 Ga0207679_10973138 3300025945 Unclassified 777
311 Ga0207651_10403096 3300025960 Bacteria 1164
312 Ga0207640_10669992 3300025981 Bacteria 886
313 Ga0207658_10075425 3300025986 Bacteria 2566
314 Ga0207658_10131569 3300025986 Bacteria 2011
315 Ga0207658_10807001 3300025986 Unclassified 852
316 Ga0207677_11219902 3300026023 Bacteria 689
317 Ga0207639_10364894 3300026041 Bacteria 1293
318 Ga0207639_10378068 3300026041 Bacteria 1271
319 Ga0207639_10534793 3300026041 Unclassified 1074
320 Ga0207708_10000126 3300026075 Bacteria 59505
321 Ga0207641_10459299 3300026088 Bacteria 1232
322 Ga0207641_10505860 3300026088 Bacteria 1174
323 Ga0207676_10066942 3300026095 Bacteria 2867
324 Ga0207675_100031989 3300026118 Bacteria 4901
325 Ga0207683_10045779 3300026121 Bacteria 3826
326 Ga0207698_10053339 3300026142 Bacteria 3103
327 Ga0207698_10265422 3300026142 Bacteria 1579
328 Ga0207698_10302953 3300026142 Bacteria 1488
329 Ga0210002_1002786 3300027617 Bacteria 2539
330 Ga0209998_10004255 3300027717 Bacteria 3051
331 Ga0209998_10028256 3300027717 Bacteria 1232
332 Ga0209974_10000290 3300027876 Bacteria 16397
333 Ga0209974_10031326 3300027876 Bacteria 1761
334 Ga0268266_10059589 3300028379 Bacteria 3289
335 Ga0268266_10417185 3300028379 Bacteria 1271
336 Ga0268266_10721193 3300028379 Bacteria 961
337 Ga0268265_10155182 3300028380 Bacteria 1936
338 Ga0268264_10590675 3300028381 Unclassified 1093
339 Ga0265318_10170618 3300028577 Bacteria 797
340 Ga0307515_10000018 3300028794 Bacteria 424853
341 Ga0265338_10141799 3300028800 Bacteria 1881
342 Ga0265338_10195712 3300028800 Bacteria 1528
343 Ga0265338_10535449 3300028800 Unclassified 821
344 Ga0265325_10026933 3300031241 Bacteria 3111
345 Ga0265325_10097809 3300031241 Unclassified 1440
346 Ga0265340_10382931 3300031247 Unclassified 621
347 Ga0265339_10021647 3300031249 Bacteria 3736
348 Ga0265339_10062547 3300031249 Bacteria 2001
349 Ga0265339_10337556 3300031249 Unclassified 712
350 Ga0307408_100004179 3300031548 Bacteria 9841
351 Ga0307508_10000120 3300031616 Bacteria 93316
352 Ga0307508_10100203 3300031616 Bacteria 2492
353 Ga0265314_10032642 3300031711 Bacteria 3827
354 Ga0307405_10002374 3300031731 Bacteria 8290
355 Ga0307413_10031519 3300031824 Bacteria 2993
356 Ga0307406_11116806 3300031901 Bacteria 681
357 Ga0307407_10074380 3300031903 Bacteria 2033
358 Ga0307407_10203494 3300031903 Unclassified 1328
359 Ga0307414_10042551 3300032004 Unclassified 3087
360 Ga0307415_100057000 3300032126 Bacteria 2682
361 Ga0373959_0033445 3300034820 Bacteria 1049
362 Ga0373926_0027645 3300035083 Unclassified 1989
363 Ga0373934_0103577 3300035086 Bacteria 1151
364 Ga0373944_0047092 3300035089 Unclassified 1350
365 Ga0373923_0059597 3300035111 Unclassified 1619
366 Ga0373936_0010571 3300035113 Unclassified 3484
367 Ga0373939_0071960 3300035114 Bacteria 1128
368 Ga0373956_0481568 3300035119 Bacteria 592
369 Ga0373943_0269354 3300035170 Archaea 960
370 Ga0373946_0038492 3300035171 Unclassified 1948
371 Ga0373955_0022208 3300035172 Bacteria 3216
372 Ga0373931_0293963 3300035691 Bacteria 1001
373 Ga0373935_0022427 3300035692 Bacteria 3872
374 Ga0373935_0177858 3300035692 Bacteria 1459
375 Ga0373933_0032336 3300035724 Bacteria 3041
376 Ga0373947_0016057 3300035725 Unclassified 4303
377 Ga0373947_0022255 3300035725 Bacteria 3674
378 Ga0373937_0309292 3300036401 Bacteria 1494
379 Ga0373937_0602170 3300036401 Bacteria 1043
380 Ga0373937_0639626 3300036401 Bacteria 1009
381 Ga0373925_0013285 3300037068 Bacteria 5960
382 Ga0395898_0758644 3300037466 Unclassified 911
383 Ga0395898_0836142 3300037466 Bacteria 860
384 Ga0395898_0978218 3300037466 Bacteria 783
385 Ga0395905_0025350 3300037471 Bacteria 5592
386 Ga0395905_0525315 3300037471 Bacteria 1084
387 Ga0436364_0528381 3300037853 Bacteria 1991
388 Ga0395901_0292222 3300038443 Unclassified 1691
389 Ga0395901_0536371 3300038443 Bacteria 1187
390 Ga0436365_0910109 3300039437 Bacteria 7067
391 Ga0436362_0414753 3300039453 Unclassified 575
392 Ga0439455_0008349 3300042012 Unclassified 2217
393 Ga0439458_0006193 3300042157 Unclassified 2669
394 Ga0439440_0065125 3300042993 Bacteria 938
395 Ga0453684_0014979 3300044712 Bacteria 12316
396 Ga0466968_0499969 3300044735 Unclassified 606
397 Ga0466957_0529767 3300044842 Bacteria 819
398 Ga0451576_0681968 3300045051 Bacteria 1080
399 Ga0466967_0691356 3300045976 Bacteria 1010
400 Ga0495592_0068850 3300046454 Bacteria 2582
401 Ga0495629_0154438 3300046459 Archaea 1595
402 Ga0495638_0027229 3300046460 Bacteria 3701
403 Ga0495638_0040965 3300046460 Bacteria 2933
404 Ga0495651_0119240 3300046462 Bacteria 1941
405 Ga0495580_0000523 3300046472 Bacteria 32397
406 Ga0495582_0001022 3300046473 Bacteria 15658
407 Ga0495582_0038559 3300046473 Bacteria 2630
408 Ga0495662_0362573 3300046476 Unclassified 712
409 Ga0495664_0198404 3300046477 Unclassified 1216
410 Ga0495596_0195110 3300046500 Bacteria 787
411 Ga0495608_0005145 3300046511 Bacteria 9348
412 Ga0495618_0019975 3300046514 Bacteria 4123
413 Ga0495628_0050339 3300046516 Bacteria 3295
414 Ga0495630_0002908 3300046517 Bacteria 11899
415 Ga0495630_0077911 3300046517 Unclassified 2499
416 Ga0495643_0058561 3300046522 Bacteria 2050
417 Ga0495586_0541918 3300046535 Unclassified 672
418 Ga0495587_0130618 3300046536 Bacteria 1435
419 Ga0495609_0026507 3300046538 Bacteria 2654
420 Ga0495645_0098531 3300046543 Bacteria 2080
421 Ga0495667_0008465 3300046559 Bacteria 6984
422 Ga0495667_0156819 3300046559 Unclassified 1465
423 Ga0495656_0211561 3300046615 Bacteria 966
424 Ga0495634_0193831 3300046642 Bacteria 1266
425 Ga0495599_0063826 3300046678 Bacteria 2301
426 Ga0495658_0084823 3300046683 Bacteria 1866
427 Ga0495613_0000975 3300046689 Bacteria 21818
428 Ga0495649_0108491 3300046694 Bacteria 1473
429 Ga0495649_0186360 3300046694 Bacteria 1081
430 Ga0495581_0249319 3300047315 Archaea 1038
431 Ga0495604_0006118 3300047317 Bacteria 9552
432 Ga0495674_0004353 3300047319 Bacteria 13610
433 Ga0495672_0005369 3300047320 Bacteria 10190
434 Ga0495675_0165720 3300047444 Bacteria 1359
435 Ga0495684_0000140 3300047471 Bacteria 53062
436 Ga0495684_0573532 3300047471 Unclassified 765
437 Ga0495602_0207571 3300048088 Bacteria 1490
438 Ga0495614_0251677 3300048089 Archaea 808
439 Ga0496105_0156533 3300048908 Bacteria 1871
440 Ga0496106_0003995 3300048909 Bacteria 11023
441 Ga0496108_0279390 3300048911 Unclassified 1454
442 Ga0496110_0017935 3300048913 Bacteria 5928
443 Ga0496113_0082844 3300048916 Bacteria 2461
444 Ga0496114_0067860 3300048917 Unclassified 2993
445 Ga0496115_0007463 3300048918 Bacteria 8047
446 Ga0496117_0016272 3300048920 Bacteria 6284
447 Ga0496118_0002345 3300048921 Bacteria 25686
448 Ga0496119_0436642 3300048922 Bacteria 619
449 Ga0496121_0003002 3300048924 Bacteria 24518
450 Ga0496124_0005039 3300048927 Bacteria 15096
451 Ga0496126_0019777 3300048929 Bacteria 6624
452 Ga0496126_0025870 3300048929 Bacteria 5637
453 Ga0495682_0036877 3300049460 Bacteria 1799
454 Ga0501032_0167902 3300049569 Bacteria 1439
455 Ga0501033_0674139 3300049570 Bacteria 705
456 Ga0501038_0190066 3300049574 Bacteria 1653
457 Ga0501039_0089418 3300049575 Bacteria 2400
458 Ga0501041_0159852 3300049577 Bacteria 1408
459 Ga0501042_0001234 3300049578 Bacteria 14883
460 Ga0501043_0489228 3300049579 Bacteria 920
461 Ga0501047_0188624 3300049581 Bacteria 1926
462 Ga0501048_0025864 3300049582 Bacteria 4276
463 Ga0501070_0225233 3300049586 Unclassified 1537
464 Ga0501070_0316570 3300049586 Bacteria 1270
465 Ga0501071_0029971 3300049587 Bacteria 3845
466 Ga0501072_0270015 3300049588 Bacteria 1353
467 Ga0501073_0108136 3300049589 Bacteria 1930
468 Ga0501073_0544812 3300049589 Unclassified 802
469 Ga0501074_0321340 3300049590 Bacteria 1099
470 Ga0501075_0027550 3300049591 Bacteria 4189
471 Ga0501076_0004492 3300049592 Bacteria 9938
472 Ga0501198_002323 3300049649 Unclassified 2554
473 Ga0501207_006153 3300049654 Archaea 1678
474 Ga0501216_000538 3300049660 Bacteria 4548
475 Ga0501217_000298 3300049661 Bacteria 7813
476 Ga0501223_004753 3300049663 Bacteria 2890
477 Ga0501227_030920 3300049665 Unclassified 1284
478 Ga0501233_001316 3300049668 Bacteria 4247
479 Ga0501236_001630 3300049670 Bacteria 2552
480 Ga0501243_002617 3300049675 Unclassified 2643
481 Ga0501257_041123 3300049686 Unclassified 1135
482 Ga0501225_0004531 3300049705 Archaea 4134
483 Ga0501079_0068983 3300049741 Bacteria 2729
484 Ga0501080_0493986 3300049742 Bacteria 1094
485 Ga0501080_0790174 3300049742 Bacteria 833
486 Ga0501081_0657131 3300049743 Bacteria 786
487 Ga0501044_0170182 3300049823 Bacteria 2150
488 Ga0501226_002004 3300049853 Bacteria 2533
489 nmdc:mga03683_54381_c1 3300050489 Bacteria 1678
490 nmdc:mga03n38_145079_c1 3300050490 Bacteria 1189
491 nmdc:mga00v17_132754_c1 3300050491 Bacteria 1592
492 nmdc:mga0yw44_459043_c1 3300050492 Bacteria 863
493 nmdc:mga0k408_87254_c1 3300050493 Unclassified 1832
494 nmdc:mga0k408_91651_c1 3300050493 Bacteria 1785
495 nmdc:mga06z11_4577_c1 3300050494 Bacteria 5454
496 nmdc:mga06z11_64566_c2 3300050494 Bacteria 652
497 nmdc:mga04h51_82267_c1 3300050495 Bacteria 1145
498 nmdc:mga07m45_103136_c1 3300050496 Unclassified 1639
499 nmdc:mga05p37_1022670_c1 3300050507 Unclassified 875
500 nmdc:mga05p37_1086803_c1 3300050507 Bacteria 839
501 nmdc:mga05p37_109575_c1 3300050507 Unclassified 3397
502 nmdc:mga05p37_115525_c1 3300050507 Bacteria 3299
503 nmdc:mga09592_132559_c1 3300050508 Bacteria 2145
504 nmdc:mga09592_271153_c1 3300050508 Unclassified 1472
505 nmdc:mga09592_330253_c1 3300050508 Unclassified 1320
506 nmdc:mga09592_9463_c1 3300050508 Bacteria 7918
507 nmdc:mga0qj67_100824_c1 3300050509 Unclassified 2328
508 nmdc:mga0qj67_103413_c1 3300050509 Bacteria 2298
509 nmdc:mga0qj67_13572_c1 3300050509 Bacteria 6144
510 nmdc:mga0qj67_45088_c1 3300050509 Bacteria 3478
511 nmdc:mga0qj67_8203_c1 3300050509 Bacteria 7743
512 nmdc:mga06r32_16653_c1 3300050510 Bacteria 6699
513 nmdc:mga06r32_1992_c1 3300050510 Bacteria 18250
514 nmdc:mga06r32_406635_c1 3300050510 Bacteria 1343
515 nmdc:mga06r32_41201_c1 3300050510 Bacteria 4386
516 nmdc:mga06r32_845947_c1 3300050510 Unclassified 874
517 nmdc:mga06r32_850233_c1 3300050510 Bacteria 871
518 nmdc:mga08y16_974340_c1 3300050511 Bacteria 830
519 nmdc:mga0n895_5259_c1 3300050512 Bacteria 10785
520 nmdc:mga0n895_86840_c1 3300050512 Bacteria 3125
521 nmdc:mga0n895_96349_c1 3300050512 Bacteria 2964
522 nmdc:mga0rr50_22551_c2 3300050513 Bacteria 3517
523 nmdc:mga0rr50_67600_c1 3300050513 Bacteria 2715
524 nmdc:mga08x19_3394_c1 3300050514 Bacteria 9499
525 nmdc:mga0a205_29616_c1 3300050515 Bacteria 5240
526 nmdc:mga0a205_64052_c1 3300050515 Bacteria 3551
527 Ga0495601_0001321 3300053077 Bacteria 13614
528 Ga0495619_0013156 3300053085 Bacteria 5214
529 Ga0500573_0000003 3300053140 Bacteria 355643
530 Ga0501084_0163182 3300054114 Bacteria 1880
531 Ga0501082_0089085 3300060353 Bacteria 2664
532 Ga0501082_0287323 3300060353 Bacteria 1432
533 Ga0105249_10498601
534 SwRhRL3b_contig_3264281
535 SwRhRL2b_contig_3588356
536 MBSR1b_contig_4902641
537 MBSR1b_contig_5893965
538 JGI24735J21928_10023417
539 rootH1_10151850
540 rootH1_10154437
541 Ga0065712_10153151
542 Ga0065715_10032149
543 Ga0065715_10382309
544 Ga0065707_10092599
545 Ga0065707_10121915
546 Ga0065707_10305419
547 Ga0070658_10003308
548 Ga0070658_10348609
549 Ga0070683_100001155
550 Ga0070683_100150815
551 Ga0070683_100964488
552 Ga0070690_100360374
553 Ga0070670_100304818
554 Ga0068869_100316898
555 Ga0070666_10077245
556 Ga0070680_100025304
557 Ga0070682_100013753
558 Ga0068868_100902566
559 Ga0070660_100112134
560 Ga0070689_100043820
561 Ga0070661_100539050
562 Ga0070661_100610960
563 Ga0070661_100819941
564 Ga0070675_100296169
565 Ga0070671_100229860
566 Ga0070671_100313761
567 Ga0070673_100004663
568 Ga0070673_100441432
569 Ga0070688_100008261
570 Ga0070688_100420456
571 Ga0070667_100126902
572 Ga0070667_100391371
573 Ga0070709_10004567
574 Ga0070714_100004779
575 Ga0070714_100578636
576 Ga0070713_100000888
577 Ga0070701_10287637
578 Ga0070701_10320998
579 Ga0070711_100000613
580 Ga0070711_100103827
581 Ga0070705_100030803
582 Ga0070705_100033531
583 Ga0070705_101234541
584 Ga0070700_100000215
585 Ga0070694_100244512
586 Ga0070708_100014475
587 Ga0070708_100017244
588 Ga0070708_100060060
589 Ga0070708_100528251
590 Ga0070708_100704760
591 Ga0070708_100876691
592 Ga0070681_10312779
593 Ga0070685_10006672
594 Ga0070706_100001047
595 Ga0070706_100140078
596 Ga0070706_100401463
597 Ga0070707_100006636
598 Ga0070707_100375095
599 Ga0070698_100000010
600 Ga0070698_100000531
601 Ga0070698_100021945
602 Ga0070698_100035737
603 Ga0070698_100251670
604 Ga0070698_100283485
605 Ga0070698_100643720
606 Ga0070699_100003720
607 Ga0070699_100004158
608 Ga0070699_100074587
609 Ga0070699_100093275
610 Ga0070699_100460663
611 Ga0070699_100510744
612 Ga0070679_100037531
613 Ga0070679_100053696
614 Ga0070679_100204752
615 Ga0070679_100226404
616 Ga0070684_100226566
617 Ga0070684_100402541
618 Ga0070684_101235926
619 Ga0070697_101067065
620 Ga0068853_100068238
621 Ga0068853_100553694
622 Ga0070672_100226053
623 Ga0070672_100783595
624 Ga0070686_100056717
625 Ga0070695_100285552
626 Ga0070696_100013343
627 Ga0070696_100740788
628 Ga0070693_100183325
629 Ga0070693_100183382
630 Ga0070693_100300506
631 Ga0070665_100021880
632 Ga0070665_100047801
633 Ga0070665_100100503
634 Ga0070665_100312664
635 Ga0070665_100839814
636 Ga0070704_100000386
637 Ga0070704_100056073
638 Ga0070704_100743122
639 Ga0070704_101314828
640 Ga0068855_100134458
641 Ga0068855_100409189
642 Ga0070664_100118589
643 Ga0070664_100411668
644 Ga0070664_101478843
645 Ga0068856_100130276
646 Ga0068856_100186576
647 Ga0070702_100456099
648 Ga0070702_100662394
649 Ga0068852_100359833
650 Ga0068852_100442241
651 Ga0068852_100903948
652 Ga0068859_100383151
653 Ga0068864_100017929
654 Ga0068861_100040505
655 Ga0068851_10041190
656 Ga0068863_100089907
657 Ga0068863_100966132
658 Ga0068858_100796122
659 Ga0068858_101267145
660 Ga0068860_100054096
661 Ga0068860_100520276
662 Ga0068862_100150821
663 Ga0068862_100526708
664 Ga0081455_10145659
665 Ga0070717_10148098
666 Ga0075365_10005358
667 Ga0075365_10448745
668 Ga0075368_10018728
669 Ga0075363_100149199
670 Ga0075364_10009806
671 Ga0075364_10149987
672 Ga0070716_100000911
673 Ga0070716_100630526
674 Ga0070712_100000065
675 Ga0070712_100009069
676 Ga0075362_10163960
677 Ga0075367_10040194
678 Ga0075367_10041329
679 Ga0075367_10122875
680 Ga0075367_10202439
681 Ga0075366_10036564
682 Ga0075366_10141629
683 Ga0097621_100095098
684 Ga0097621_100232488
685 Ga0075370_10004635
686 Ga0075370_10056087
687 Ga0075370_10094668
688 Ga0075370_10282682
689 Ga0068871_100135177
690 Ga0068871_100170481
691 Ga0075428_100131138
692 Ga0075428_100172899
693 Ga0075428_100237482
694 Ga0075428_100253049
695 Ga0075428_101347078
696 Ga0075428_101565571
697 Ga0075430_100010571
698 Ga0075430_100044744
699 Ga0075430_101043219
700 Ga0075431_100005349
701 Ga0075431_100224139
702 Ga0075431_100739407
703 Ga0075431_100864289
704 Ga0075431_101295895
705 Ga0075433_10001869
706 Ga0075433_10053790
707 Ga0075433_10587059
708 Ga0075434_100000316
709 Ga0075434_100018537
710 Ga0075434_100037503
711 Ga0075434_100206787
712 Ga0075429_100010861
713 Ga0075429_100355669
714 Ga0075429_100535283
715 Ga0075436_100011111
716 Ga0097620_100383166
717 Ga0075435_100020135
718 Ga0075435_100045521
719 Ga0075435_100110188
720 Ga0099795_10289491
721 Ga0105240_10006679
722 Ga0105240_10061165
723 Ga0105240_10105617
724 Ga0105240_10118364
725 Ga0105240_10170560
726 Ga0105240_10620165
727 Ga0105240_11406433
728 Ga0111539_10071221
729 Ga0111539_10199748
730 Ga0105245_10148203
731 Ga0105245_10151334
732 Ga0105245_10379086
733 Ga0105245_10672920
734 Ga0105247_10517416
735 Ga0114129_10060019
736 Ga0114129_10061053
737 Ga0114129_10067019
738 Ga0114129_10490437
739 Ga0114129_10882321
740 Ga0105241_10081993
741 Ga0105241_10124225
742 Ga0105241_10258470
743 Ga0105241_11090491
744 Ga0105242_10361690
745 Ga0105242_10959463
746 Ga0105248_10003792
747 Ga0105248_10038222
748 Ga0105248_10279953
749 Ga0105248_10803189
750 Ga0105237_10001004
751 Ga0105237_10328683
752 Ga0105237_10510401
753 Ga0105237_10885263
754 Ga0105238_10031933
755 Ga0105238_10090501
756 Ga0105238_10161213
757 Ga0105238_10251953
758 Ga0105249_10035688
759 Ga0105249_10113174
760 Ga0105239_10224405
761 Ga0105239_10318067
762 Ga0105239_10507286
763 Ga0105246_10120145
764 Ga0105246_10618620
765 Ga0157370_10105121
766 Ga0157369_10066490
767 Ga0157369_10303264
768 Ga0157369_11707676
769 Ga0157374_10796614
770 Ga0157378_10001849
771 Ga0157378_10031792
772 Ga0157378_10154932
773 Ga0157378_10667767
774 Ga0157378_10667768
775 Ga0163162_10089873
776 Ga0157372_10231226
777 Ga0157372_10697428
778 Ga0157372_10739700
779 Ga0157375_10428306
780 Ga0157375_10525965
781 Ga0163163_10125979
782 Ga0163163_10189892
783 Ga0163163_10763991
784 Ga0157380_10001299
785 Ga0157380_10850999
786 Ga0157380_11089808
787 Ga0157380_11510325
788 Ga0157379_10034327
789 Ga0157379_10139467
790 Ga0157376_10286370
791 Ga0157376_10295725
792 Ga0157376_11641127
793 Ga0213876_10015050
794 Ga0213875_10067415
795 Ga0209758_1083880
796 Ga0207653_10031777
797 Ga0207692_10211911
798 Ga0207680_10033812
799 Ga0207685_10081314
800 Ga0207699_10001465
801 Ga0207699_10013464
802 Ga0207645_10247689
803 Ga0207705_10006442
804 Ga0207705_10312076
805 Ga0207705_10526009
806 Ga0207684_10001044
807 Ga0207684_10118351
808 Ga0207707_10403414
809 Ga0207695_10013238
810 Ga0207695_10059332
811 Ga0207695_10158453
812 Ga0207671_10029691
813 Ga0207671_10267986
814 Ga0207671_10342339
815 Ga0207671_10386259
816 Ga0207693_10000022
817 Ga0207693_10011601
818 Ga0207663_10028718
819 Ga0207660_10003669
820 Ga0207657_10010276
821 Ga0207649_10541206
822 Ga0207646_10008150
823 Ga0207646_10375782
824 Ga0207694_10000741
825 Ga0207694_10048867
826 Ga0207694_10459624
827 Ga0207659_10691245
828 Ga0207659_10720566
829 Ga0207687_10444066
830 Ga0207700_10000056
831 Ga0207664_10007547
832 Ga0207664_10629395
833 Ga0207665_10000385
834 Ga0207711_10004950
835 Ga0207711_10275865
836 Ga0207711_10618500
837 Ga0207661_10011512
838 Ga0207661_10072701
839 Ga0207661_10187855
840 Ga0207661_10877382
841 Ga0207679_10105811
842 Ga0207679_10973138
843 Ga0207651_10403096
844 Ga0207640_10669992
845 Ga0207658_10075425
846 Ga0207658_10131569
847 Ga0207658_10807001
848 Ga0207677_11219902
849 Ga0207639_10364894
850 Ga0207639_10378068
851 Ga0207639_10534793
852 Ga0207708_10000126
853 Ga0207641_10459299
854 Ga0207641_10505860
855 Ga0207676_10066942
856 Ga0207675_100031989
857 Ga0207683_10045779
858 Ga0207698_10053339
859 Ga0207698_10265422
860 Ga0207698_10302953
861 Ga0210002_1002786
862 Ga0209998_10004255
863 Ga0209998_10028256
864 Ga0209974_10000290
865 Ga0209974_10031326
866 Ga0268266_10059589
867 Ga0268266_10417185
868 Ga0268266_10721193
869 Ga0268265_10155182
870 Ga0268264_10590675
871 Ga0265318_10170618
872 Ga0307515_10000018
873 Ga0265338_10141799
874 Ga0265338_10195712
875 Ga0265338_10535449
876 Ga0265325_10026933
877 Ga0265325_10097809
878 Ga0265340_10382931
879 Ga0265339_10021647
880 Ga0265339_10062547
881 Ga0265339_10337556
882 Ga0307408_100004179
883 Ga0307508_10000120
884 Ga0307508_10100203
885 Ga0265314_10032642
886 Ga0307405_10002374
887 Ga0307413_10031519
888 Ga0307406_11116806
889 Ga0307407_10074380
890 Ga0307407_10203494
891 Ga0307414_10042551
892 Ga0307415_100057000
893 Ga0373959_0033445
894 Ga0373926_0027645
895 Ga0373934_0103577
896 Ga0373944_0047092
897 Ga0373923_0059597
898 Ga0373936_0010571
899 Ga0373939_0071960
900 Ga0373956_0481568
901 Ga0373943_0269354
902 Ga0373946_0038492
903 Ga0373955_0022208
904 Ga0373931_0293963
905 Ga0373935_0022427
906 Ga0373935_0177858
907 Ga0373933_0032336
908 Ga0373947_0016057
909 Ga0373947_0022255
910 Ga0373937_0309292
911 Ga0373937_0602170
912 Ga0373937_0639626
913 Ga0373925_0013285
914 Ga0395898_0758644
915 Ga0395898_0836142
916 Ga0395898_0978218
917 Ga0395905_0025350
918 Ga0395905_0525315
919 Ga0436364_0528381
920 Ga0395901_0292222
921 Ga0395901_0536371
922 Ga0436365_0910109
923 Ga0436362_0414753
924 Ga0439455_0008349
925 Ga0439458_0006193
926 Ga0439440_0065125
927 Ga0453684_0014979
928 Ga0466968_0499969
929 Ga0466957_0529767
930 Ga0451576_0681968
931 Ga0466967_0691356
932 Ga0495592_0068850
933 Ga0495629_0154438
934 Ga0495638_0027229
935 Ga0495638_0040965
936 Ga0495651_0119240
937 Ga0495580_0000523
938 Ga0495582_0001022
939 Ga0495582_0038559
940 Ga0495662_0362573
941 Ga0495664_0198404
942 Ga0495596_0195110
943 Ga0495608_0005145
944 Ga0495618_0019975
945 Ga0495628_0050339
946 Ga0495630_0002908
947 Ga0495630_0077911
948 Ga0495643_0058561
949 Ga0495586_0541918
950 Ga0495587_0130618
951 Ga0495609_0026507
952 Ga0495645_0098531
953 Ga0495667_0008465
954 Ga0495667_0156819
955 Ga0495656_0211561
956 Ga0495634_0193831
957 Ga0495599_0063826
958 Ga0495658_0084823
959 Ga0495613_0000975
960 Ga0495649_0108491
961 Ga0495649_0186360
962 Ga0495581_0249319
963 Ga0495604_0006118
964 Ga0495674_0004353
965 Ga0495672_0005369
966 Ga0495675_0165720
967 Ga0495684_0000140
968 Ga0495684_0573532
969 Ga0495602_0207571
970 Ga0495614_0251677
971 Ga0496105_0156533
972 Ga0496106_0003995
973 Ga0496108_0279390
974 Ga0496110_0017935
975 Ga0496113_0082844
976 Ga0496114_0067860
977 Ga0496115_0007463
978 Ga0496117_0016272
979 Ga0496118_0002345
980 Ga0496119_0436642
981 Ga0496121_0003002
982 Ga0496124_0005039
983 Ga0496126_0019777
984 Ga0496126_0025870
985 Ga0495682_0036877
986 Ga0501032_0167902
987 Ga0501033_0674139
988 Ga0501038_0190066
989 Ga0501039_0089418
990 Ga0501041_0159852
991 Ga0501042_0001234
992 Ga0501043_0489228
993 Ga0501047_0188624
994 Ga0501048_0025864
995 Ga0501070_0225233
996 Ga0501070_0316570
997 Ga0501071_0029971
998 Ga0501072_0270015
999 Ga0501073_0108136
1000 Ga0501073_0544812
1001 Ga0501074_0321340
1002 Ga0501075_0027550
1003 Ga0501076_0004492
1004 Ga0501198_002323
1005 Ga0501207_006153
1006 Ga0501216_000538
1007 Ga0501217_000298
1008 Ga0501223_004753
1009 Ga0501227_030920
1010 Ga0501233_001316
1011 Ga0501236_001630
1012 Ga0501243_002617
1013 Ga0501257_041123
1014 Ga0501225_0004531
1015 Ga0501079_0068983
1016 Ga0501080_0493986
1017 Ga0501080_0790174
1018 Ga0501081_0657131
1019 Ga0501044_0170182
1020 Ga0501226_002004
1021 nmdc:mga03683_54381_c1
1022 nmdc:mga03n38_145079_c1
1023 nmdc:mga00v17_132754_c1
1024 nmdc:mga0yw44_459043_c1
1025 nmdc:mga0k408_87254_c1
1026 nmdc:mga0k408_91651_c1
1027 nmdc:mga06z11_4577_c1
1028 nmdc:mga06z11_64566_c2
1029 nmdc:mga04h51_82267_c1
1030 nmdc:mga07m45_103136_c1
1031 nmdc:mga05p37_1022670_c1
1032 nmdc:mga05p37_1086803_c1
1033 nmdc:mga05p37_109575_c1
1034 nmdc:mga05p37_115525_c1
1035 nmdc:mga09592_132559_c1
1036 nmdc:mga09592_271153_c1
1037 nmdc:mga09592_330253_c1
1038 nmdc:mga09592_9463_c1
1039 nmdc:mga0qj67_100824_c1
1040 nmdc:mga0qj67_103413_c1
1041 nmdc:mga0qj67_13572_c1
1042 nmdc:mga0qj67_45088_c1
1043 nmdc:mga0qj67_8203_c1
1044 nmdc:mga06r32_16653_c1
1045 nmdc:mga06r32_1992_c1
1046 nmdc:mga06r32_406635_c1
1047 nmdc:mga06r32_41201_c1
1048 nmdc:mga06r32_845947_c1
1049 nmdc:mga06r32_850233_c1
1050 nmdc:mga08y16_974340_c1
1051 nmdc:mga0n895_5259_c1
1052 nmdc:mga0n895_86840_c1
1053 nmdc:mga0n895_96349_c1
1054 nmdc:mga0rr50_22551_c2
1055 nmdc:mga0rr50_67600_c1
1056 nmdc:mga08x19_3394_c1
1057 nmdc:mga0a205_29616_c1
1058 nmdc:mga0a205_64052_c1
1059 Ga0495601_0001321
1060 Ga0495619_0013156
1061 Ga0500573_0000003
1062 Ga0501084_0163182
1063 Ga0501082_0089085
1064 Ga0501082_0287323

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

20

197

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8276 4 188
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8256 5 188
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8188 4 188
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.8167 5 189
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8164 5 188
ID Description Score Start End Superfamily
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8427 6 186 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8292 6 186 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8129 5 189 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8088 4 185 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8042 4 185 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A7Y5G0Q8-F1-model_v4 Dihydrofolate reductase 0.9961 3 189 GO:0008703
GO:0009231
AF-A0A7Y5G0Q8-F1-model_v4 Dihydrofolate reductase 0.9908 3 189 GO:0008703
GO:0009231
AF-A0A1B9SPR1-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.984 3 188 GO:0008703
GO:0009231
AF-Q6MQX9-F1-model_v4 Putative secreted protein 0.9813 1 188 GO:0008703
GO:0009231
AF-A0A1B9SPR1-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9787 3 188 GO:0008703
GO:0009231

Map