F460281
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 532 | 206 | 531 | 305 |
Family's Representative Sequence
| Representative Sequence | 3300025960|Ga0207651_10007231|Ga0207651_100072318 |
| Length | 356 |
| Sequence | MAHRMSKHGWHLVIHGGAGAMRPKHGDPDHEQRAREGLRAALDDGAAVLASGGAALDAVEASVRLLEDDPCFNAGRGSVLTSEGCVELDAAIMDGATRRAGAIAGLRTTRAPVSLARKLMEQGPHVFLSGNGADQFARDAGLEQVENSWFITPERQRQLDELLEHGGFDADVKYGTVGAVAVDEHGNVAAATSTGGLTAKRWGRIGDSPLIGAGTYADDRSAAVSATGSGEYFIRAVAAHQLAERVRFGGETLQAALDGVLADIRDLGGTGGLIAVAPNGDTAWGFTTRAMYRGIANSDGRTVAIYADEDERKGSAAVIHSASCAMAARSVATKSATAARKLRLGMKCAERVTTGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 137 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 138 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 139 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 141 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 142 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 143 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 144 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 145 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 146 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 147 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 148 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 149 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 150 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 151 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 153 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 154 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 155 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 158 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 159 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 160 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 161 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 162 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 163 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 164 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 165 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 166 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 167 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 183 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 185 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 186 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 187 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 188 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 189 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 190 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 191 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 192 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 193 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 194 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 195 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 196 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 197 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 198 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 199 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 200 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 201 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 202 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 206 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 0.56 |
| Nodule | 0 |
| Rhizoplane | 1.5 |
| Rhizosphere | 97.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10006708 | 3300001989 | Bacteria | 4334 |
| 2 | JGI24737J22298_10002015 | 3300001990 | Bacteria | 7257 |
| 3 | JGI24735J21928_10005958 | 3300002067 | Bacteria | 4026 |
| 4 | JGI24738J21930_10000573 | 3300002075 | Bacteria | 10539 |
| 5 | JGI24751J29686_10012503 | 3300002459 | Bacteria | 1750 |
| 6 | Ga0065715_10000657 | 3300005293 | Bacteria | 17035 |
| 7 | Ga0065707_10187989 | 3300005295 | Bacteria | 1377 |
| 8 | Ga0070658_10000171 | 3300005327 | Bacteria | 57017 |
| 9 | Ga0070658_10033779 | 3300005327 | Bacteria | 4116 |
| 10 | Ga0070658_10087297 | 3300005327 | Bacteria | 2567 |
| 11 | Ga0070658_10100876 | 3300005327 | Bacteria | 2386 |
| 12 | Ga0070658_10158512 | 3300005327 | Bacteria | 1898 |
| 13 | Ga0070658_10199594 | 3300005327 | Bacteria | 1687 |
| 14 | Ga0070676_10010325 | 3300005328 | Bacteria | 5065 |
| 15 | Ga0070683_100000608 | 3300005329 | Bacteria | 25688 |
| 16 | Ga0070683_100007839 | 3300005329 | Bacteria | 9042 |
| 17 | Ga0070670_100003354 | 3300005331 | Bacteria | 13262 |
| 18 | Ga0070670_100003856 | 3300005331 | Bacteria | 12503 |
| 19 | Ga0070670_100006052 | 3300005331 | Bacteria | 10232 |
| 20 | Ga0070670_100114834 | 3300005331 | Bacteria | 2321 |
| 21 | Ga0070677_10023631 | 3300005333 | Bacteria | 2277 |
| 22 | Ga0070677_10047636 | 3300005333 | Bacteria | 1719 |
| 23 | Ga0070677_10072970 | 3300005333 | Bacteria | 1449 |
| 24 | Ga0068869_100022765 | 3300005334 | Bacteria | 4321 |
| 25 | Ga0068869_100211196 | 3300005334 | Bacteria | 1534 |
| 26 | Ga0070666_10001125 | 3300005335 | Bacteria | 16290 |
| 27 | Ga0070666_10114778 | 3300005335 | Bacteria | 1865 |
| 28 | Ga0070680_100017399 | 3300005336 | Bacteria | 5669 |
| 29 | Ga0068868_100012162 | 3300005338 | Bacteria | 6285 |
| 30 | Ga0068868_100164845 | 3300005338 | Bacteria | 1832 |
| 31 | Ga0068868_100407658 | 3300005338 | Bacteria | 1174 |
| 32 | Ga0070660_100000134 | 3300005339 | Bacteria | 47105 |
| 33 | Ga0070660_100254911 | 3300005339 | Bacteria | 1431 |
| 34 | Ga0070692_10014989 | 3300005345 | Bacteria | 3656 |
| 35 | Ga0070668_100011424 | 3300005347 | Bacteria | 6615 |
| 36 | Ga0070668_100013414 | 3300005347 | Bacteria | 6116 |
| 37 | Ga0070668_100131808 | 3300005347 | Bacteria | 2007 |
| 38 | Ga0070669_100000722 | 3300005353 | Bacteria | 24132 |
| 39 | Ga0070669_100040561 | 3300005353 | Bacteria | 3384 |
| 40 | Ga0070669_100043918 | 3300005353 | Bacteria | 3256 |
| 41 | Ga0070669_100099686 | 3300005353 | Bacteria | 2190 |
| 42 | Ga0070669_100184063 | 3300005353 | Bacteria | 1636 |
| 43 | Ga0070675_100001154 | 3300005354 | Bacteria | 19084 |
| 44 | Ga0070675_100006153 | 3300005354 | Bacteria | 9198 |
| 45 | Ga0070675_100017077 | 3300005354 | Bacteria | 5766 |
| 46 | Ga0070675_100142739 | 3300005354 | Bacteria | 2048 |
| 47 | Ga0070671_100004634 | 3300005355 | Bacteria | 10905 |
| 48 | Ga0070671_100018188 | 3300005355 | Bacteria | 5706 |
| 49 | Ga0070671_100267356 | 3300005355 | Bacteria | 1453 |
| 50 | Ga0070674_100015601 | 3300005356 | Bacteria | 4747 |
| 51 | Ga0070674_100098294 | 3300005356 | Bacteria | 2127 |
| 52 | Ga0070673_100129541 | 3300005364 | Bacteria | 2115 |
| 53 | Ga0070659_100000067 | 3300005366 | Bacteria | 81723 |
| 54 | Ga0070659_100003069 | 3300005366 | Bacteria | 11859 |
| 55 | Ga0070659_100003694 | 3300005366 | Bacteria | 10914 |
| 56 | Ga0070659_100011112 | 3300005366 | Bacteria | 6651 |
| 57 | Ga0070659_100021627 | 3300005366 | Bacteria | 4902 |
| 58 | Ga0070659_100049919 | 3300005366 | Bacteria | 3290 |
| 59 | Ga0070659_100066382 | 3300005366 | Bacteria | 2859 |
| 60 | Ga0070667_100002206 | 3300005367 | Bacteria | 17134 |
| 61 | Ga0070667_100002611 | 3300005367 | Bacteria | 15628 |
| 62 | Ga0070667_100034609 | 3300005367 | Bacteria | 4227 |
| 63 | Ga0070667_100044663 | 3300005367 | Bacteria | 3722 |
| 64 | Ga0070667_100074000 | 3300005367 | Bacteria | 2906 |
| 65 | Ga0070714_100006574 | 3300005435 | Bacteria | 8993 |
| 66 | Ga0070714_100008901 | 3300005435 | Bacteria | 7854 |
| 67 | Ga0070700_100025242 | 3300005441 | Bacteria | 3499 |
| 68 | Ga0070694_100043673 | 3300005444 | Bacteria | 2998 |
| 69 | Ga0070663_100000671 | 3300005455 | Bacteria | 18346 |
| 70 | Ga0070663_100021761 | 3300005455 | Bacteria | 4272 |
| 71 | Ga0070678_100017303 | 3300005456 | Bacteria | 4638 |
| 72 | Ga0070678_100174356 | 3300005456 | Bacteria | 1754 |
| 73 | Ga0070678_100291627 | 3300005456 | Bacteria | 1383 |
| 74 | Ga0070662_100000250 | 3300005457 | Bacteria | 31764 |
| 75 | Ga0070662_100000873 | 3300005457 | Bacteria | 18446 |
| 76 | Ga0070662_100008790 | 3300005457 | Bacteria | 6588 |
| 77 | Ga0070662_100009066 | 3300005457 | Bacteria | 6492 |
| 78 | Ga0070662_100155823 | 3300005457 | Bacteria | 1783 |
| 79 | Ga0070662_100165610 | 3300005457 | Bacteria | 1732 |
| 80 | Ga0070662_100204277 | 3300005457 | Bacteria | 1569 |
| 81 | Ga0068867_100027613 | 3300005459 | Bacteria | 4081 |
| 82 | Ga0068867_100072236 | 3300005459 | Bacteria | 2582 |
| 83 | Ga0068867_100432471 | 3300005459 | Bacteria | 1117 |
| 84 | Ga0070679_100171474 | 3300005530 | Bacteria | 2142 |
| 85 | Ga0068853_100000366 | 3300005539 | Bacteria | 31104 |
| 86 | Ga0068853_100040983 | 3300005539 | Bacteria | 3953 |
| 87 | Ga0068853_100113071 | 3300005539 | Bacteria | 2414 |
| 88 | Ga0068853_100149091 | 3300005539 | Bacteria | 2104 |
| 89 | Ga0068853_100152170 | 3300005539 | Bacteria | 2083 |
| 90 | Ga0070672_100001931 | 3300005543 | Bacteria | 13017 |
| 91 | Ga0070672_100041672 | 3300005543 | Bacteria | 3531 |
| 92 | Ga0070672_100228970 | 3300005543 | Bacteria | 1561 |
| 93 | Ga0070672_100296593 | 3300005543 | Bacteria | 1369 |
| 94 | Ga0070695_100089243 | 3300005545 | Bacteria | 2054 |
| 95 | Ga0070696_100065949 | 3300005546 | Bacteria | 2538 |
| 96 | Ga0070693_100128311 | 3300005547 | Bacteria | 1582 |
| 97 | Ga0070665_100003424 | 3300005548 | Bacteria | 16943 |
| 98 | Ga0070665_100019092 | 3300005548 | Bacteria | 6877 |
| 99 | Ga0070665_100531964 | 3300005548 | Bacteria | 1187 |
| 100 | Ga0068855_100000434 | 3300005563 | Bacteria | 51855 |
| 101 | Ga0068855_100204717 | 3300005563 | Bacteria | 2220 |
| 102 | Ga0070664_100000170 | 3300005564 | Bacteria | 45449 |
| 103 | Ga0070664_100004225 | 3300005564 | Bacteria | 11551 |
| 104 | Ga0070664_100032810 | 3300005564 | Bacteria | 4345 |
| 105 | Ga0070664_100118384 | 3300005564 | Bacteria | 2317 |
| 106 | Ga0068857_100002151 | 3300005577 | Bacteria | 16023 |
| 107 | Ga0068857_100057883 | 3300005577 | Bacteria | 3441 |
| 108 | Ga0068857_100120729 | 3300005577 | Bacteria | 2359 |
| 109 | Ga0068857_100207471 | 3300005577 | Bacteria | 1787 |
| 110 | Ga0068857_100307635 | 3300005577 | Bacteria | 1462 |
| 111 | Ga0068857_100429180 | 3300005577 | Bacteria | 1233 |
| 112 | Ga0068854_100200748 | 3300005578 | Bacteria | 1567 |
| 113 | Ga0068856_100000793 | 3300005614 | Bacteria | 34127 |
| 114 | Ga0068856_100318087 | 3300005614 | Bacteria | 1574 |
| 115 | Ga0068852_100000251 | 3300005616 | Bacteria | 36412 |
| 116 | Ga0068852_100036355 | 3300005616 | Bacteria | 4120 |
| 117 | Ga0068852_100069958 | 3300005616 | Bacteria | 3078 |
| 118 | Ga0068852_100288877 | 3300005616 | Bacteria | 1583 |
| 119 | Ga0068852_100317568 | 3300005616 | Bacteria | 1512 |
| 120 | Ga0068859_100000136 | 3300005617 | Bacteria | 68907 |
| 121 | Ga0068859_100014991 | 3300005617 | Bacteria | 7781 |
| 122 | Ga0068859_100034799 | 3300005617 | Bacteria | 5055 |
| 123 | Ga0068859_100101739 | 3300005617 | Bacteria | 2931 |
| 124 | Ga0068859_100165200 | 3300005617 | Bacteria | 2293 |
| 125 | Ga0068859_100173686 | 3300005617 | Bacteria | 2237 |
| 126 | Ga0068864_100000651 | 3300005618 | Bacteria | 29025 |
| 127 | Ga0068864_100019582 | 3300005618 | Bacteria | 5661 |
| 128 | Ga0068864_100091745 | 3300005618 | Bacteria | 2680 |
| 129 | Ga0068864_100290563 | 3300005618 | Bacteria | 1528 |
| 130 | Ga0068861_100013259 | 3300005719 | Bacteria | 5767 |
| 131 | Ga0068861_100233189 | 3300005719 | Bacteria | 1562 |
| 132 | Ga0068851_10009273 | 3300005834 | Bacteria | 4568 |
| 133 | Ga0068851_10021086 | 3300005834 | Bacteria | 3161 |
| 134 | Ga0068863_100000140 | 3300005841 | Bacteria | 76175 |
| 135 | Ga0068863_100013399 | 3300005841 | Bacteria | 7905 |
| 136 | Ga0068863_100044783 | 3300005841 | Bacteria | 4199 |
| 137 | Ga0068863_100076125 | 3300005841 | Bacteria | 3175 |
| 138 | Ga0068858_100001826 | 3300005842 | Bacteria | 21672 |
| 139 | Ga0068858_100005794 | 3300005842 | Bacteria | 12065 |
| 140 | Ga0068858_100093113 | 3300005842 | Bacteria | 2805 |
| 141 | Ga0068860_100004881 | 3300005843 | Bacteria | 13665 |
| 142 | Ga0068860_100008260 | 3300005843 | Bacteria | 10358 |
| 143 | Ga0068860_100139575 | 3300005843 | Bacteria | 2328 |
| 144 | Ga0068860_100229309 | 3300005843 | Bacteria | 1805 |
| 145 | Ga0068860_100253882 | 3300005843 | Bacteria | 1713 |
| 146 | Ga0068860_100386567 | 3300005843 | Unclassified | 1382 |
| 147 | Ga0068860_100402921 | 3300005843 | Bacteria | 1353 |
| 148 | Ga0068862_100003397 | 3300005844 | Bacteria | 13728 |
| 149 | Ga0068862_100024686 | 3300005844 | Bacteria | 5044 |
| 150 | Ga0068862_100070567 | 3300005844 | Bacteria | 3016 |
| 151 | Ga0068862_100078937 | 3300005844 | Bacteria | 2853 |
| 152 | Ga0068862_100090625 | 3300005844 | Bacteria | 2662 |
| 153 | Ga0068862_100168947 | 3300005844 | Bacteria | 1957 |
| 154 | Ga0068862_100220672 | 3300005844 | Bacteria | 1716 |
| 155 | Ga0068862_100510388 | 3300005844 | Bacteria | 1142 |
| 156 | Ga0075365_10125145 | 3300006038 | Bacteria | 1776 |
| 157 | Ga0097621_100429396 | 3300006237 | Unclassified | 1187 |
| 158 | Ga0068871_100084047 | 3300006358 | Bacteria | 2641 |
| 159 | Ga0068871_100170166 | 3300006358 | Bacteria | 1867 |
| 160 | Ga0075431_100010549 | 3300006847 | Bacteria | 9288 |
| 161 | Ga0075433_10014104 | 3300006852 | Bacteria | 6517 |
| 162 | Ga0075434_100715366 | 3300006871 | Bacteria | 1019 |
| 163 | Ga0068865_100055117 | 3300006881 | Bacteria | 2765 |
| 164 | Ga0097620_100000136 | 3300006931 | Bacteria | 68907 |
| 165 | Ga0097620_100014992 | 3300006931 | Bacteria | 7781 |
| 166 | Ga0097620_100034798 | 3300006931 | Bacteria | 5055 |
| 167 | Ga0097620_100101742 | 3300006931 | Bacteria | 2931 |
| 168 | Ga0097620_100165205 | 3300006931 | Bacteria | 2293 |
| 169 | Ga0097620_100173689 | 3300006931 | Bacteria | 2237 |
| 170 | Ga0105250_10006154 | 3300009092 | Bacteria | 5273 |
| 171 | Ga0105240_10200961 | 3300009093 | Bacteria | 2336 |
| 172 | Ga0111539_10016465 | 3300009094 | Bacteria | 9167 |
| 173 | Ga0111539_10087692 | 3300009094 | Bacteria | 3655 |
| 174 | Ga0111539_10359989 | 3300009094 | Bacteria | 1693 |
| 175 | Ga0105243_10121626 | 3300009148 | Bacteria | 2202 |
| 176 | Ga0105243_10192522 | 3300009148 | Bacteria | 1782 |
| 177 | Ga0105241_10118518 | 3300009174 | Bacteria | 2128 |
| 178 | Ga0105241_10130783 | 3300009174 | Bacteria | 2032 |
| 179 | Ga0105248_10000416 | 3300009177 | Bacteria | 48833 |
| 180 | Ga0105248_10001074 | 3300009177 | Bacteria | 30223 |
| 181 | Ga0105248_10010278 | 3300009177 | Bacteria | 10302 |
| 182 | Ga0105248_10010640 | 3300009177 | Bacteria | 10146 |
| 183 | Ga0105248_10057097 | 3300009177 | Bacteria | 4381 |
| 184 | Ga0105248_10233303 | 3300009177 | Bacteria | 2071 |
| 185 | Ga0105238_10004794 | 3300009551 | Bacteria | 13382 |
| 186 | Ga0105238_10198701 | 3300009551 | Bacteria | 1980 |
| 187 | Ga0105238_10227595 | 3300009551 | Bacteria | 1841 |
| 188 | Ga0105249_10047155 | 3300009553 | Bacteria | 3925 |
| 189 | Ga0105249_10085168 | 3300009553 | Bacteria | 2945 |
| 190 | Ga0105246_10099425 | 3300011119 | Bacteria | 2114 |
| 191 | Ga0157373_10056276 | 3300013100 | Bacteria | 2794 |
| 192 | Ga0157373_10162735 | 3300013100 | Bacteria | 1570 |
| 193 | Ga0157373_10313498 | 3300013100 | Bacteria | 1115 |
| 194 | Ga0157371_10003313 | 3300013102 | Bacteria | 14726 |
| 195 | Ga0157371_10018061 | 3300013102 | Bacteria | 5223 |
| 196 | Ga0157371_10337980 | 3300013102 | Bacteria | 1095 |
| 197 | Ga0157370_10105456 | 3300013104 | Bacteria | 2638 |
| 198 | Ga0157370_10143116 | 3300013104 | Bacteria | 2227 |
| 199 | Ga0157370_10261271 | 3300013104 | Bacteria | 1600 |
| 200 | Ga0157369_10002615 | 3300013105 | Bacteria | 21530 |
| 201 | Ga0157369_10017149 | 3300013105 | Bacteria | 8135 |
| 202 | Ga0157369_10162445 | 3300013105 | Bacteria | 2357 |
| 203 | Ga0157378_10192935 | 3300013297 | Bacteria | 1922 |
| 204 | Ga0163162_10014337 | 3300013306 | Bacteria | 7745 |
| 205 | Ga0157372_10002970 | 3300013307 | Bacteria | 18265 |
| 206 | Ga0157375_10057975 | 3300013308 | Bacteria | 3830 |
| 207 | Ga0157375_10205807 | 3300013308 | Bacteria | 2124 |
| 208 | Ga0157375_10264587 | 3300013308 | Bacteria | 1881 |
| 209 | Ga0157375_10619148 | 3300013308 | Bacteria | 1241 |
| 210 | Ga0163163_10001010 | 3300014325 | Bacteria | 23813 |
| 211 | Ga0163163_10001818 | 3300014325 | Bacteria | 18008 |
| 212 | Ga0163163_10029780 | 3300014325 | Bacteria | 5253 |
| 213 | Ga0157380_10011701 | 3300014326 | Bacteria | 6344 |
| 214 | Ga0157380_10026069 | 3300014326 | Bacteria | 4437 |
| 215 | Ga0157380_10052391 | 3300014326 | Bacteria | 3231 |
| 216 | Ga0157379_10005135 | 3300014968 | Bacteria | 11233 |
| 217 | Ga0157379_10034021 | 3300014968 | Bacteria | 4542 |
| 218 | Ga0163161_10083730 | 3300017792 | Bacteria | 2351 |
| 219 | Ga0163161_10118315 | 3300017792 | Bacteria | 1988 |
| 220 | Ga0207697_10004622 | 3300025315 | Bacteria | 6542 |
| 221 | Ga0207656_10004954 | 3300025321 | Bacteria | 4677 |
| 222 | Ga0207656_10010956 | 3300025321 | Bacteria | 3412 |
| 223 | Ga0207682_10000527 | 3300025893 | Bacteria | 17568 |
| 224 | Ga0207682_10010107 | 3300025893 | Bacteria | 3704 |
| 225 | Ga0207688_10010292 | 3300025901 | Bacteria | 5091 |
| 226 | Ga0207688_10060488 | 3300025901 | Bacteria | 2134 |
| 227 | Ga0207688_10178850 | 3300025901 | Bacteria | 1264 |
| 228 | Ga0207647_10024741 | 3300025904 | Bacteria | 3957 |
| 229 | Ga0207647_10072117 | 3300025904 | Bacteria | 2083 |
| 230 | Ga0207645_10141728 | 3300025907 | Bacteria | 1566 |
| 231 | Ga0207645_10142611 | 3300025907 | Bacteria | 1561 |
| 232 | Ga0207645_10198911 | 3300025907 | Bacteria | 1318 |
| 233 | Ga0207705_10000212 | 3300025909 | Bacteria | 58540 |
| 234 | Ga0207705_10012187 | 3300025909 | Bacteria | 6214 |
| 235 | Ga0207705_10013882 | 3300025909 | Bacteria | 5808 |
| 236 | Ga0207705_10026828 | 3300025909 | Bacteria | 4105 |
| 237 | Ga0207695_10316623 | 3300025913 | Bacteria | 1450 |
| 238 | Ga0207660_10009002 | 3300025917 | Bacteria | 6461 |
| 239 | Ga0207660_10285476 | 3300025917 | Bacteria | 1311 |
| 240 | Ga0207657_10000638 | 3300025919 | Bacteria | 37165 |
| 241 | Ga0207657_10007988 | 3300025919 | Bacteria | 10787 |
| 242 | Ga0207657_10111679 | 3300025919 | Bacteria | 2256 |
| 243 | Ga0207657_10165519 | 3300025919 | Bacteria | 1794 |
| 244 | Ga0207649_10000304 | 3300025920 | Bacteria | 37784 |
| 245 | Ga0207649_10029557 | 3300025920 | Bacteria | 3237 |
| 246 | Ga0207652_10112754 | 3300025921 | Bacteria | 2413 |
| 247 | Ga0207681_10002811 | 3300025923 | Bacteria | 11017 |
| 248 | Ga0207681_10027816 | 3300025923 | Bacteria | 3660 |
| 249 | Ga0207681_10036269 | 3300025923 | Bacteria | 3252 |
| 250 | Ga0207681_10157473 | 3300025923 | Bacteria | 1708 |
| 251 | Ga0207681_10193124 | 3300025923 | Bacteria | 1559 |
| 252 | Ga0207681_10306939 | 3300025923 | Bacteria | 1257 |
| 253 | Ga0207694_10020412 | 3300025924 | Bacteria | 5013 |
| 254 | Ga0207694_10200087 | 3300025924 | Bacteria | 1625 |
| 255 | Ga0207650_10002625 | 3300025925 | Bacteria | 12437 |
| 256 | Ga0207650_10008254 | 3300025925 | Bacteria | 7109 |
| 257 | Ga0207650_10011136 | 3300025925 | Bacteria | 6185 |
| 258 | Ga0207650_10011146 | 3300025925 | Bacteria | 6183 |
| 259 | Ga0207650_10018464 | 3300025925 | Bacteria | 4895 |
| 260 | Ga0207650_10021270 | 3300025925 | Bacteria | 4586 |
| 261 | Ga0207650_10311402 | 3300025925 | Bacteria | 1288 |
| 262 | Ga0207659_10000877 | 3300025926 | Bacteria | 17877 |
| 263 | Ga0207659_10036003 | 3300025926 | Bacteria | 3425 |
| 264 | Ga0207659_10114456 | 3300025926 | Bacteria | 2056 |
| 265 | Ga0207687_10000473 | 3300025927 | Bacteria | 27414 |
| 266 | Ga0207687_10200344 | 3300025927 | Bacteria | 1560 |
| 267 | Ga0207664_10006488 | 3300025929 | Bacteria | 8051 |
| 268 | Ga0207664_10007948 | 3300025929 | Bacteria | 7373 |
| 269 | Ga0207644_10001989 | 3300025931 | Bacteria | 13220 |
| 270 | Ga0207644_10011810 | 3300025931 | Bacteria | 5783 |
| 271 | Ga0207644_10018897 | 3300025931 | Bacteria | 4671 |
| 272 | Ga0207644_10028914 | 3300025931 | Bacteria | 3842 |
| 273 | Ga0207644_10031819 | 3300025931 | Bacteria | 3678 |
| 274 | Ga0207690_10000264 | 3300025932 | Bacteria | 37683 |
| 275 | Ga0207690_10069941 | 3300025932 | Bacteria | 2416 |
| 276 | Ga0207706_10000639 | 3300025933 | Bacteria | 37168 |
| 277 | Ga0207706_10001215 | 3300025933 | Bacteria | 26023 |
| 278 | Ga0207706_10008348 | 3300025933 | Bacteria | 9551 |
| 279 | Ga0207706_10021226 | 3300025933 | Bacteria | 5834 |
| 280 | Ga0207706_10099314 | 3300025933 | Bacteria | 2561 |
| 281 | Ga0207706_10309549 | 3300025933 | Bacteria | 1375 |
| 282 | Ga0207706_10353785 | 3300025933 | Bacteria | 1277 |
| 283 | Ga0207686_10100883 | 3300025934 | Bacteria | 1927 |
| 284 | Ga0207686_10123039 | 3300025934 | Bacteria | 1768 |
| 285 | Ga0207709_10136150 | 3300025935 | Bacteria | 1682 |
| 286 | Ga0207669_10008218 | 3300025937 | Bacteria | 4889 |
| 287 | Ga0207704_10202735 | 3300025938 | Bacteria | 1453 |
| 288 | Ga0207691_10000878 | 3300025940 | Bacteria | 29903 |
| 289 | Ga0207691_10010146 | 3300025940 | Bacteria | 9040 |
| 290 | Ga0207691_10085676 | 3300025940 | Bacteria | 2828 |
| 291 | Ga0207691_10123357 | 3300025940 | Bacteria | 2293 |
| 292 | Ga0207711_10000105 | 3300025941 | Bacteria | 90036 |
| 293 | Ga0207711_10001216 | 3300025941 | Bacteria | 24391 |
| 294 | Ga0207711_10006500 | 3300025941 | Bacteria | 9841 |
| 295 | Ga0207711_10019212 | 3300025941 | Bacteria | 5689 |
| 296 | Ga0207711_10075817 | 3300025941 | Bacteria | 2928 |
| 297 | Ga0207689_10026313 | 3300025942 | Bacteria | 4871 |
| 298 | Ga0207689_10199171 | 3300025942 | Bacteria | 1653 |
| 299 | Ga0207689_10264803 | 3300025942 | Bacteria | 1422 |
| 300 | Ga0207661_10001647 | 3300025944 | Bacteria | 15222 |
| 301 | Ga0207661_10009350 | 3300025944 | Bacteria | 7023 |
| 302 | Ga0207661_10264956 | 3300025944 | Bacteria | 1532 |
| 303 | Ga0207679_10000191 | 3300025945 | Bacteria | 49174 |
| 304 | Ga0207679_10002027 | 3300025945 | Bacteria | 12576 |
| 305 | Ga0207679_10033400 | 3300025945 | Bacteria | 3620 |
| 306 | Ga0207679_10095670 | 3300025945 | Bacteria | 2309 |
| 307 | Ga0207679_10260474 | 3300025945 | Bacteria | 1479 |
| 308 | Ga0207679_10310641 | 3300025945 | Bacteria | 1362 |
| 309 | Ga0207679_10364554 | 3300025945 | Bacteria | 1263 |
| 310 | Ga0207667_10001227 | 3300025949 | Bacteria | 32137 |
| 311 | Ga0207667_10070885 | 3300025949 | Bacteria | 3626 |
| 312 | Ga0207651_10007231 | 3300025960 | Bacteria | 5904 |
| 313 | Ga0207651_10062498 | 3300025960 | Bacteria | 2595 |
| 314 | Ga0207651_10126433 | 3300025960 | Bacteria | 1948 |
| 315 | Ga0207651_10155666 | 3300025960 | Bacteria | 1785 |
| 316 | Ga0207712_10013271 | 3300025961 | Bacteria | 5280 |
| 317 | Ga0207712_10034390 | 3300025961 | Bacteria | 3435 |
| 318 | Ga0207668_10493337 | 3300025972 | Bacteria | 1052 |
| 319 | Ga0207640_10061806 | 3300025981 | Bacteria | 2482 |
| 320 | Ga0207640_10208454 | 3300025981 | Bacteria | 1487 |
| 321 | Ga0207658_10003869 | 3300025986 | Bacteria | 10543 |
| 322 | Ga0207658_10010411 | 3300025986 | Bacteria | 6317 |
| 323 | Ga0207658_10017239 | 3300025986 | Bacteria | 4976 |
| 324 | Ga0207658_10063735 | 3300025986 | Bacteria | 2763 |
| 325 | Ga0207658_10189557 | 3300025986 | Bacteria | 1708 |
| 326 | Ga0207703_10000974 | 3300026035 | Bacteria | 27552 |
| 327 | Ga0207703_10026142 | 3300026035 | Bacteria | 4593 |
| 328 | Ga0207639_10000179 | 3300026041 | Bacteria | 49456 |
| 329 | Ga0207639_10002119 | 3300026041 | Bacteria | 13364 |
| 330 | Ga0207639_10073426 | 3300026041 | Bacteria | 2682 |
| 331 | Ga0207639_10107765 | 3300026041 | Bacteria | 2264 |
| 332 | Ga0207639_10116685 | 3300026041 | Bacteria | 2186 |
| 333 | Ga0207678_10002101 | 3300026067 | Bacteria | 18034 |
| 334 | Ga0207678_10018822 | 3300026067 | Bacteria | 6064 |
| 335 | Ga0207678_10132933 | 3300026067 | Bacteria | 2123 |
| 336 | Ga0207708_10048527 | 3300026075 | Bacteria | 3232 |
| 337 | Ga0207702_10000413 | 3300026078 | Bacteria | 48840 |
| 338 | Ga0207702_10372358 | 3300026078 | Bacteria | 1371 |
| 339 | Ga0207641_10000172 | 3300026088 | Bacteria | 90549 |
| 340 | Ga0207641_10102376 | 3300026088 | Bacteria | 2525 |
| 341 | Ga0207641_10109019 | 3300026088 | Bacteria | 2451 |
| 342 | Ga0207648_10009427 | 3300026089 | Bacteria | 9353 |
| 343 | Ga0207648_10032670 | 3300026089 | Bacteria | 4592 |
| 344 | Ga0207676_10002051 | 3300026095 | Bacteria | 14619 |
| 345 | Ga0207676_10098256 | 3300026095 | Bacteria | 2420 |
| 346 | Ga0207676_10101102 | 3300026095 | Bacteria | 2390 |
| 347 | Ga0207676_10245491 | 3300026095 | Bacteria | 1609 |
| 348 | Ga0207674_10006642 | 3300026116 | Bacteria | 13588 |
| 349 | Ga0207674_10013457 | 3300026116 | Bacteria | 9074 |
| 350 | Ga0207674_10074107 | 3300026116 | Bacteria | 3417 |
| 351 | Ga0207674_10112180 | 3300026116 | Bacteria | 2700 |
| 352 | Ga0207675_100010422 | 3300026118 | Bacteria | 8705 |
| 353 | Ga0207683_10012717 | 3300026121 | Bacteria | 7181 |
| 354 | Ga0207698_10002088 | 3300026142 | Bacteria | 11786 |
| 355 | Ga0207698_10013588 | 3300026142 | Bacteria | 5379 |
| 356 | Ga0207698_10025863 | 3300026142 | Bacteria | 4143 |
| 357 | Ga0207698_10151533 | 3300026142 | Bacteria | 2013 |
| 358 | Ga0207698_10245407 | 3300026142 | Bacteria | 1635 |
| 359 | Ga0268266_10003318 | 3300028379 | Bacteria | 16154 |
| 360 | Ga0268266_10367226 | 3300028379 | Bacteria | 1355 |
| 361 | Ga0268266_10514137 | 3300028379 | Bacteria | 1144 |
| 362 | Ga0268265_10002567 | 3300028380 | Bacteria | 13576 |
| 363 | Ga0268265_10009320 | 3300028380 | Bacteria | 6636 |
| 364 | Ga0268265_10014584 | 3300028380 | Bacteria | 5356 |
| 365 | Ga0268265_10053264 | 3300028380 | Bacteria | 3065 |
| 366 | Ga0268265_10054823 | 3300028380 | Bacteria | 3027 |
| 367 | Ga0268265_10074093 | 3300028380 | Bacteria | 2661 |
| 368 | Ga0268265_10280166 | 3300028380 | Bacteria | 1491 |
| 369 | Ga0268264_10001846 | 3300028381 | Bacteria | 19295 |
| 370 | Ga0268264_10069255 | 3300028381 | Bacteria | 2984 |
| 371 | Ga0268264_10069881 | 3300028381 | Bacteria | 2971 |
| 372 | Ga0307515_10313652 | 3300028794 | Bacteria | 1241 |
| 373 | Ga0307408_100009963 | 3300031548 | Bacteria | 6260 |
| 374 | Ga0307408_100371900 | 3300031548 | Bacteria | 1219 |
| 375 | Ga0307508_10003647 | 3300031616 | Bacteria | 15437 |
| 376 | Ga0307405_10039549 | 3300031731 | Bacteria | 2851 |
| 377 | Ga0307405_10147199 | 3300031731 | Bacteria | 1651 |
| 378 | Ga0307405_10235658 | 3300031731 | Bacteria | 1352 |
| 379 | Ga0307405_10320050 | 3300031731 | Bacteria | 1184 |
| 380 | Ga0307413_10010653 | 3300031824 | Bacteria | 4475 |
| 381 | Ga0307413_10220035 | 3300031824 | Bacteria | 1386 |
| 382 | Ga0307410_10001680 | 3300031852 | Bacteria | 10178 |
| 383 | Ga0307410_10006193 | 3300031852 | Bacteria | 6429 |
| 384 | Ga0307410_10028784 | 3300031852 | Bacteria | 3529 |
| 385 | Ga0307406_10056920 | 3300031901 | Bacteria | 2506 |
| 386 | Ga0307406_10119732 | 3300031901 | Bacteria | 1828 |
| 387 | Ga0307406_10162844 | 3300031901 | Bacteria | 1606 |
| 388 | Ga0307406_10204208 | 3300031901 | Bacteria | 1457 |
| 389 | Ga0307406_10275826 | 3300031901 | Bacteria | 1280 |
| 390 | Ga0307407_10007557 | 3300031903 | Bacteria | 4929 |
| 391 | Ga0307407_10068145 | 3300031903 | Bacteria | 2107 |
| 392 | Ga0307412_10037987 | 3300031911 | Bacteria | 3097 |
| 393 | Ga0307412_10039765 | 3300031911 | Bacteria | 3039 |
| 394 | Ga0307412_10092000 | 3300031911 | Bacteria | 2124 |
| 395 | Ga0307412_10126865 | 3300031911 | Bacteria | 1847 |
| 396 | Ga0307409_100004691 | 3300031995 | Bacteria | 7735 |
| 397 | Ga0307409_100051618 | 3300031995 | Bacteria | 3148 |
| 398 | Ga0307409_100096176 | 3300031995 | Bacteria | 2442 |
| 399 | Ga0307409_100220886 | 3300031995 | Bacteria | 1710 |
| 400 | Ga0307409_100222182 | 3300031995 | Bacteria | 1706 |
| 401 | Ga0307416_100008568 | 3300032002 | Bacteria | 6612 |
| 402 | Ga0307416_100010906 | 3300032002 | Bacteria | 6028 |
| 403 | Ga0307416_100103781 | 3300032002 | Bacteria | 2483 |
| 404 | Ga0307416_100211707 | 3300032002 | Bacteria | 1850 |
| 405 | Ga0307416_100276593 | 3300032002 | Bacteria | 1652 |
| 406 | Ga0307416_100286425 | 3300032002 | Bacteria | 1628 |
| 407 | Ga0307416_100472651 | 3300032002 | Bacteria | 1312 |
| 408 | Ga0307414_10002944 | 3300032004 | Bacteria | 9002 |
| 409 | Ga0307414_10006121 | 3300032004 | Bacteria | 6682 |
| 410 | Ga0307414_10006145 | 3300032004 | Bacteria | 6672 |
| 411 | Ga0307414_10116153 | 3300032004 | Bacteria | 2048 |
| 412 | Ga0307411_10000586 | 3300032005 | Bacteria | 13032 |
| 413 | Ga0307411_10015264 | 3300032005 | Bacteria | 4307 |
| 414 | Ga0307411_10080211 | 3300032005 | Bacteria | 2243 |
| 415 | Ga0307411_10378487 | 3300032005 | Bacteria | 1163 |
| 416 | Ga0307411_10461077 | 3300032005 | Bacteria | 1065 |
| 417 | Ga0307411_10463512 | 3300032005 | Bacteria | 1063 |
| 418 | Ga0307415_100019776 | 3300032126 | Bacteria | 4095 |
| 419 | Ga0307415_100043322 | 3300032126 | Bacteria | 3002 |
| 420 | Ga0373929_0022189 | 3300035085 | Bacteria | 1294 |
| 421 | Ga0373942_0014208 | 3300035207 | Bacteria | 1924 |
| 422 | Ga0395899_0002299 | 3300037312 | Bacteria | 15586 |
| 423 | Ga0395899_0018642 | 3300037312 | Bacteria | 5273 |
| 424 | Ga0395899_0114131 | 3300037312 | Bacteria | 1940 |
| 425 | Ga0395899_0219863 | 3300037312 | Bacteria | 1316 |
| 426 | Ga0395900_0001884 | 3300037418 | Bacteria | 23847 |
| 427 | Ga0395900_0016277 | 3300037418 | Bacteria | 7579 |
| 428 | Ga0395900_0020547 | 3300037418 | Bacteria | 6742 |
| 429 | Ga0395900_0044846 | 3300037418 | Bacteria | 4554 |
| 430 | Ga0395900_0049948 | 3300037418 | Bacteria | 4309 |
| 431 | Ga0395900_0091155 | 3300037418 | Bacteria | 3132 |
| 432 | Ga0395900_0123505 | 3300037418 | Bacteria | 2655 |
| 433 | Ga0395898_0022238 | 3300037466 | Bacteria | 6425 |
| 434 | Ga0395898_0043900 | 3300037466 | Bacteria | 4404 |
| 435 | Ga0395898_0123767 | 3300037466 | Bacteria | 2478 |
| 436 | Ga0395898_0267226 | 3300037466 | Bacteria | 1631 |
| 437 | Ga0395905_0000940 | 3300037471 | Bacteria | 37468 |
| 438 | Ga0395905_0015335 | 3300037471 | Bacteria | 7285 |
| 439 | Ga0395905_0023644 | 3300037471 | Bacteria | 5802 |
| 440 | Ga0395905_0031015 | 3300037471 | Bacteria | 5034 |
| 441 | Ga0395905_0033319 | 3300037471 | Bacteria | 4839 |
| 442 | Ga0395905_0037428 | 3300037471 | Bacteria | 4555 |
| 443 | Ga0395905_0053971 | 3300037471 | Bacteria | 3761 |
| 444 | Ga0395905_0089990 | 3300037471 | Bacteria | 2877 |
| 445 | Ga0395905_0139689 | 3300037471 | Bacteria | 2279 |
| 446 | Ga0395905_0144989 | 3300037471 | Bacteria | 2234 |
| 447 | Ga0395905_0256585 | 3300037471 | Bacteria | 1633 |
| 448 | Ga0395905_0380202 | 3300037471 | Bacteria | 1306 |
| 449 | Ga0395905_0647545 | 3300037471 | Unclassified | 959 |
| 450 | Ga0395901_0001289 | 3300038443 | Bacteria | 26489 |
| 451 | Ga0395901_0011872 | 3300038443 | Bacteria | 8833 |
| 452 | Ga0395901_0012548 | 3300038443 | Bacteria | 8598 |
| 453 | Ga0395901_0037623 | 3300038443 | Bacteria | 5004 |
| 454 | Ga0395901_0053642 | 3300038443 | Bacteria | 4189 |
| 455 | Ga0395901_0492091 | 3300038443 | Bacteria | 1249 |
| 456 | Ga0439445_0016147 | 3300042004 | Bacteria | 1834 |
| 457 | Ga0450917_001103 | 3300042120 | Bacteria | 1983 |
| 458 | Ga0450889_003880 | 3300042144 | Bacteria | 1476 |
| 459 | Ga0466966_0000021 | 3300044684 | Bacteria | 116714 |
| 460 | Ga0466961_0067351 | 3300044693 | Bacteria | 2274 |
| 461 | Ga0466961_0088698 | 3300044693 | Bacteria | 1954 |
| 462 | Ga0466963_0016310 | 3300044694 | Bacteria | 4617 |
| 463 | Ga0466963_0138165 | 3300044694 | Bacteria | 1687 |
| 464 | Ga0466963_0216413 | 3300044694 | Bacteria | 1341 |
| 465 | Ga0466957_0000196 | 3300044842 | Bacteria | 27913 |
| 466 | Ga0466957_0002469 | 3300044842 | Bacteria | 9932 |
| 467 | Ga0466957_0053703 | 3300044842 | Bacteria | 2457 |
| 468 | Ga0466959_0010835 | 3300045049 | Bacteria | 6536 |
| 469 | Ga0466958_0000506 | 3300045836 | Bacteria | 16309 |
| 470 | Ga0466967_0003640 | 3300045976 | Bacteria | 10132 |
| 471 | Ga0466967_0021699 | 3300045976 | Bacteria | 5223 |
| 472 | Ga0466967_0122115 | 3300045976 | Bacteria | 2408 |
| 473 | Ga0466967_0352859 | 3300045976 | Bacteria | 1424 |
| 474 | Ga0495585_0010304 | 3300046492 | Bacteria | 5572 |
| 475 | Ga0495663_0001608 | 3300046525 | Bacteria | 7066 |
| 476 | Ga0495663_0001665 | 3300046525 | Bacteria | 6928 |
| 477 | Ga0495642_0021481 | 3300046528 | Bacteria | 2539 |
| 478 | Ga0495642_0190633 | 3300046528 | Bacteria | 893 |
| 479 | Ga0495598_0000355 | 3300046537 | Bacteria | 8181 |
| 480 | Ga0495598_0007997 | 3300046537 | Bacteria | 2448 |
| 481 | Ga0495598_0013226 | 3300046537 | Bacteria | 2041 |
| 482 | Ga0495621_0001079 | 3300046539 | Bacteria | 7002 |
| 483 | Ga0495621_0003905 | 3300046539 | Bacteria | 4141 |
| 484 | Ga0495621_0005019 | 3300046539 | Bacteria | 3773 |
| 485 | Ga0495621_0025089 | 3300046539 | Bacteria | 1999 |
| 486 | Ga0495621_0059896 | 3300046539 | Bacteria | 1380 |
| 487 | Ga0495622_0053575 | 3300046557 | Bacteria | 1872 |
| 488 | Ga0495633_0010639 | 3300046558 | Bacteria | 5013 |
| 489 | Ga0495668_0003644 | 3300046616 | Bacteria | 11384 |
| 490 | Ga0495659_0003377 | 3300046664 | Bacteria | 5115 |
| 491 | Ga0495659_0005087 | 3300046664 | Bacteria | 4131 |
| 492 | Ga0495659_0042444 | 3300046664 | Bacteria | 1628 |
| 493 | Ga0495661_0016408 | 3300046665 | Bacteria | 4909 |
| 494 | Ga0495669_0000570 | 3300046684 | Bacteria | 16324 |
| 495 | Ga0495669_0011512 | 3300046684 | Bacteria | 3757 |
| 496 | Ga0495669_0016808 | 3300046684 | Bacteria | 3136 |
| 497 | Ga0495670_0015651 | 3300046691 | Bacteria | 3727 |
| 498 | Ga0495670_0028722 | 3300046691 | Bacteria | 2757 |
| 499 | Ga0495670_0036816 | 3300046691 | Bacteria | 2438 |
| 500 | Ga0495670_0047004 | 3300046691 | Bacteria | 2157 |
| 501 | Ga0495670_0110461 | 3300046691 | Bacteria | 1422 |
| 502 | Ga0495677_0003145 | 3300047445 | Bacteria | 6437 |
| 503 | Ga0495677_0087165 | 3300047445 | Bacteria | 1174 |
| 504 | Ga0496100_0059744 | 3300048903 | Bacteria | 2506 |
| 505 | Ga0496101_0011204 | 3300048904 | Bacteria | 5941 |
| 506 | Ga0496101_0354588 | 3300048904 | Bacteria | 1153 |
| 507 | Ga0496107_0052549 | 3300048910 | Bacteria | 2939 |
| 508 | Ga0496109_0017447 | 3300048912 | Bacteria | 6294 |
| 509 | Ga0496110_0002543 | 3300048913 | Bacteria | 13715 |
| 510 | Ga0496111_0004244 | 3300048914 | Bacteria | 9031 |
| 511 | Ga0496114_0087718 | 3300048917 | Bacteria | 2638 |
| 512 | Ga0501290_001519 | 3300049513 | Bacteria | 3162 |
| 513 | Ga0501292_000012 | 3300049515 | Bacteria | 69398 |
| 514 | Ga0501294_000207 | 3300049517 | Bacteria | 7276 |
| 515 | Ga0501202_011211 | 3300049652 | Bacteria | 1677 |
| 516 | Ga0501222_001760 | 3300049662 | Bacteria | 3003 |
| 517 | Ga0501227_005638 | 3300049665 | Bacteria | 2680 |
| 518 | Ga0501235_005673 | 3300049669 | Bacteria | 2715 |
| 519 | Ga0501259_001670 | 3300049688 | Bacteria | 3694 |
| 520 | Ga0501261_000031 | 3300049690 | Bacteria | 31241 |
| 521 | Ga0501245_000094 | 3300049708 | Bacteria | 8843 |
| 522 | Ga0501279_000004 | 3300049775 | Bacteria | 175612 |
| 523 | Ga0501280_000052 | 3300049776 | Bacteria | 33642 |
| 524 | Ga0501282_000448 | 3300049778 | Bacteria | 4918 |
| 525 | Ga0501283_001414 | 3300049779 | Bacteria | 3125 |
| 526 | nmdc:mga0yw44_189101_c1 | 3300050492 | Bacteria | 1357 |
| 527 | nmdc:mga06r32_62768_c1 | 3300050510 | Bacteria | 3580 |
| 528 | nmdc:mga08y16_72472_c1 | 3300050511 | Bacteria | 3589 |
| 529 | nmdc:mga0a205_8452_c1 | 3300050515 | Bacteria | 9369 |
| 530 | Ga0500658_0000585 | 3300053134 | Bacteria | 15336 |
| 531 | Ga0466962_0014837 | 3300061719 | Bacteria | 3753 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031995 | Ga0307409_100222182 | Ga0307409_1002221822 | 262 |
| 2 | 3300032005 | Ga0307411_10461077 | Ga0307411_104610771 | 262 |
| 3 | 3300006038 | Ga0075365_10125145 | Ga0075365_101251452 | 264 |
| 4 | 3300050492 | nmdc:mga0yw44_189101_c1 | nmdc:mga0yw44_189101_c1_139_1068 | 264 |
| 5 | 3300046691 | Ga0495670_0110461 | Ga0495670_0110461_124_978 | 268 |
| 6 | 3300028380 | Ga0268265_10009320 | Ga0268265_100093202 | 270 |
| 7 | 3300005331 | Ga0070670_100003354 | Ga0070670_1000033544 | 271 |
| 8 | 3300025925 | Ga0207650_10011136 | Ga0207650_100111369 | 271 |
| 9 | 3300031903 | Ga0307407_10068145 | Ga0307407_100681452 | 271 |
| 10 | 3300032005 | Ga0307411_10015264 | Ga0307411_100152646 | 271 |
| 11 | 3300046528 | Ga0495642_0190633 | Ga0495642_0190633_35_859 | 271 |
| 12 | 3300006847 | Ga0075431_100010549 | Ga0075431_10001054911 | 272 |
| 13 | 3300042004 | Ga0439445_0016147 | Ga0439445_0016147_292_1215 | 272 |
| 14 | 3300049513 | Ga0501290_001519 | Ga0501290_001519_151_1119 | 272 |
| 15 | 3300049515 | Ga0501292_000012 | Ga0501292_000012_50376_51347 | 272 |
| 16 | 3300049517 | Ga0501294_000207 | Ga0501294_000207_5344_6315 | 272 |
| 17 | 3300049652 | Ga0501202_011211 | Ga0501202_011211_334_1305 | 272 |
| 18 | 3300049662 | Ga0501222_001760 | Ga0501222_001760_1945_2916 | 272 |
| 19 | 3300049665 | Ga0501227_005638 | Ga0501227_005638_161_1132 | 272 |
| 20 | 3300049669 | Ga0501235_005673 | Ga0501235_005673_1187_2158 | 272 |
| 21 | 3300049688 | Ga0501259_001670 | Ga0501259_001670_1147_2118 | 272 |
| 22 | 3300049690 | Ga0501261_000031 | Ga0501261_000031_29286_30257 | 272 |
| 23 | 3300049708 | Ga0501245_000094 | Ga0501245_000094_4239_5210 | 272 |
| 24 | 3300049775 | Ga0501279_000004 | Ga0501279_000004_7575_8546 | 272 |
| 25 | 3300049776 | Ga0501280_000052 | Ga0501280_000052_14682_15650 | 272 |
| 26 | 3300049778 | Ga0501282_000448 | Ga0501282_000448_1582_2553 | 272 |
| 27 | 3300050510 | nmdc:mga06r32_62768_c1 | nmdc:mga06r32_62768_c1_342_1265 | 272 |
| 28 | 3300031995 | Ga0307409_100051618 | Ga0307409_1000516184 | 273 |
| 29 | 3300013297 | Ga0157378_10192935 | Ga0157378_101929352 | 274 |
| 30 | 3300005548 | Ga0070665_100531964 | Ga0070665_1005319641 | 275 |
| 31 | 3300028379 | Ga0268266_10514137 | Ga0268266_105141372 | 275 |
| 32 | 3300005843 | Ga0068860_100139575 | Ga0068860_1001395752 | 276 |
| 33 | 3300028381 | Ga0268264_10069255 | Ga0268264_100692552 | 276 |
| 34 | 3300031911 | Ga0307412_10126865 | Ga0307412_101268652 | 276 |
| 35 | 3300044842 | Ga0466957_0053703 | Ga0466957_0053703_680_1606 | 276 |
| 36 | 3300046684 | Ga0495669_0011512 | Ga0495669_0011512_238_1176 | 276 |
| 37 | 3300011119 | Ga0105246_10099425 | Ga0105246_100994251 | 277 |
| 38 | 3300028794 | Ga0307515_10313652 | Ga0307515_103136521 | 277 |
| 39 | 3300044694 | Ga0466963_0138165 | Ga0466963_0138165_548_1474 | 277 |
| 40 | 3300044842 | Ga0466957_0002469 | Ga0466957_0002469_3778_4716 | 277 |
| 41 | 3300045836 | Ga0466958_0000506 | Ga0466958_0000506_11235_12173 | 277 |
| 42 | 3300045976 | Ga0466967_0122115 | Ga0466967_0122115_497_1423 | 277 |
| 43 | 3300049779 | Ga0501283_001414 | Ga0501283_001414_1145_2116 | 277 |
| 44 | 3300061719 | Ga0466962_0014837 | Ga0466962_0014837_2297_3235 | 277 |
| 45 | 3300031852 | Ga0307410_10001680 | Ga0307410_100016807 | 278 |
| 46 | 3300031548 | Ga0307408_100009963 | Ga0307408_1000099635 | 279 |
| 47 | 3300009148 | Ga0105243_10121626 | Ga0105243_101216262 | 281 |
| 48 | 3300005338 | Ga0068868_100012162 | Ga0068868_1000121628 | 282 |
| 49 | 3300005354 | Ga0070675_100142739 | Ga0070675_1001427392 | 282 |
| 50 | 3300005367 | Ga0070667_100074000 | Ga0070667_1000740004 | 282 |
| 51 | 3300005545 | Ga0070695_100089243 | Ga0070695_1000892432 | 282 |
| 52 | 3300005577 | Ga0068857_100120729 | Ga0068857_1001207292 | 282 |
| 53 | 3300005617 | Ga0068859_100165200 | Ga0068859_1001652003 | 282 |
| 54 | 3300005841 | Ga0068863_100076125 | Ga0068863_1000761255 | 282 |
| 55 | 3300005842 | Ga0068858_100001826 | Ga0068858_10000182616 | 282 |
| 56 | 3300005843 | Ga0068860_100402921 | Ga0068860_1004029212 | 282 |
| 57 | 3300005844 | Ga0068862_100168947 | Ga0068862_1001689472 | 282 |
| 58 | 3300005844 | Ga0068862_100510388 | Ga0068862_1005103881 | 282 |
| 59 | 3300006852 | Ga0075433_10014104 | Ga0075433_100141045 | 282 |
| 60 | 3300006871 | Ga0075434_100715366 | Ga0075434_1007153662 | 282 |
| 61 | 3300006931 | Ga0097620_100165205 | Ga0097620_1001652052 | 282 |
| 62 | 3300009148 | Ga0105243_10192522 | Ga0105243_101925222 | 282 |
| 63 | 3300009174 | Ga0105241_10118518 | Ga0105241_101185182 | 282 |
| 64 | 3300013308 | Ga0157375_10264587 | Ga0157375_102645872 | 282 |
| 65 | 3300025927 | Ga0207687_10000473 | Ga0207687_100004736 | 282 |
| 66 | 3300025927 | Ga0207687_10200344 | Ga0207687_102003442 | 282 |
| 67 | 3300025933 | Ga0207706_10353785 | Ga0207706_103537852 | 282 |
| 68 | 3300025934 | Ga0207686_10100883 | Ga0207686_101008832 | 282 |
| 69 | 3300025935 | Ga0207709_10136150 | Ga0207709_101361502 | 282 |
| 70 | 3300025942 | Ga0207689_10026313 | Ga0207689_100263135 | 282 |
| 71 | 3300025945 | Ga0207679_10260474 | Ga0207679_102604742 | 282 |
| 72 | 3300025986 | Ga0207658_10063735 | Ga0207658_100637352 | 282 |
| 73 | 3300026035 | Ga0207703_10000974 | Ga0207703_100009747 | 282 |
| 74 | 3300026088 | Ga0207641_10102376 | Ga0207641_101023762 | 282 |
| 75 | 3300026095 | Ga0207676_10245491 | Ga0207676_102454912 | 282 |
| 76 | 3300026116 | Ga0207674_10112180 | Ga0207674_101121802 | 282 |
| 77 | 3300028380 | Ga0268265_10014584 | Ga0268265_100145841 | 282 |
| 78 | 3300028380 | Ga0268265_10280166 | Ga0268265_102801662 | 282 |
| 79 | 3300050515 | nmdc:mga0a205_8452_c1 | nmdc:mga0a205_8452_c1_5827_6744 | 282 |
| 80 | 3300014326 | Ga0157380_10026069 | Ga0157380_100260692 | 283 |
| 81 | 3300005295 | Ga0065707_10187989 | Ga0065707_101879892 | 289 |
| 82 | 3300031616 | Ga0307508_10003647 | Ga0307508_100036472 | 289 |
| 83 | 3300046557 | Ga0495622_0053575 | Ga0495622_0053575_616_1542 | 289 |
| 84 | 3300005457 | Ga0070662_100155823 | Ga0070662_1001558232 | 290 |
| 85 | 3300005548 | Ga0070665_100019092 | Ga0070665_1000190924 | 290 |
| 86 | 3300005614 | Ga0068856_100318087 | Ga0068856_1003180872 | 290 |
| 87 | 3300005617 | Ga0068859_100173686 | Ga0068859_1001736861 | 290 |
| 88 | 3300006931 | Ga0097620_100173689 | Ga0097620_1001736891 | 290 |
| 89 | 3300009174 | Ga0105241_10130783 | Ga0105241_101307832 | 290 |
| 90 | 3300009177 | Ga0105248_10000416 | Ga0105248_1000041628 | 290 |
| 91 | 3300013102 | Ga0157371_10003313 | Ga0157371_100033132 | 290 |
| 92 | 3300014325 | Ga0163163_10001818 | Ga0163163_1000181813 | 290 |
| 93 | 3300014968 | Ga0157379_10034021 | Ga0157379_100340215 | 290 |
| 94 | 3300025925 | Ga0207650_10311402 | Ga0207650_103114022 | 290 |
| 95 | 3300025940 | Ga0207691_10085676 | Ga0207691_100856761 | 290 |
| 96 | 3300025945 | Ga0207679_10364554 | Ga0207679_103645542 | 290 |
| 97 | 3300031731 | Ga0307405_10320050 | Ga0307405_103200502 | 290 |
| 98 | 3300031824 | Ga0307413_10220035 | Ga0307413_102200352 | 290 |
| 99 | 3300031901 | Ga0307406_10056920 | Ga0307406_100569204 | 290 |
| 100 | 3300031911 | Ga0307412_10039765 | Ga0307412_100397652 | 290 |
| 101 | 3300031995 | Ga0307409_100096176 | Ga0307409_1000961764 | 290 |
| 102 | 3300032005 | Ga0307411_10378487 | Ga0307411_103784872 | 290 |
| 103 | 3300032126 | Ga0307415_100019776 | Ga0307415_1000197762 | 290 |
| 104 | 3300035085 | Ga0373929_0022189 | Ga0373929_0022189_389_1261 | 290 |
| 105 | 3300035207 | Ga0373942_0014208 | Ga0373942_0014208_456_1328 | 290 |
| 106 | iso_pu_bacteria | 2993356040 | 2993356161 | 290 |
| 107 | 3300005543 | Ga0070672_100228970 | Ga0070672_1002289702 | 291 |
| 108 | 3300005834 | Ga0068851_10009273 | Ga0068851_100092735 | 291 |
| 109 | 3300005844 | Ga0068862_100024686 | Ga0068862_1000246866 | 291 |
| 110 | 3300009551 | Ga0105238_10227595 | Ga0105238_102275951 | 291 |
| 111 | 3300013100 | Ga0157373_10313498 | Ga0157373_103134982 | 291 |
| 112 | 3300025321 | Ga0207656_10004954 | Ga0207656_100049545 | 291 |
| 113 | 3300026116 | Ga0207674_10013457 | Ga0207674_1001345711 | 291 |
| 114 | 3300037471 | Ga0395905_0380202 | Ga0395905_0380202_156_1079 | 291 |
| 115 | 3300044694 | Ga0466963_0216413 | Ga0466963_0216413_49_984 | 291 |
| 116 | 3300048910 | Ga0496107_0052549 | Ga0496107_0052549_267_1202 | 291 |
| 117 | 3300001989 | JGI24739J22299_10006708 | JGI24739J22299_100067083 | 292 |
| 118 | 3300001990 | JGI24737J22298_10002015 | JGI24737J22298_100020155 | 292 |
| 119 | 3300002067 | JGI24735J21928_10005958 | JGI24735J21928_100059585 | 292 |
| 120 | 3300002075 | JGI24738J21930_10000573 | JGI24738J21930_100005739 | 292 |
| 121 | 3300002459 | JGI24751J29686_10012503 | JGI24751J29686_100125031 | 292 |
| 122 | 3300005293 | Ga0065715_10000657 | Ga0065715_100006577 | 292 |
| 123 | 3300005327 | Ga0070658_10000171 | Ga0070658_1000017136 | 292 |
| 124 | 3300005327 | Ga0070658_10033779 | Ga0070658_100337794 | 292 |
| 125 | 3300005327 | Ga0070658_10087297 | Ga0070658_100872972 | 292 |
| 126 | 3300005327 | Ga0070658_10100876 | Ga0070658_101008762 | 292 |
| 127 | 3300005327 | Ga0070658_10158512 | Ga0070658_101585122 | 292 |
| 128 | 3300005327 | Ga0070658_10199594 | Ga0070658_101995942 | 292 |
| 129 | 3300005328 | Ga0070676_10010325 | Ga0070676_100103252 | 292 |
| 130 | 3300005329 | Ga0070683_100000608 | Ga0070683_10000060813 | 292 |
| 131 | 3300005329 | Ga0070683_100007839 | Ga0070683_1000078398 | 292 |
| 132 | 3300005331 | Ga0070670_100003856 | Ga0070670_1000038566 | 292 |
| 133 | 3300005331 | Ga0070670_100006052 | Ga0070670_1000060529 | 292 |
| 134 | 3300005331 | Ga0070670_100114834 | Ga0070670_1001148342 | 292 |
| 135 | 3300005333 | Ga0070677_10023631 | Ga0070677_100236312 | 292 |
| 136 | 3300005333 | Ga0070677_10047636 | Ga0070677_100476362 | 292 |
| 137 | 3300005333 | Ga0070677_10072970 | Ga0070677_100729702 | 292 |
| 138 | 3300005334 | Ga0068869_100022765 | Ga0068869_1000227651 | 292 |
| 139 | 3300005334 | Ga0068869_100211196 | Ga0068869_1002111962 | 292 |
| 140 | 3300005335 | Ga0070666_10001125 | Ga0070666_100011258 | 292 |
| 141 | 3300005335 | Ga0070666_10114778 | Ga0070666_101147782 | 292 |
| 142 | 3300005336 | Ga0070680_100017399 | Ga0070680_1000173998 | 292 |
| 143 | 3300005338 | Ga0068868_100164845 | Ga0068868_1001648452 | 292 |
| 144 | 3300005338 | Ga0068868_100407658 | Ga0068868_1004076581 | 292 |
| 145 | 3300005339 | Ga0070660_100000134 | Ga0070660_10000013424 | 292 |
| 146 | 3300005339 | Ga0070660_100254911 | Ga0070660_1002549111 | 292 |
| 147 | 3300005345 | Ga0070692_10014989 | Ga0070692_100149895 | 292 |
| 148 | 3300005347 | Ga0070668_100011424 | Ga0070668_1000114246 | 292 |
| 149 | 3300005347 | Ga0070668_100013414 | Ga0070668_1000134142 | 292 |
| 150 | 3300005347 | Ga0070668_100131808 | Ga0070668_1001318082 | 292 |
| 151 | 3300005353 | Ga0070669_100000722 | Ga0070669_10000072231 | 292 |
| 152 | 3300005353 | Ga0070669_100040561 | Ga0070669_1000405612 | 292 |
| 153 | 3300005353 | Ga0070669_100043918 | Ga0070669_1000439182 | 292 |
| 154 | 3300005353 | Ga0070669_100099686 | Ga0070669_1000996862 | 292 |
| 155 | 3300005353 | Ga0070669_100184063 | Ga0070669_1001840632 | 292 |
| 156 | 3300005354 | Ga0070675_100001154 | Ga0070675_10000115416 | 292 |
| 157 | 3300005354 | Ga0070675_100006153 | Ga0070675_1000061537 | 292 |
| 158 | 3300005354 | Ga0070675_100017077 | Ga0070675_1000170774 | 292 |
| 159 | 3300005355 | Ga0070671_100004634 | Ga0070671_1000046347 | 292 |
| 160 | 3300005355 | Ga0070671_100018188 | Ga0070671_1000181882 | 292 |
| 161 | 3300005355 | Ga0070671_100267356 | Ga0070671_1002673562 | 292 |
| 162 | 3300005356 | Ga0070674_100015601 | Ga0070674_1000156012 | 292 |
| 163 | 3300005356 | Ga0070674_100098294 | Ga0070674_1000982942 | 292 |
| 164 | 3300005364 | Ga0070673_100129541 | Ga0070673_1001295412 | 292 |
| 165 | 3300005366 | Ga0070659_100000067 | Ga0070659_10000006724 | 292 |
| 166 | 3300005366 | Ga0070659_100003069 | Ga0070659_1000030695 | 292 |
| 167 | 3300005366 | Ga0070659_100003694 | Ga0070659_1000036942 | 292 |
| 168 | 3300005366 | Ga0070659_100011112 | Ga0070659_1000111127 | 292 |
| 169 | 3300005366 | Ga0070659_100021627 | Ga0070659_1000216278 | 292 |
| 170 | 3300005366 | Ga0070659_100049919 | Ga0070659_1000499195 | 292 |
| 171 | 3300005366 | Ga0070659_100066382 | Ga0070659_1000663822 | 292 |
| 172 | 3300005367 | Ga0070667_100002206 | Ga0070667_1000022068 | 292 |
| 173 | 3300005367 | Ga0070667_100002611 | Ga0070667_10000261116 | 292 |
| 174 | 3300005367 | Ga0070667_100034609 | Ga0070667_1000346092 | 292 |
| 175 | 3300005367 | Ga0070667_100044663 | Ga0070667_1000446635 | 292 |
| 176 | 3300005435 | Ga0070714_100006574 | Ga0070714_1000065749 | 292 |
| 177 | 3300005435 | Ga0070714_100008901 | Ga0070714_1000089012 | 292 |
| 178 | 3300005441 | Ga0070700_100025242 | Ga0070700_1000252422 | 292 |
| 179 | 3300005444 | Ga0070694_100043673 | Ga0070694_1000436732 | 292 |
| 180 | 3300005455 | Ga0070663_100000671 | Ga0070663_1000006712 | 292 |
| 181 | 3300005455 | Ga0070663_100021761 | Ga0070663_1000217616 | 292 |
| 182 | 3300005456 | Ga0070678_100017303 | Ga0070678_1000173032 | 292 |
| 183 | 3300005456 | Ga0070678_100174356 | Ga0070678_1001743562 | 292 |
| 184 | 3300005456 | Ga0070678_100291627 | Ga0070678_1002916272 | 292 |
| 185 | 3300005457 | Ga0070662_100000250 | Ga0070662_10000025024 | 292 |
| 186 | 3300005457 | Ga0070662_100000873 | Ga0070662_1000008733 | 292 |
| 187 | 3300005457 | Ga0070662_100008790 | Ga0070662_1000087903 | 292 |
| 188 | 3300005457 | Ga0070662_100009066 | Ga0070662_1000090665 | 292 |
| 189 | 3300005457 | Ga0070662_100165610 | Ga0070662_1001656102 | 292 |
| 190 | 3300005457 | Ga0070662_100204277 | Ga0070662_1002042772 | 292 |
| 191 | 3300005459 | Ga0068867_100027613 | Ga0068867_1000276135 | 292 |
| 192 | 3300005459 | Ga0068867_100072236 | Ga0068867_1000722362 | 292 |
| 193 | 3300005459 | Ga0068867_100432471 | Ga0068867_1004324712 | 292 |
| 194 | 3300005530 | Ga0070679_100171474 | Ga0070679_1001714742 | 292 |
| 195 | 3300005539 | Ga0068853_100000366 | Ga0068853_10000036617 | 292 |
| 196 | 3300005539 | Ga0068853_100040983 | Ga0068853_1000409833 | 292 |
| 197 | 3300005539 | Ga0068853_100113071 | Ga0068853_1001130713 | 292 |
| 198 | 3300005539 | Ga0068853_100149091 | Ga0068853_1001490912 | 292 |
| 199 | 3300005539 | Ga0068853_100152170 | Ga0068853_1001521702 | 292 |
| 200 | 3300005543 | Ga0070672_100001931 | Ga0070672_1000019312 | 292 |
| 201 | 3300005543 | Ga0070672_100041672 | Ga0070672_1000416724 | 292 |
| 202 | 3300005543 | Ga0070672_100296593 | Ga0070672_1002965932 | 292 |
| 203 | 3300005546 | Ga0070696_100065949 | Ga0070696_1000659492 | 292 |
| 204 | 3300005547 | Ga0070693_100128311 | Ga0070693_1001283112 | 292 |
| 205 | 3300005548 | Ga0070665_100003424 | Ga0070665_1000034248 | 292 |
| 206 | 3300005563 | Ga0068855_100000434 | Ga0068855_10000043448 | 292 |
| 207 | 3300005563 | Ga0068855_100204717 | Ga0068855_1002047172 | 292 |
| 208 | 3300005564 | Ga0070664_100000170 | Ga0070664_10000017013 | 292 |
| 209 | 3300005564 | Ga0070664_100004225 | Ga0070664_1000042259 | 292 |
| 210 | 3300005564 | Ga0070664_100032810 | Ga0070664_1000328104 | 292 |
| 211 | 3300005564 | Ga0070664_100118384 | Ga0070664_1001183841 | 292 |
| 212 | 3300005577 | Ga0068857_100002151 | Ga0068857_1000021512 | 292 |
| 213 | 3300005577 | Ga0068857_100057883 | Ga0068857_1000578834 | 292 |
| 214 | 3300005577 | Ga0068857_100207471 | Ga0068857_1002074712 | 292 |
| 215 | 3300005577 | Ga0068857_100307635 | Ga0068857_1003076351 | 292 |
| 216 | 3300005577 | Ga0068857_100429180 | Ga0068857_1004291802 | 292 |
| 217 | 3300005578 | Ga0068854_100200748 | Ga0068854_1002007482 | 292 |
| 218 | 3300005614 | Ga0068856_100000793 | Ga0068856_10000079325 | 292 |
| 219 | 3300005616 | Ga0068852_100000251 | Ga0068852_10000025122 | 292 |
| 220 | 3300005616 | Ga0068852_100036355 | Ga0068852_1000363552 | 292 |
| 221 | 3300005616 | Ga0068852_100069958 | Ga0068852_1000699582 | 292 |
| 222 | 3300005616 | Ga0068852_100288877 | Ga0068852_1002888772 | 292 |
| 223 | 3300005616 | Ga0068852_100317568 | Ga0068852_1003175682 | 292 |
| 224 | 3300005617 | Ga0068859_100000136 | Ga0068859_10000013619 | 292 |
| 225 | 3300005617 | Ga0068859_100014991 | Ga0068859_1000149912 | 292 |
| 226 | 3300005617 | Ga0068859_100034799 | Ga0068859_1000347995 | 292 |
| 227 | 3300005617 | Ga0068859_100101739 | Ga0068859_1001017391 | 292 |
| 228 | 3300005618 | Ga0068864_100000651 | Ga0068864_1000006516 | 292 |
| 229 | 3300005618 | Ga0068864_100019582 | Ga0068864_1000195827 | 292 |
| 230 | 3300005618 | Ga0068864_100091745 | Ga0068864_1000917452 | 292 |
| 231 | 3300005618 | Ga0068864_100290563 | Ga0068864_1002905632 | 292 |
| 232 | 3300005719 | Ga0068861_100013259 | Ga0068861_1000132597 | 292 |
| 233 | 3300005719 | Ga0068861_100233189 | Ga0068861_1002331892 | 292 |
| 234 | 3300005834 | Ga0068851_10021086 | Ga0068851_100210864 | 292 |
| 235 | 3300005841 | Ga0068863_100000140 | Ga0068863_10000014021 | 292 |
| 236 | 3300005841 | Ga0068863_100013399 | Ga0068863_1000133998 | 292 |
| 237 | 3300005841 | Ga0068863_100044783 | Ga0068863_1000447835 | 292 |
| 238 | 3300005842 | Ga0068858_100005794 | Ga0068858_10000579411 | 292 |
| 239 | 3300005842 | Ga0068858_100093113 | Ga0068858_1000931132 | 292 |
| 240 | 3300005843 | Ga0068860_100004881 | Ga0068860_1000048818 | 292 |
| 241 | 3300005843 | Ga0068860_100008260 | Ga0068860_1000082602 | 292 |
| 242 | 3300005843 | Ga0068860_100229309 | Ga0068860_1002293091 | 292 |
| 243 | 3300005843 | Ga0068860_100253882 | Ga0068860_1002538822 | 292 |
| 244 | 3300005843 | Ga0068860_100386567 | Ga0068860_1003865672 | 292 |
| 245 | 3300005844 | Ga0068862_100003397 | Ga0068862_10000339712 | 292 |
| 246 | 3300005844 | Ga0068862_100070567 | Ga0068862_1000705673 | 292 |
| 247 | 3300005844 | Ga0068862_100078937 | Ga0068862_1000789375 | 292 |
| 248 | 3300005844 | Ga0068862_100090625 | Ga0068862_1000906252 | 292 |
| 249 | 3300005844 | Ga0068862_100220672 | Ga0068862_1002206722 | 292 |
| 250 | 3300006237 | Ga0097621_100429396 | Ga0097621_1004293962 | 292 |
| 251 | 3300006358 | Ga0068871_100084047 | Ga0068871_1000840472 | 292 |
| 252 | 3300006358 | Ga0068871_100170166 | Ga0068871_1001701662 | 292 |
| 253 | 3300006881 | Ga0068865_100055117 | Ga0068865_1000551172 | 292 |
| 254 | 3300006931 | Ga0097620_100000136 | Ga0097620_10000013619 | 292 |
| 255 | 3300006931 | Ga0097620_100014992 | Ga0097620_1000149922 | 292 |
| 256 | 3300006931 | Ga0097620_100034798 | Ga0097620_1000347983 | 292 |
| 257 | 3300006931 | Ga0097620_100101742 | Ga0097620_1001017424 | 292 |
| 258 | 3300009092 | Ga0105250_10006154 | Ga0105250_100061545 | 292 |
| 259 | 3300009093 | Ga0105240_10200961 | Ga0105240_102009612 | 292 |
| 260 | 3300009094 | Ga0111539_10016465 | Ga0111539_100164655 | 292 |
| 261 | 3300009094 | Ga0111539_10087692 | Ga0111539_100876922 | 292 |
| 262 | 3300009094 | Ga0111539_10359989 | Ga0111539_103599892 | 292 |
| 263 | 3300009177 | Ga0105248_10001074 | Ga0105248_1000107413 | 292 |
| 264 | 3300009177 | Ga0105248_10010278 | Ga0105248_100102782 | 292 |
| 265 | 3300009177 | Ga0105248_10010640 | Ga0105248_100106408 | 292 |
| 266 | 3300009177 | Ga0105248_10057097 | Ga0105248_100570975 | 292 |
| 267 | 3300009177 | Ga0105248_10233303 | Ga0105248_102333032 | 292 |
| 268 | 3300009551 | Ga0105238_10004794 | Ga0105238_100047942 | 292 |
| 269 | 3300009551 | Ga0105238_10198701 | Ga0105238_101987012 | 292 |
| 270 | 3300009553 | Ga0105249_10047155 | Ga0105249_100471552 | 292 |
| 271 | 3300009553 | Ga0105249_10085168 | Ga0105249_100851682 | 292 |
| 272 | 3300013100 | Ga0157373_10056276 | Ga0157373_100562763 | 292 |
| 273 | 3300013100 | Ga0157373_10162735 | Ga0157373_101627352 | 292 |
| 274 | 3300013102 | Ga0157371_10018061 | Ga0157371_100180612 | 292 |
| 275 | 3300013102 | Ga0157371_10337980 | Ga0157371_103379801 | 292 |
| 276 | 3300013104 | Ga0157370_10105456 | Ga0157370_101054563 | 292 |
| 277 | 3300013104 | Ga0157370_10143116 | Ga0157370_101431162 | 292 |
| 278 | 3300013104 | Ga0157370_10261271 | Ga0157370_102612711 | 292 |
| 279 | 3300013105 | Ga0157369_10002615 | Ga0157369_100026155 | 292 |
| 280 | 3300013105 | Ga0157369_10017149 | Ga0157369_100171492 | 292 |
| 281 | 3300013105 | Ga0157369_10162445 | Ga0157369_101624452 | 292 |
| 282 | 3300013306 | Ga0163162_10014337 | Ga0163162_100143372 | 292 |
| 283 | 3300013307 | Ga0157372_10002970 | Ga0157372_1000297016 | 292 |
| 284 | 3300013308 | Ga0157375_10057975 | Ga0157375_100579755 | 292 |
| 285 | 3300013308 | Ga0157375_10205807 | Ga0157375_102058072 | 292 |
| 286 | 3300013308 | Ga0157375_10619148 | Ga0157375_106191481 | 292 |
| 287 | 3300014325 | Ga0163163_10001010 | Ga0163163_1000101010 | 292 |
| 288 | 3300014325 | Ga0163163_10029780 | Ga0163163_100297805 | 292 |
| 289 | 3300014326 | Ga0157380_10011701 | Ga0157380_100117012 | 292 |
| 290 | 3300014326 | Ga0157380_10052391 | Ga0157380_100523912 | 292 |
| 291 | 3300014968 | Ga0157379_10005135 | Ga0157379_1000513513 | 292 |
| 292 | 3300017792 | Ga0163161_10083730 | Ga0163161_100837302 | 292 |
| 293 | 3300017792 | Ga0163161_10118315 | Ga0163161_101183152 | 292 |
| 294 | 3300025315 | Ga0207697_10004622 | Ga0207697_100046223 | 292 |
| 295 | 3300025321 | Ga0207656_10010956 | Ga0207656_100109565 | 292 |
| 296 | 3300025893 | Ga0207682_10000527 | Ga0207682_100005272 | 292 |
| 297 | 3300025893 | Ga0207682_10010107 | Ga0207682_100101072 | 292 |
| 298 | 3300025901 | Ga0207688_10010292 | Ga0207688_100102922 | 292 |
| 299 | 3300025901 | Ga0207688_10060488 | Ga0207688_100604882 | 292 |
| 300 | 3300025901 | Ga0207688_10178850 | Ga0207688_101788502 | 292 |
| 301 | 3300025904 | Ga0207647_10024741 | Ga0207647_100247412 | 292 |
| 302 | 3300025904 | Ga0207647_10072117 | Ga0207647_100721172 | 292 |
| 303 | 3300025907 | Ga0207645_10141728 | Ga0207645_101417282 | 292 |
| 304 | 3300025907 | Ga0207645_10142611 | Ga0207645_101426112 | 292 |
| 305 | 3300025907 | Ga0207645_10198911 | Ga0207645_101989112 | 292 |
| 306 | 3300025909 | Ga0207705_10000212 | Ga0207705_1000021237 | 292 |
| 307 | 3300025909 | Ga0207705_10012187 | Ga0207705_100121873 | 292 |
| 308 | 3300025909 | Ga0207705_10013882 | Ga0207705_100138827 | 292 |
| 309 | 3300025909 | Ga0207705_10026828 | Ga0207705_100268283 | 292 |
| 310 | 3300025913 | Ga0207695_10316623 | Ga0207695_103166232 | 292 |
| 311 | 3300025917 | Ga0207660_10009002 | Ga0207660_100090025 | 292 |
| 312 | 3300025917 | Ga0207660_10285476 | Ga0207660_102854762 | 292 |
| 313 | 3300025919 | Ga0207657_10000638 | Ga0207657_1000063824 | 292 |
| 314 | 3300025919 | Ga0207657_10007988 | Ga0207657_1000798810 | 292 |
| 315 | 3300025919 | Ga0207657_10111679 | Ga0207657_101116792 | 292 |
| 316 | 3300025919 | Ga0207657_10165519 | Ga0207657_101655192 | 292 |
| 317 | 3300025920 | Ga0207649_10000304 | Ga0207649_1000030425 | 292 |
| 318 | 3300025920 | Ga0207649_10029557 | Ga0207649_100295572 | 292 |
| 319 | 3300025921 | Ga0207652_10112754 | Ga0207652_101127542 | 292 |
| 320 | 3300025923 | Ga0207681_10002811 | Ga0207681_1000281110 | 292 |
| 321 | 3300025923 | Ga0207681_10027816 | Ga0207681_100278164 | 292 |
| 322 | 3300025923 | Ga0207681_10036269 | Ga0207681_100362692 | 292 |
| 323 | 3300025923 | Ga0207681_10157473 | Ga0207681_101574731 | 292 |
| 324 | 3300025923 | Ga0207681_10193124 | Ga0207681_101931242 | 292 |
| 325 | 3300025923 | Ga0207681_10306939 | Ga0207681_103069392 | 292 |
| 326 | 3300025924 | Ga0207694_10020412 | Ga0207694_100204128 | 292 |
| 327 | 3300025924 | Ga0207694_10200087 | Ga0207694_102000872 | 292 |
| 328 | 3300025925 | Ga0207650_10002625 | Ga0207650_100026258 | 292 |
| 329 | 3300025925 | Ga0207650_10008254 | Ga0207650_100082548 | 292 |
| 330 | 3300025925 | Ga0207650_10011146 | Ga0207650_100111467 | 292 |
| 331 | 3300025925 | Ga0207650_10018464 | Ga0207650_100184646 | 292 |
| 332 | 3300025925 | Ga0207650_10021270 | Ga0207650_100212702 | 292 |
| 333 | 3300025926 | Ga0207659_10000877 | Ga0207659_100008779 | 292 |
| 334 | 3300025926 | Ga0207659_10036003 | Ga0207659_100360035 | 292 |
| 335 | 3300025926 | Ga0207659_10114456 | Ga0207659_101144561 | 292 |
| 336 | 3300025929 | Ga0207664_10006488 | Ga0207664_100064888 | 292 |
| 337 | 3300025929 | Ga0207664_10007948 | Ga0207664_1000794811 | 292 |
| 338 | 3300025931 | Ga0207644_10001989 | Ga0207644_100019899 | 292 |
| 339 | 3300025931 | Ga0207644_10011810 | Ga0207644_100118106 | 292 |
| 340 | 3300025931 | Ga0207644_10018897 | Ga0207644_100188975 | 292 |
| 341 | 3300025931 | Ga0207644_10028914 | Ga0207644_100289142 | 292 |
| 342 | 3300025931 | Ga0207644_10031819 | Ga0207644_100318193 | 292 |
| 343 | 3300025932 | Ga0207690_10000264 | Ga0207690_1000026418 | 292 |
| 344 | 3300025932 | Ga0207690_10069941 | Ga0207690_100699412 | 292 |
| 345 | 3300025933 | Ga0207706_10000639 | Ga0207706_1000063924 | 292 |
| 346 | 3300025933 | Ga0207706_10001215 | Ga0207706_1000121519 | 292 |
| 347 | 3300025933 | Ga0207706_10008348 | Ga0207706_100083487 | 292 |
| 348 | 3300025933 | Ga0207706_10021226 | Ga0207706_100212263 | 292 |
| 349 | 3300025933 | Ga0207706_10099314 | Ga0207706_100993142 | 292 |
| 350 | 3300025933 | Ga0207706_10309549 | Ga0207706_103095492 | 292 |
| 351 | 3300025934 | Ga0207686_10123039 | Ga0207686_101230392 | 292 |
| 352 | 3300025937 | Ga0207669_10008218 | Ga0207669_100082183 | 292 |
| 353 | 3300025938 | Ga0207704_10202735 | Ga0207704_102027352 | 292 |
| 354 | 3300025940 | Ga0207691_10000878 | Ga0207691_100008783 | 292 |
| 355 | 3300025940 | Ga0207691_10010146 | Ga0207691_100101468 | 292 |
| 356 | 3300025940 | Ga0207691_10123357 | Ga0207691_101233572 | 292 |
| 357 | 3300025941 | Ga0207711_10000105 | Ga0207711_1000010513 | 292 |
| 358 | 3300025941 | Ga0207711_10001216 | Ga0207711_1000121610 | 292 |
| 359 | 3300025941 | Ga0207711_10006500 | Ga0207711_100065004 | 292 |
| 360 | 3300025941 | Ga0207711_10019212 | Ga0207711_100192126 | 292 |
| 361 | 3300025941 | Ga0207711_10075817 | Ga0207711_100758173 | 292 |
| 362 | 3300025942 | Ga0207689_10199171 | Ga0207689_101991712 | 292 |
| 363 | 3300025942 | Ga0207689_10264803 | Ga0207689_102648032 | 292 |
| 364 | 3300025944 | Ga0207661_10001647 | Ga0207661_100016475 | 292 |
| 365 | 3300025944 | Ga0207661_10009350 | Ga0207661_100093509 | 292 |
| 366 | 3300025944 | Ga0207661_10264956 | Ga0207661_102649562 | 292 |
| 367 | 3300025945 | Ga0207679_10000191 | Ga0207679_1000019153 | 292 |
| 368 | 3300025945 | Ga0207679_10002027 | Ga0207679_1000202710 | 292 |
| 369 | 3300025945 | Ga0207679_10033400 | Ga0207679_100334002 | 292 |
| 370 | 3300025945 | Ga0207679_10095670 | Ga0207679_100956701 | 292 |
| 371 | 3300025945 | Ga0207679_10310641 | Ga0207679_103106412 | 292 |
| 372 | 3300025949 | Ga0207667_10001227 | Ga0207667_1000122711 | 292 |
| 373 | 3300025949 | Ga0207667_10070885 | Ga0207667_100708854 | 292 |
| 374 | 3300025960 | Ga0207651_10007231 | Ga0207651_100072318 | 292 |
| 375 | 3300025960 | Ga0207651_10062498 | Ga0207651_100624982 | 292 |
| 376 | 3300025960 | Ga0207651_10126433 | Ga0207651_101264332 | 292 |
| 377 | 3300025960 | Ga0207651_10155666 | Ga0207651_101556662 | 292 |
| 378 | 3300025961 | Ga0207712_10013271 | Ga0207712_100132715 | 292 |
| 379 | 3300025961 | Ga0207712_10034390 | Ga0207712_100343902 | 292 |
| 380 | 3300025972 | Ga0207668_10493337 | Ga0207668_104933372 | 292 |
| 381 | 3300025981 | Ga0207640_10061806 | Ga0207640_100618062 | 292 |
| 382 | 3300025981 | Ga0207640_10208454 | Ga0207640_102084542 | 292 |
| 383 | 3300025986 | Ga0207658_10003869 | Ga0207658_100038695 | 292 |
| 384 | 3300025986 | Ga0207658_10010411 | Ga0207658_100104115 | 292 |
| 385 | 3300025986 | Ga0207658_10017239 | Ga0207658_100172398 | 292 |
| 386 | 3300025986 | Ga0207658_10189557 | Ga0207658_101895572 | 292 |
| 387 | 3300026035 | Ga0207703_10026142 | Ga0207703_100261423 | 292 |
| 388 | 3300026041 | Ga0207639_10000179 | Ga0207639_1000017943 | 292 |
| 389 | 3300026041 | Ga0207639_10002119 | Ga0207639_100021194 | 292 |
| 390 | 3300026041 | Ga0207639_10073426 | Ga0207639_100734261 | 292 |
| 391 | 3300026041 | Ga0207639_10107765 | Ga0207639_101077652 | 292 |
| 392 | 3300026041 | Ga0207639_10116685 | Ga0207639_101166852 | 292 |
| 393 | 3300026067 | Ga0207678_10002101 | Ga0207678_100021012 | 292 |
| 394 | 3300026067 | Ga0207678_10018822 | Ga0207678_100188226 | 292 |
| 395 | 3300026067 | Ga0207678_10132933 | Ga0207678_101329333 | 292 |
| 396 | 3300026075 | Ga0207708_10048527 | Ga0207708_100485274 | 292 |
| 397 | 3300026078 | Ga0207702_10000413 | Ga0207702_1000041325 | 292 |
| 398 | 3300026078 | Ga0207702_10372358 | Ga0207702_103723582 | 292 |
| 399 | 3300026088 | Ga0207641_10000172 | Ga0207641_1000017282 | 292 |
| 400 | 3300026088 | Ga0207641_10109019 | Ga0207641_101090192 | 292 |
| 401 | 3300026089 | Ga0207648_10009427 | Ga0207648_100094278 | 292 |
| 402 | 3300026089 | Ga0207648_10032670 | Ga0207648_100326702 | 292 |
| 403 | 3300026095 | Ga0207676_10002051 | Ga0207676_1000205113 | 292 |
| 404 | 3300026095 | Ga0207676_10098256 | Ga0207676_100982561 | 292 |
| 405 | 3300026095 | Ga0207676_10101102 | Ga0207676_101011022 | 292 |
| 406 | 3300026116 | Ga0207674_10006642 | Ga0207674_100066424 | 292 |
| 407 | 3300026116 | Ga0207674_10074107 | Ga0207674_100741072 | 292 |
| 408 | 3300026118 | Ga0207675_100010422 | Ga0207675_1000104227 | 292 |
| 409 | 3300026121 | Ga0207683_10012717 | Ga0207683_100127175 | 292 |
| 410 | 3300026142 | Ga0207698_10002088 | Ga0207698_1000208810 | 292 |
| 411 | 3300026142 | Ga0207698_10013588 | Ga0207698_100135886 | 292 |
| 412 | 3300026142 | Ga0207698_10025863 | Ga0207698_100258632 | 292 |
| 413 | 3300026142 | Ga0207698_10151533 | Ga0207698_101515332 | 292 |
| 414 | 3300026142 | Ga0207698_10245407 | Ga0207698_102454072 | 292 |
| 415 | 3300028379 | Ga0268266_10003318 | Ga0268266_100033188 | 292 |
| 416 | 3300028379 | Ga0268266_10367226 | Ga0268266_103672262 | 292 |
| 417 | 3300028380 | Ga0268265_10002567 | Ga0268265_100025678 | 292 |
| 418 | 3300028380 | Ga0268265_10053264 | Ga0268265_100532642 | 292 |
| 419 | 3300028380 | Ga0268265_10054823 | Ga0268265_100548233 | 292 |
| 420 | 3300028380 | Ga0268265_10074093 | Ga0268265_100740932 | 292 |
| 421 | 3300028381 | Ga0268264_10001846 | Ga0268264_1000184614 | 292 |
| 422 | 3300028381 | Ga0268264_10069881 | Ga0268264_100698812 | 292 |
| 423 | 3300031548 | Ga0307408_100371900 | Ga0307408_1003719002 | 292 |
| 424 | 3300031731 | Ga0307405_10039549 | Ga0307405_100395493 | 292 |
| 425 | 3300031731 | Ga0307405_10147199 | Ga0307405_101471992 | 292 |
| 426 | 3300031731 | Ga0307405_10235658 | Ga0307405_102356581 | 292 |
| 427 | 3300031824 | Ga0307413_10010653 | Ga0307413_100106535 | 292 |
| 428 | 3300031852 | Ga0307410_10006193 | Ga0307410_100061937 | 292 |
| 429 | 3300031852 | Ga0307410_10028784 | Ga0307410_100287841 | 292 |
| 430 | 3300031901 | Ga0307406_10119732 | Ga0307406_101197322 | 292 |
| 431 | 3300031901 | Ga0307406_10162844 | Ga0307406_101628442 | 292 |
| 432 | 3300031901 | Ga0307406_10204208 | Ga0307406_102042082 | 292 |
| 433 | 3300031901 | Ga0307406_10275826 | Ga0307406_102758262 | 292 |
| 434 | 3300031903 | Ga0307407_10007557 | Ga0307407_100075572 | 292 |
| 435 | 3300031911 | Ga0307412_10037987 | Ga0307412_100379871 | 292 |
| 436 | 3300031911 | Ga0307412_10092000 | Ga0307412_100920002 | 292 |
| 437 | 3300031995 | Ga0307409_100004691 | Ga0307409_10000469111 | 292 |
| 438 | 3300031995 | Ga0307409_100220886 | Ga0307409_1002208862 | 292 |
| 439 | 3300032002 | Ga0307416_100008568 | Ga0307416_1000085686 | 292 |
| 440 | 3300032002 | Ga0307416_100010906 | Ga0307416_1000109068 | 292 |
| 441 | 3300032002 | Ga0307416_100103781 | Ga0307416_1001037812 | 292 |
| 442 | 3300032002 | Ga0307416_100211707 | Ga0307416_1002117072 | 292 |
| 443 | 3300032002 | Ga0307416_100276593 | Ga0307416_1002765932 | 292 |
| 444 | 3300032002 | Ga0307416_100286425 | Ga0307416_1002864251 | 292 |
| 445 | 3300032002 | Ga0307416_100472651 | Ga0307416_1004726512 | 292 |
| 446 | 3300032004 | Ga0307414_10002944 | Ga0307414_100029445 | 292 |
| 447 | 3300032004 | Ga0307414_10006121 | Ga0307414_100061217 | 292 |
| 448 | 3300032004 | Ga0307414_10006145 | Ga0307414_100061454 | 292 |
| 449 | 3300032004 | Ga0307414_10116153 | Ga0307414_101161532 | 292 |
| 450 | 3300032005 | Ga0307411_10000586 | Ga0307411_100005863 | 292 |
| 451 | 3300032005 | Ga0307411_10080211 | Ga0307411_100802112 | 292 |
| 452 | 3300032005 | Ga0307411_10463512 | Ga0307411_104635121 | 292 |
| 453 | 3300032126 | Ga0307415_100043322 | Ga0307415_1000433225 | 292 |
| 454 | 3300037312 | Ga0395899_0002299 | Ga0395899_0002299_2229_3167 | 292 |
| 455 | 3300037312 | Ga0395899_0018642 | Ga0395899_0018642_3958_4881 | 292 |
| 456 | 3300037312 | Ga0395899_0114131 | Ga0395899_0114131_966_1886 | 292 |
| 457 | 3300037312 | Ga0395899_0219863 | Ga0395899_0219863_11_913 | 292 |
| 458 | 3300037418 | Ga0395900_0001884 | Ga0395900_0001884_4244_5182 | 292 |
| 459 | 3300037418 | Ga0395900_0016277 | Ga0395900_0016277_4634_5554 | 292 |
| 460 | 3300037418 | Ga0395900_0020547 | Ga0395900_0020547_887_1765 | 292 |
| 461 | 3300037418 | Ga0395900_0044846 | Ga0395900_0044846_1592_2530 | 292 |
| 462 | 3300037418 | Ga0395900_0049948 | Ga0395900_0049948_2225_3145 | 292 |
| 463 | 3300037418 | Ga0395900_0091155 | Ga0395900_0091155_2005_2928 | 292 |
| 464 | 3300037418 | Ga0395900_0123505 | Ga0395900_0123505_345_1265 | 292 |
| 465 | 3300037466 | Ga0395898_0022238 | Ga0395898_0022238_5307_6245 | 292 |
| 466 | 3300037466 | Ga0395898_0043900 | Ga0395898_0043900_935_1813 | 292 |
| 467 | 3300037466 | Ga0395898_0123767 | Ga0395898_0123767_1391_2314 | 292 |
| 468 | 3300037466 | Ga0395898_0267226 | Ga0395898_0267226_163_1101 | 292 |
| 469 | 3300037471 | Ga0395905_0000940 | Ga0395905_0000940_14204_15082 | 292 |
| 470 | 3300037471 | Ga0395905_0015335 | Ga0395905_0015335_4869_5807 | 292 |
| 471 | 3300037471 | Ga0395905_0023644 | Ga0395905_0023644_968_1888 | 292 |
| 472 | 3300037471 | Ga0395905_0031015 | Ga0395905_0031015_2633_3571 | 292 |
| 473 | 3300037471 | Ga0395905_0033319 | Ga0395905_0033319_3515_4453 | 292 |
| 474 | 3300037471 | Ga0395905_0037428 | Ga0395905_0037428_121_1047 | 292 |
| 475 | 3300037471 | Ga0395905_0053971 | Ga0395905_0053971_833_1753 | 292 |
| 476 | 3300037471 | Ga0395905_0089990 | Ga0395905_0089990_803_1786 | 292 |
| 477 | 3300037471 | Ga0395905_0139689 | Ga0395905_0139689_1294_2172 | 292 |
| 478 | 3300037471 | Ga0395905_0144989 | Ga0395905_0144989_55_933 | 292 |
| 479 | 3300037471 | Ga0395905_0256585 | Ga0395905_0256585_360_1283 | 292 |
| 480 | 3300037471 | Ga0395905_0647545 | Ga0395905_0647545_52_930 | 292 |
| 481 | 3300038443 | Ga0395901_0001289 | Ga0395901_0001289_5047_5985 | 292 |
| 482 | 3300038443 | Ga0395901_0011872 | Ga0395901_0011872_3277_4215 | 292 |
| 483 | 3300038443 | Ga0395901_0012548 | Ga0395901_0012548_3347_4267 | 292 |
| 484 | 3300038443 | Ga0395901_0037623 | Ga0395901_0037623_946_1866 | 292 |
| 485 | 3300038443 | Ga0395901_0053642 | Ga0395901_0053642_3037_3915 | 292 |
| 486 | 3300038443 | Ga0395901_0492091 | Ga0395901_0492091_204_1082 | 292 |
| 487 | 3300042120 | Ga0450917_001103 | Ga0450917_001103_339_1262 | 292 |
| 488 | 3300042144 | Ga0450889_003880 | Ga0450889_003880_128_1051 | 292 |
| 489 | 3300044684 | Ga0466966_0000021 | Ga0466966_0000021_28421_29398 | 292 |
| 490 | 3300044693 | Ga0466961_0067351 | Ga0466961_0067351_484_1410 | 292 |
| 491 | 3300044693 | Ga0466961_0088698 | Ga0466961_0088698_907_1833 | 292 |
| 492 | 3300044694 | Ga0466963_0016310 | Ga0466963_0016310_2811_3737 | 292 |
| 493 | 3300044842 | Ga0466957_0000196 | Ga0466957_0000196_17791_18717 | 292 |
| 494 | 3300045049 | Ga0466959_0010835 | Ga0466959_0010835_426_1352 | 292 |
| 495 | 3300045976 | Ga0466967_0003640 | Ga0466967_0003640_4366_5292 | 292 |
| 496 | 3300045976 | Ga0466967_0021699 | Ga0466967_0021699_2652_3590 | 292 |
| 497 | 3300045976 | Ga0466967_0352859 | Ga0466967_0352859_205_1143 | 292 |
| 498 | 3300046492 | Ga0495585_0010304 | Ga0495585_0010304_4003_4926 | 292 |
| 499 | 3300046525 | Ga0495663_0001608 | Ga0495663_0001608_4098_5021 | 292 |
| 500 | 3300046525 | Ga0495663_0001665 | Ga0495663_0001665_1792_2715 | 292 |
| 501 | 3300046528 | Ga0495642_0021481 | Ga0495642_0021481_532_1455 | 292 |
| 502 | 3300046537 | Ga0495598_0000355 | Ga0495598_0000355_4107_5030 | 292 |
| 503 | 3300046537 | Ga0495598_0007997 | Ga0495598_0007997_1373_2296 | 292 |
| 504 | 3300046537 | Ga0495598_0013226 | Ga0495598_0013226_524_1450 | 292 |
| 505 | 3300046539 | Ga0495621_0001079 | Ga0495621_0001079_4246_5169 | 292 |
| 506 | 3300046539 | Ga0495621_0003905 | Ga0495621_0003905_2312_3238 | 292 |
| 507 | 3300046539 | Ga0495621_0005019 | Ga0495621_0005019_657_1580 | 292 |
| 508 | 3300046539 | Ga0495621_0025089 | Ga0495621_0025089_853_1776 | 292 |
| 509 | 3300046539 | Ga0495621_0059896 | Ga0495621_0059896_180_1058 | 292 |
| 510 | 3300046558 | Ga0495633_0010639 | Ga0495633_0010639_1906_2829 | 292 |
| 511 | 3300046616 | Ga0495668_0003644 | Ga0495668_0003644_9036_9959 | 292 |
| 512 | 3300046664 | Ga0495659_0003377 | Ga0495659_0003377_2337_3260 | 292 |
| 513 | 3300046664 | Ga0495659_0005087 | Ga0495659_0005087_1101_2024 | 292 |
| 514 | 3300046664 | Ga0495659_0042444 | Ga0495659_0042444_391_1317 | 292 |
| 515 | 3300046665 | Ga0495661_0016408 | Ga0495661_0016408_2370_3293 | 292 |
| 516 | 3300046684 | Ga0495669_0000570 | Ga0495669_0000570_11122_12045 | 292 |
| 517 | 3300046684 | Ga0495669_0016808 | Ga0495669_0016808_842_1765 | 292 |
| 518 | 3300046691 | Ga0495670_0015651 | Ga0495670_0015651_1791_2714 | 292 |
| 519 | 3300046691 | Ga0495670_0028722 | Ga0495670_0028722_1558_2481 | 292 |
| 520 | 3300046691 | Ga0495670_0036816 | Ga0495670_0036816_615_1538 | 292 |
| 521 | 3300046691 | Ga0495670_0047004 | Ga0495670_0047004_979_1899 | 292 |
| 522 | 3300047445 | Ga0495677_0003145 | Ga0495677_0003145_4633_5556 | 292 |
| 523 | 3300047445 | Ga0495677_0087165 | Ga0495677_0087165_13_936 | 292 |
| 524 | 3300048903 | Ga0496100_0059744 | Ga0496100_0059744_77_955 | 292 |
| 525 | 3300048904 | Ga0496101_0011204 | Ga0496101_0011204_3333_4211 | 292 |
| 526 | 3300048904 | Ga0496101_0354588 | Ga0496101_0354588_91_1023 | 292 |
| 527 | 3300048912 | Ga0496109_0017447 | Ga0496109_0017447_5310_6233 | 292 |
| 528 | 3300048913 | Ga0496110_0002543 | Ga0496110_0002543_5614_6537 | 292 |
| 529 | 3300048914 | Ga0496111_0004244 | Ga0496111_0004244_2447_3370 | 292 |
| 530 | 3300048917 | Ga0496114_0087718 | Ga0496114_0087718_341_1219 | 292 |
| 531 | 3300050511 | nmdc:mga08y16_72472_c1 | nmdc:mga08y16_72472_c1_2407_3333 | 292 |
| 532 | 3300053134 | Ga0500658_0000585 | Ga0500658_0000585_13403_14329 | 292 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gez-assembly1.cif.gz_A | crystal structure of potassium-independent plant asparaginase | 0.9645 | 1 | 144 |
| 7qyx-assembly1.cif.gz_BBB | structure of e.coli class 2 l-asparaginase ecaiii, mutant rdm1-24 (r207a, d210s, s211t) | 0.9619 | 156 | 286 |
| 8bqo-assembly1.cif.gz_AAA | structure of e.coli class 2 l-asparaginase ecaiii, mutant m200i | 0.9619 | 1 | 145 |
| 8bkf-assembly1.cif.gz_BBB | structure of e. coli class 2 l-asparaginase ecaiii, mutant m200t (crystal m200t#o) | 0.9618 | 156 | 287 |
| 8bqo-assembly1.cif.gz_DDD | structure of e.coli class 2 l-asparaginase ecaiii, mutant m200i | 0.9616 | 156 | 286 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1k2xB00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase | 0.9627 | 156 | 287 | 3.60.20.30 |
| af_Q7L266_168_305_3.60.20.30 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase | 0.9475 | 156 | 287 | 3.60.20.30 |
| af_E7FA20_798_925_3.60.20.30 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase | 0.9449 | 156 | 284 | 3.60.20.30 |
| af_Q9VXT7_188_321_3.60.20.30 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase | 0.9425 | 156 | 287 | 3.60.20.30 |
| 1k2xB00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase | 0.9351 | 156 | 287 | 3.60.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4S2GQC2-F1-model_v4 | Isoaspartyl peptidase/L-asparaginase | 0.9766 | 179 | 264 |
GO:0016787
|
| AF-A0A4Y9RHV3-F1-model_v4 | Beta-aspartyl-peptidase | 0.9762 | 1 | 145 |
GO:0016787
|
| AF-A0A534CLU1-F1-model_v4 | Isoaspartyl peptidase/L-asparaginase | 0.9753 | 1 | 134 |
GO:0016787
|
| AF-A0A7X1K5G9-F1-model_v4 | deleted | 0.9745 | 33 | 142 |
|
| AF-A0A521W9I7-F1-model_v4 | Isoaspartyl peptidase/L-asparaginase | 0.9744 | 1 | 140 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar