F460281

General Info

Members Datasets Scaffolds Average Seq Length
532 206 531 305

Family's Representative Sequence

Representative Sequence 3300025960|Ga0207651_10007231|Ga0207651_100072318
Length 356
Sequence MAHRMSKHGWHLVIHGGAGAMRPKHGDPDHEQRAREGLRAALDDGAAVLASGGAALDAVEASVRLLEDDPCFNAGRGSVLTSEGCVELDAAIMDGATRRAGAIAGLRTTRAPVSLARKLMEQGPHVFLSGNGADQFARDAGLEQVENSWFITPERQRQLDELLEHGGFDADVKYGTVGAVAVDEHGNVAAATSTGGLTAKRWGRIGDSPLIGAGTYADDRSAAVSATGSGEYFIRAVAAHQLAERVRFGGETLQAALDGVLADIRDLGGTGGLIAVAPNGDTAWGFTTRAMYRGIANSDGRTVAIYADEDERKGSAAVIHSASCAMAARSVATKSATAARKLRLGMKCAERVTTGS

Samples

Sample ID Description Type Environment
1 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
158 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
159 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
188 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
189 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
190 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
191 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
192 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
193 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
194 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
195 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
196 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
197 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
198 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
199 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
200 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 1.5
Rhizosphere 97.37
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10006708 3300001989 Bacteria 4334
2 JGI24737J22298_10002015 3300001990 Bacteria 7257
3 JGI24735J21928_10005958 3300002067 Bacteria 4026
4 JGI24738J21930_10000573 3300002075 Bacteria 10539
5 JGI24751J29686_10012503 3300002459 Bacteria 1750
6 Ga0065715_10000657 3300005293 Bacteria 17035
7 Ga0065707_10187989 3300005295 Bacteria 1377
8 Ga0070658_10000171 3300005327 Bacteria 57017
9 Ga0070658_10033779 3300005327 Bacteria 4116
10 Ga0070658_10087297 3300005327 Bacteria 2567
11 Ga0070658_10100876 3300005327 Bacteria 2386
12 Ga0070658_10158512 3300005327 Bacteria 1898
13 Ga0070658_10199594 3300005327 Bacteria 1687
14 Ga0070676_10010325 3300005328 Bacteria 5065
15 Ga0070683_100000608 3300005329 Bacteria 25688
16 Ga0070683_100007839 3300005329 Bacteria 9042
17 Ga0070670_100003354 3300005331 Bacteria 13262
18 Ga0070670_100003856 3300005331 Bacteria 12503
19 Ga0070670_100006052 3300005331 Bacteria 10232
20 Ga0070670_100114834 3300005331 Bacteria 2321
21 Ga0070677_10023631 3300005333 Bacteria 2277
22 Ga0070677_10047636 3300005333 Bacteria 1719
23 Ga0070677_10072970 3300005333 Bacteria 1449
24 Ga0068869_100022765 3300005334 Bacteria 4321
25 Ga0068869_100211196 3300005334 Bacteria 1534
26 Ga0070666_10001125 3300005335 Bacteria 16290
27 Ga0070666_10114778 3300005335 Bacteria 1865
28 Ga0070680_100017399 3300005336 Bacteria 5669
29 Ga0068868_100012162 3300005338 Bacteria 6285
30 Ga0068868_100164845 3300005338 Bacteria 1832
31 Ga0068868_100407658 3300005338 Bacteria 1174
32 Ga0070660_100000134 3300005339 Bacteria 47105
33 Ga0070660_100254911 3300005339 Bacteria 1431
34 Ga0070692_10014989 3300005345 Bacteria 3656
35 Ga0070668_100011424 3300005347 Bacteria 6615
36 Ga0070668_100013414 3300005347 Bacteria 6116
37 Ga0070668_100131808 3300005347 Bacteria 2007
38 Ga0070669_100000722 3300005353 Bacteria 24132
39 Ga0070669_100040561 3300005353 Bacteria 3384
40 Ga0070669_100043918 3300005353 Bacteria 3256
41 Ga0070669_100099686 3300005353 Bacteria 2190
42 Ga0070669_100184063 3300005353 Bacteria 1636
43 Ga0070675_100001154 3300005354 Bacteria 19084
44 Ga0070675_100006153 3300005354 Bacteria 9198
45 Ga0070675_100017077 3300005354 Bacteria 5766
46 Ga0070675_100142739 3300005354 Bacteria 2048
47 Ga0070671_100004634 3300005355 Bacteria 10905
48 Ga0070671_100018188 3300005355 Bacteria 5706
49 Ga0070671_100267356 3300005355 Bacteria 1453
50 Ga0070674_100015601 3300005356 Bacteria 4747
51 Ga0070674_100098294 3300005356 Bacteria 2127
52 Ga0070673_100129541 3300005364 Bacteria 2115
53 Ga0070659_100000067 3300005366 Bacteria 81723
54 Ga0070659_100003069 3300005366 Bacteria 11859
55 Ga0070659_100003694 3300005366 Bacteria 10914
56 Ga0070659_100011112 3300005366 Bacteria 6651
57 Ga0070659_100021627 3300005366 Bacteria 4902
58 Ga0070659_100049919 3300005366 Bacteria 3290
59 Ga0070659_100066382 3300005366 Bacteria 2859
60 Ga0070667_100002206 3300005367 Bacteria 17134
61 Ga0070667_100002611 3300005367 Bacteria 15628
62 Ga0070667_100034609 3300005367 Bacteria 4227
63 Ga0070667_100044663 3300005367 Bacteria 3722
64 Ga0070667_100074000 3300005367 Bacteria 2906
65 Ga0070714_100006574 3300005435 Bacteria 8993
66 Ga0070714_100008901 3300005435 Bacteria 7854
67 Ga0070700_100025242 3300005441 Bacteria 3499
68 Ga0070694_100043673 3300005444 Bacteria 2998
69 Ga0070663_100000671 3300005455 Bacteria 18346
70 Ga0070663_100021761 3300005455 Bacteria 4272
71 Ga0070678_100017303 3300005456 Bacteria 4638
72 Ga0070678_100174356 3300005456 Bacteria 1754
73 Ga0070678_100291627 3300005456 Bacteria 1383
74 Ga0070662_100000250 3300005457 Bacteria 31764
75 Ga0070662_100000873 3300005457 Bacteria 18446
76 Ga0070662_100008790 3300005457 Bacteria 6588
77 Ga0070662_100009066 3300005457 Bacteria 6492
78 Ga0070662_100155823 3300005457 Bacteria 1783
79 Ga0070662_100165610 3300005457 Bacteria 1732
80 Ga0070662_100204277 3300005457 Bacteria 1569
81 Ga0068867_100027613 3300005459 Bacteria 4081
82 Ga0068867_100072236 3300005459 Bacteria 2582
83 Ga0068867_100432471 3300005459 Bacteria 1117
84 Ga0070679_100171474 3300005530 Bacteria 2142
85 Ga0068853_100000366 3300005539 Bacteria 31104
86 Ga0068853_100040983 3300005539 Bacteria 3953
87 Ga0068853_100113071 3300005539 Bacteria 2414
88 Ga0068853_100149091 3300005539 Bacteria 2104
89 Ga0068853_100152170 3300005539 Bacteria 2083
90 Ga0070672_100001931 3300005543 Bacteria 13017
91 Ga0070672_100041672 3300005543 Bacteria 3531
92 Ga0070672_100228970 3300005543 Bacteria 1561
93 Ga0070672_100296593 3300005543 Bacteria 1369
94 Ga0070695_100089243 3300005545 Bacteria 2054
95 Ga0070696_100065949 3300005546 Bacteria 2538
96 Ga0070693_100128311 3300005547 Bacteria 1582
97 Ga0070665_100003424 3300005548 Bacteria 16943
98 Ga0070665_100019092 3300005548 Bacteria 6877
99 Ga0070665_100531964 3300005548 Bacteria 1187
100 Ga0068855_100000434 3300005563 Bacteria 51855
101 Ga0068855_100204717 3300005563 Bacteria 2220
102 Ga0070664_100000170 3300005564 Bacteria 45449
103 Ga0070664_100004225 3300005564 Bacteria 11551
104 Ga0070664_100032810 3300005564 Bacteria 4345
105 Ga0070664_100118384 3300005564 Bacteria 2317
106 Ga0068857_100002151 3300005577 Bacteria 16023
107 Ga0068857_100057883 3300005577 Bacteria 3441
108 Ga0068857_100120729 3300005577 Bacteria 2359
109 Ga0068857_100207471 3300005577 Bacteria 1787
110 Ga0068857_100307635 3300005577 Bacteria 1462
111 Ga0068857_100429180 3300005577 Bacteria 1233
112 Ga0068854_100200748 3300005578 Bacteria 1567
113 Ga0068856_100000793 3300005614 Bacteria 34127
114 Ga0068856_100318087 3300005614 Bacteria 1574
115 Ga0068852_100000251 3300005616 Bacteria 36412
116 Ga0068852_100036355 3300005616 Bacteria 4120
117 Ga0068852_100069958 3300005616 Bacteria 3078
118 Ga0068852_100288877 3300005616 Bacteria 1583
119 Ga0068852_100317568 3300005616 Bacteria 1512
120 Ga0068859_100000136 3300005617 Bacteria 68907
121 Ga0068859_100014991 3300005617 Bacteria 7781
122 Ga0068859_100034799 3300005617 Bacteria 5055
123 Ga0068859_100101739 3300005617 Bacteria 2931
124 Ga0068859_100165200 3300005617 Bacteria 2293
125 Ga0068859_100173686 3300005617 Bacteria 2237
126 Ga0068864_100000651 3300005618 Bacteria 29025
127 Ga0068864_100019582 3300005618 Bacteria 5661
128 Ga0068864_100091745 3300005618 Bacteria 2680
129 Ga0068864_100290563 3300005618 Bacteria 1528
130 Ga0068861_100013259 3300005719 Bacteria 5767
131 Ga0068861_100233189 3300005719 Bacteria 1562
132 Ga0068851_10009273 3300005834 Bacteria 4568
133 Ga0068851_10021086 3300005834 Bacteria 3161
134 Ga0068863_100000140 3300005841 Bacteria 76175
135 Ga0068863_100013399 3300005841 Bacteria 7905
136 Ga0068863_100044783 3300005841 Bacteria 4199
137 Ga0068863_100076125 3300005841 Bacteria 3175
138 Ga0068858_100001826 3300005842 Bacteria 21672
139 Ga0068858_100005794 3300005842 Bacteria 12065
140 Ga0068858_100093113 3300005842 Bacteria 2805
141 Ga0068860_100004881 3300005843 Bacteria 13665
142 Ga0068860_100008260 3300005843 Bacteria 10358
143 Ga0068860_100139575 3300005843 Bacteria 2328
144 Ga0068860_100229309 3300005843 Bacteria 1805
145 Ga0068860_100253882 3300005843 Bacteria 1713
146 Ga0068860_100386567 3300005843 Unclassified 1382
147 Ga0068860_100402921 3300005843 Bacteria 1353
148 Ga0068862_100003397 3300005844 Bacteria 13728
149 Ga0068862_100024686 3300005844 Bacteria 5044
150 Ga0068862_100070567 3300005844 Bacteria 3016
151 Ga0068862_100078937 3300005844 Bacteria 2853
152 Ga0068862_100090625 3300005844 Bacteria 2662
153 Ga0068862_100168947 3300005844 Bacteria 1957
154 Ga0068862_100220672 3300005844 Bacteria 1716
155 Ga0068862_100510388 3300005844 Bacteria 1142
156 Ga0075365_10125145 3300006038 Bacteria 1776
157 Ga0097621_100429396 3300006237 Unclassified 1187
158 Ga0068871_100084047 3300006358 Bacteria 2641
159 Ga0068871_100170166 3300006358 Bacteria 1867
160 Ga0075431_100010549 3300006847 Bacteria 9288
161 Ga0075433_10014104 3300006852 Bacteria 6517
162 Ga0075434_100715366 3300006871 Bacteria 1019
163 Ga0068865_100055117 3300006881 Bacteria 2765
164 Ga0097620_100000136 3300006931 Bacteria 68907
165 Ga0097620_100014992 3300006931 Bacteria 7781
166 Ga0097620_100034798 3300006931 Bacteria 5055
167 Ga0097620_100101742 3300006931 Bacteria 2931
168 Ga0097620_100165205 3300006931 Bacteria 2293
169 Ga0097620_100173689 3300006931 Bacteria 2237
170 Ga0105250_10006154 3300009092 Bacteria 5273
171 Ga0105240_10200961 3300009093 Bacteria 2336
172 Ga0111539_10016465 3300009094 Bacteria 9167
173 Ga0111539_10087692 3300009094 Bacteria 3655
174 Ga0111539_10359989 3300009094 Bacteria 1693
175 Ga0105243_10121626 3300009148 Bacteria 2202
176 Ga0105243_10192522 3300009148 Bacteria 1782
177 Ga0105241_10118518 3300009174 Bacteria 2128
178 Ga0105241_10130783 3300009174 Bacteria 2032
179 Ga0105248_10000416 3300009177 Bacteria 48833
180 Ga0105248_10001074 3300009177 Bacteria 30223
181 Ga0105248_10010278 3300009177 Bacteria 10302
182 Ga0105248_10010640 3300009177 Bacteria 10146
183 Ga0105248_10057097 3300009177 Bacteria 4381
184 Ga0105248_10233303 3300009177 Bacteria 2071
185 Ga0105238_10004794 3300009551 Bacteria 13382
186 Ga0105238_10198701 3300009551 Bacteria 1980
187 Ga0105238_10227595 3300009551 Bacteria 1841
188 Ga0105249_10047155 3300009553 Bacteria 3925
189 Ga0105249_10085168 3300009553 Bacteria 2945
190 Ga0105246_10099425 3300011119 Bacteria 2114
191 Ga0157373_10056276 3300013100 Bacteria 2794
192 Ga0157373_10162735 3300013100 Bacteria 1570
193 Ga0157373_10313498 3300013100 Bacteria 1115
194 Ga0157371_10003313 3300013102 Bacteria 14726
195 Ga0157371_10018061 3300013102 Bacteria 5223
196 Ga0157371_10337980 3300013102 Bacteria 1095
197 Ga0157370_10105456 3300013104 Bacteria 2638
198 Ga0157370_10143116 3300013104 Bacteria 2227
199 Ga0157370_10261271 3300013104 Bacteria 1600
200 Ga0157369_10002615 3300013105 Bacteria 21530
201 Ga0157369_10017149 3300013105 Bacteria 8135
202 Ga0157369_10162445 3300013105 Bacteria 2357
203 Ga0157378_10192935 3300013297 Bacteria 1922
204 Ga0163162_10014337 3300013306 Bacteria 7745
205 Ga0157372_10002970 3300013307 Bacteria 18265
206 Ga0157375_10057975 3300013308 Bacteria 3830
207 Ga0157375_10205807 3300013308 Bacteria 2124
208 Ga0157375_10264587 3300013308 Bacteria 1881
209 Ga0157375_10619148 3300013308 Bacteria 1241
210 Ga0163163_10001010 3300014325 Bacteria 23813
211 Ga0163163_10001818 3300014325 Bacteria 18008
212 Ga0163163_10029780 3300014325 Bacteria 5253
213 Ga0157380_10011701 3300014326 Bacteria 6344
214 Ga0157380_10026069 3300014326 Bacteria 4437
215 Ga0157380_10052391 3300014326 Bacteria 3231
216 Ga0157379_10005135 3300014968 Bacteria 11233
217 Ga0157379_10034021 3300014968 Bacteria 4542
218 Ga0163161_10083730 3300017792 Bacteria 2351
219 Ga0163161_10118315 3300017792 Bacteria 1988
220 Ga0207697_10004622 3300025315 Bacteria 6542
221 Ga0207656_10004954 3300025321 Bacteria 4677
222 Ga0207656_10010956 3300025321 Bacteria 3412
223 Ga0207682_10000527 3300025893 Bacteria 17568
224 Ga0207682_10010107 3300025893 Bacteria 3704
225 Ga0207688_10010292 3300025901 Bacteria 5091
226 Ga0207688_10060488 3300025901 Bacteria 2134
227 Ga0207688_10178850 3300025901 Bacteria 1264
228 Ga0207647_10024741 3300025904 Bacteria 3957
229 Ga0207647_10072117 3300025904 Bacteria 2083
230 Ga0207645_10141728 3300025907 Bacteria 1566
231 Ga0207645_10142611 3300025907 Bacteria 1561
232 Ga0207645_10198911 3300025907 Bacteria 1318
233 Ga0207705_10000212 3300025909 Bacteria 58540
234 Ga0207705_10012187 3300025909 Bacteria 6214
235 Ga0207705_10013882 3300025909 Bacteria 5808
236 Ga0207705_10026828 3300025909 Bacteria 4105
237 Ga0207695_10316623 3300025913 Bacteria 1450
238 Ga0207660_10009002 3300025917 Bacteria 6461
239 Ga0207660_10285476 3300025917 Bacteria 1311
240 Ga0207657_10000638 3300025919 Bacteria 37165
241 Ga0207657_10007988 3300025919 Bacteria 10787
242 Ga0207657_10111679 3300025919 Bacteria 2256
243 Ga0207657_10165519 3300025919 Bacteria 1794
244 Ga0207649_10000304 3300025920 Bacteria 37784
245 Ga0207649_10029557 3300025920 Bacteria 3237
246 Ga0207652_10112754 3300025921 Bacteria 2413
247 Ga0207681_10002811 3300025923 Bacteria 11017
248 Ga0207681_10027816 3300025923 Bacteria 3660
249 Ga0207681_10036269 3300025923 Bacteria 3252
250 Ga0207681_10157473 3300025923 Bacteria 1708
251 Ga0207681_10193124 3300025923 Bacteria 1559
252 Ga0207681_10306939 3300025923 Bacteria 1257
253 Ga0207694_10020412 3300025924 Bacteria 5013
254 Ga0207694_10200087 3300025924 Bacteria 1625
255 Ga0207650_10002625 3300025925 Bacteria 12437
256 Ga0207650_10008254 3300025925 Bacteria 7109
257 Ga0207650_10011136 3300025925 Bacteria 6185
258 Ga0207650_10011146 3300025925 Bacteria 6183
259 Ga0207650_10018464 3300025925 Bacteria 4895
260 Ga0207650_10021270 3300025925 Bacteria 4586
261 Ga0207650_10311402 3300025925 Bacteria 1288
262 Ga0207659_10000877 3300025926 Bacteria 17877
263 Ga0207659_10036003 3300025926 Bacteria 3425
264 Ga0207659_10114456 3300025926 Bacteria 2056
265 Ga0207687_10000473 3300025927 Bacteria 27414
266 Ga0207687_10200344 3300025927 Bacteria 1560
267 Ga0207664_10006488 3300025929 Bacteria 8051
268 Ga0207664_10007948 3300025929 Bacteria 7373
269 Ga0207644_10001989 3300025931 Bacteria 13220
270 Ga0207644_10011810 3300025931 Bacteria 5783
271 Ga0207644_10018897 3300025931 Bacteria 4671
272 Ga0207644_10028914 3300025931 Bacteria 3842
273 Ga0207644_10031819 3300025931 Bacteria 3678
274 Ga0207690_10000264 3300025932 Bacteria 37683
275 Ga0207690_10069941 3300025932 Bacteria 2416
276 Ga0207706_10000639 3300025933 Bacteria 37168
277 Ga0207706_10001215 3300025933 Bacteria 26023
278 Ga0207706_10008348 3300025933 Bacteria 9551
279 Ga0207706_10021226 3300025933 Bacteria 5834
280 Ga0207706_10099314 3300025933 Bacteria 2561
281 Ga0207706_10309549 3300025933 Bacteria 1375
282 Ga0207706_10353785 3300025933 Bacteria 1277
283 Ga0207686_10100883 3300025934 Bacteria 1927
284 Ga0207686_10123039 3300025934 Bacteria 1768
285 Ga0207709_10136150 3300025935 Bacteria 1682
286 Ga0207669_10008218 3300025937 Bacteria 4889
287 Ga0207704_10202735 3300025938 Bacteria 1453
288 Ga0207691_10000878 3300025940 Bacteria 29903
289 Ga0207691_10010146 3300025940 Bacteria 9040
290 Ga0207691_10085676 3300025940 Bacteria 2828
291 Ga0207691_10123357 3300025940 Bacteria 2293
292 Ga0207711_10000105 3300025941 Bacteria 90036
293 Ga0207711_10001216 3300025941 Bacteria 24391
294 Ga0207711_10006500 3300025941 Bacteria 9841
295 Ga0207711_10019212 3300025941 Bacteria 5689
296 Ga0207711_10075817 3300025941 Bacteria 2928
297 Ga0207689_10026313 3300025942 Bacteria 4871
298 Ga0207689_10199171 3300025942 Bacteria 1653
299 Ga0207689_10264803 3300025942 Bacteria 1422
300 Ga0207661_10001647 3300025944 Bacteria 15222
301 Ga0207661_10009350 3300025944 Bacteria 7023
302 Ga0207661_10264956 3300025944 Bacteria 1532
303 Ga0207679_10000191 3300025945 Bacteria 49174
304 Ga0207679_10002027 3300025945 Bacteria 12576
305 Ga0207679_10033400 3300025945 Bacteria 3620
306 Ga0207679_10095670 3300025945 Bacteria 2309
307 Ga0207679_10260474 3300025945 Bacteria 1479
308 Ga0207679_10310641 3300025945 Bacteria 1362
309 Ga0207679_10364554 3300025945 Bacteria 1263
310 Ga0207667_10001227 3300025949 Bacteria 32137
311 Ga0207667_10070885 3300025949 Bacteria 3626
312 Ga0207651_10007231 3300025960 Bacteria 5904
313 Ga0207651_10062498 3300025960 Bacteria 2595
314 Ga0207651_10126433 3300025960 Bacteria 1948
315 Ga0207651_10155666 3300025960 Bacteria 1785
316 Ga0207712_10013271 3300025961 Bacteria 5280
317 Ga0207712_10034390 3300025961 Bacteria 3435
318 Ga0207668_10493337 3300025972 Bacteria 1052
319 Ga0207640_10061806 3300025981 Bacteria 2482
320 Ga0207640_10208454 3300025981 Bacteria 1487
321 Ga0207658_10003869 3300025986 Bacteria 10543
322 Ga0207658_10010411 3300025986 Bacteria 6317
323 Ga0207658_10017239 3300025986 Bacteria 4976
324 Ga0207658_10063735 3300025986 Bacteria 2763
325 Ga0207658_10189557 3300025986 Bacteria 1708
326 Ga0207703_10000974 3300026035 Bacteria 27552
327 Ga0207703_10026142 3300026035 Bacteria 4593
328 Ga0207639_10000179 3300026041 Bacteria 49456
329 Ga0207639_10002119 3300026041 Bacteria 13364
330 Ga0207639_10073426 3300026041 Bacteria 2682
331 Ga0207639_10107765 3300026041 Bacteria 2264
332 Ga0207639_10116685 3300026041 Bacteria 2186
333 Ga0207678_10002101 3300026067 Bacteria 18034
334 Ga0207678_10018822 3300026067 Bacteria 6064
335 Ga0207678_10132933 3300026067 Bacteria 2123
336 Ga0207708_10048527 3300026075 Bacteria 3232
337 Ga0207702_10000413 3300026078 Bacteria 48840
338 Ga0207702_10372358 3300026078 Bacteria 1371
339 Ga0207641_10000172 3300026088 Bacteria 90549
340 Ga0207641_10102376 3300026088 Bacteria 2525
341 Ga0207641_10109019 3300026088 Bacteria 2451
342 Ga0207648_10009427 3300026089 Bacteria 9353
343 Ga0207648_10032670 3300026089 Bacteria 4592
344 Ga0207676_10002051 3300026095 Bacteria 14619
345 Ga0207676_10098256 3300026095 Bacteria 2420
346 Ga0207676_10101102 3300026095 Bacteria 2390
347 Ga0207676_10245491 3300026095 Bacteria 1609
348 Ga0207674_10006642 3300026116 Bacteria 13588
349 Ga0207674_10013457 3300026116 Bacteria 9074
350 Ga0207674_10074107 3300026116 Bacteria 3417
351 Ga0207674_10112180 3300026116 Bacteria 2700
352 Ga0207675_100010422 3300026118 Bacteria 8705
353 Ga0207683_10012717 3300026121 Bacteria 7181
354 Ga0207698_10002088 3300026142 Bacteria 11786
355 Ga0207698_10013588 3300026142 Bacteria 5379
356 Ga0207698_10025863 3300026142 Bacteria 4143
357 Ga0207698_10151533 3300026142 Bacteria 2013
358 Ga0207698_10245407 3300026142 Bacteria 1635
359 Ga0268266_10003318 3300028379 Bacteria 16154
360 Ga0268266_10367226 3300028379 Bacteria 1355
361 Ga0268266_10514137 3300028379 Bacteria 1144
362 Ga0268265_10002567 3300028380 Bacteria 13576
363 Ga0268265_10009320 3300028380 Bacteria 6636
364 Ga0268265_10014584 3300028380 Bacteria 5356
365 Ga0268265_10053264 3300028380 Bacteria 3065
366 Ga0268265_10054823 3300028380 Bacteria 3027
367 Ga0268265_10074093 3300028380 Bacteria 2661
368 Ga0268265_10280166 3300028380 Bacteria 1491
369 Ga0268264_10001846 3300028381 Bacteria 19295
370 Ga0268264_10069255 3300028381 Bacteria 2984
371 Ga0268264_10069881 3300028381 Bacteria 2971
372 Ga0307515_10313652 3300028794 Bacteria 1241
373 Ga0307408_100009963 3300031548 Bacteria 6260
374 Ga0307408_100371900 3300031548 Bacteria 1219
375 Ga0307508_10003647 3300031616 Bacteria 15437
376 Ga0307405_10039549 3300031731 Bacteria 2851
377 Ga0307405_10147199 3300031731 Bacteria 1651
378 Ga0307405_10235658 3300031731 Bacteria 1352
379 Ga0307405_10320050 3300031731 Bacteria 1184
380 Ga0307413_10010653 3300031824 Bacteria 4475
381 Ga0307413_10220035 3300031824 Bacteria 1386
382 Ga0307410_10001680 3300031852 Bacteria 10178
383 Ga0307410_10006193 3300031852 Bacteria 6429
384 Ga0307410_10028784 3300031852 Bacteria 3529
385 Ga0307406_10056920 3300031901 Bacteria 2506
386 Ga0307406_10119732 3300031901 Bacteria 1828
387 Ga0307406_10162844 3300031901 Bacteria 1606
388 Ga0307406_10204208 3300031901 Bacteria 1457
389 Ga0307406_10275826 3300031901 Bacteria 1280
390 Ga0307407_10007557 3300031903 Bacteria 4929
391 Ga0307407_10068145 3300031903 Bacteria 2107
392 Ga0307412_10037987 3300031911 Bacteria 3097
393 Ga0307412_10039765 3300031911 Bacteria 3039
394 Ga0307412_10092000 3300031911 Bacteria 2124
395 Ga0307412_10126865 3300031911 Bacteria 1847
396 Ga0307409_100004691 3300031995 Bacteria 7735
397 Ga0307409_100051618 3300031995 Bacteria 3148
398 Ga0307409_100096176 3300031995 Bacteria 2442
399 Ga0307409_100220886 3300031995 Bacteria 1710
400 Ga0307409_100222182 3300031995 Bacteria 1706
401 Ga0307416_100008568 3300032002 Bacteria 6612
402 Ga0307416_100010906 3300032002 Bacteria 6028
403 Ga0307416_100103781 3300032002 Bacteria 2483
404 Ga0307416_100211707 3300032002 Bacteria 1850
405 Ga0307416_100276593 3300032002 Bacteria 1652
406 Ga0307416_100286425 3300032002 Bacteria 1628
407 Ga0307416_100472651 3300032002 Bacteria 1312
408 Ga0307414_10002944 3300032004 Bacteria 9002
409 Ga0307414_10006121 3300032004 Bacteria 6682
410 Ga0307414_10006145 3300032004 Bacteria 6672
411 Ga0307414_10116153 3300032004 Bacteria 2048
412 Ga0307411_10000586 3300032005 Bacteria 13032
413 Ga0307411_10015264 3300032005 Bacteria 4307
414 Ga0307411_10080211 3300032005 Bacteria 2243
415 Ga0307411_10378487 3300032005 Bacteria 1163
416 Ga0307411_10461077 3300032005 Bacteria 1065
417 Ga0307411_10463512 3300032005 Bacteria 1063
418 Ga0307415_100019776 3300032126 Bacteria 4095
419 Ga0307415_100043322 3300032126 Bacteria 3002
420 Ga0373929_0022189 3300035085 Bacteria 1294
421 Ga0373942_0014208 3300035207 Bacteria 1924
422 Ga0395899_0002299 3300037312 Bacteria 15586
423 Ga0395899_0018642 3300037312 Bacteria 5273
424 Ga0395899_0114131 3300037312 Bacteria 1940
425 Ga0395899_0219863 3300037312 Bacteria 1316
426 Ga0395900_0001884 3300037418 Bacteria 23847
427 Ga0395900_0016277 3300037418 Bacteria 7579
428 Ga0395900_0020547 3300037418 Bacteria 6742
429 Ga0395900_0044846 3300037418 Bacteria 4554
430 Ga0395900_0049948 3300037418 Bacteria 4309
431 Ga0395900_0091155 3300037418 Bacteria 3132
432 Ga0395900_0123505 3300037418 Bacteria 2655
433 Ga0395898_0022238 3300037466 Bacteria 6425
434 Ga0395898_0043900 3300037466 Bacteria 4404
435 Ga0395898_0123767 3300037466 Bacteria 2478
436 Ga0395898_0267226 3300037466 Bacteria 1631
437 Ga0395905_0000940 3300037471 Bacteria 37468
438 Ga0395905_0015335 3300037471 Bacteria 7285
439 Ga0395905_0023644 3300037471 Bacteria 5802
440 Ga0395905_0031015 3300037471 Bacteria 5034
441 Ga0395905_0033319 3300037471 Bacteria 4839
442 Ga0395905_0037428 3300037471 Bacteria 4555
443 Ga0395905_0053971 3300037471 Bacteria 3761
444 Ga0395905_0089990 3300037471 Bacteria 2877
445 Ga0395905_0139689 3300037471 Bacteria 2279
446 Ga0395905_0144989 3300037471 Bacteria 2234
447 Ga0395905_0256585 3300037471 Bacteria 1633
448 Ga0395905_0380202 3300037471 Bacteria 1306
449 Ga0395905_0647545 3300037471 Unclassified 959
450 Ga0395901_0001289 3300038443 Bacteria 26489
451 Ga0395901_0011872 3300038443 Bacteria 8833
452 Ga0395901_0012548 3300038443 Bacteria 8598
453 Ga0395901_0037623 3300038443 Bacteria 5004
454 Ga0395901_0053642 3300038443 Bacteria 4189
455 Ga0395901_0492091 3300038443 Bacteria 1249
456 Ga0439445_0016147 3300042004 Bacteria 1834
457 Ga0450917_001103 3300042120 Bacteria 1983
458 Ga0450889_003880 3300042144 Bacteria 1476
459 Ga0466966_0000021 3300044684 Bacteria 116714
460 Ga0466961_0067351 3300044693 Bacteria 2274
461 Ga0466961_0088698 3300044693 Bacteria 1954
462 Ga0466963_0016310 3300044694 Bacteria 4617
463 Ga0466963_0138165 3300044694 Bacteria 1687
464 Ga0466963_0216413 3300044694 Bacteria 1341
465 Ga0466957_0000196 3300044842 Bacteria 27913
466 Ga0466957_0002469 3300044842 Bacteria 9932
467 Ga0466957_0053703 3300044842 Bacteria 2457
468 Ga0466959_0010835 3300045049 Bacteria 6536
469 Ga0466958_0000506 3300045836 Bacteria 16309
470 Ga0466967_0003640 3300045976 Bacteria 10132
471 Ga0466967_0021699 3300045976 Bacteria 5223
472 Ga0466967_0122115 3300045976 Bacteria 2408
473 Ga0466967_0352859 3300045976 Bacteria 1424
474 Ga0495585_0010304 3300046492 Bacteria 5572
475 Ga0495663_0001608 3300046525 Bacteria 7066
476 Ga0495663_0001665 3300046525 Bacteria 6928
477 Ga0495642_0021481 3300046528 Bacteria 2539
478 Ga0495642_0190633 3300046528 Bacteria 893
479 Ga0495598_0000355 3300046537 Bacteria 8181
480 Ga0495598_0007997 3300046537 Bacteria 2448
481 Ga0495598_0013226 3300046537 Bacteria 2041
482 Ga0495621_0001079 3300046539 Bacteria 7002
483 Ga0495621_0003905 3300046539 Bacteria 4141
484 Ga0495621_0005019 3300046539 Bacteria 3773
485 Ga0495621_0025089 3300046539 Bacteria 1999
486 Ga0495621_0059896 3300046539 Bacteria 1380
487 Ga0495622_0053575 3300046557 Bacteria 1872
488 Ga0495633_0010639 3300046558 Bacteria 5013
489 Ga0495668_0003644 3300046616 Bacteria 11384
490 Ga0495659_0003377 3300046664 Bacteria 5115
491 Ga0495659_0005087 3300046664 Bacteria 4131
492 Ga0495659_0042444 3300046664 Bacteria 1628
493 Ga0495661_0016408 3300046665 Bacteria 4909
494 Ga0495669_0000570 3300046684 Bacteria 16324
495 Ga0495669_0011512 3300046684 Bacteria 3757
496 Ga0495669_0016808 3300046684 Bacteria 3136
497 Ga0495670_0015651 3300046691 Bacteria 3727
498 Ga0495670_0028722 3300046691 Bacteria 2757
499 Ga0495670_0036816 3300046691 Bacteria 2438
500 Ga0495670_0047004 3300046691 Bacteria 2157
501 Ga0495670_0110461 3300046691 Bacteria 1422
502 Ga0495677_0003145 3300047445 Bacteria 6437
503 Ga0495677_0087165 3300047445 Bacteria 1174
504 Ga0496100_0059744 3300048903 Bacteria 2506
505 Ga0496101_0011204 3300048904 Bacteria 5941
506 Ga0496101_0354588 3300048904 Bacteria 1153
507 Ga0496107_0052549 3300048910 Bacteria 2939
508 Ga0496109_0017447 3300048912 Bacteria 6294
509 Ga0496110_0002543 3300048913 Bacteria 13715
510 Ga0496111_0004244 3300048914 Bacteria 9031
511 Ga0496114_0087718 3300048917 Bacteria 2638
512 Ga0501290_001519 3300049513 Bacteria 3162
513 Ga0501292_000012 3300049515 Bacteria 69398
514 Ga0501294_000207 3300049517 Bacteria 7276
515 Ga0501202_011211 3300049652 Bacteria 1677
516 Ga0501222_001760 3300049662 Bacteria 3003
517 Ga0501227_005638 3300049665 Bacteria 2680
518 Ga0501235_005673 3300049669 Bacteria 2715
519 Ga0501259_001670 3300049688 Bacteria 3694
520 Ga0501261_000031 3300049690 Bacteria 31241
521 Ga0501245_000094 3300049708 Bacteria 8843
522 Ga0501279_000004 3300049775 Bacteria 175612
523 Ga0501280_000052 3300049776 Bacteria 33642
524 Ga0501282_000448 3300049778 Bacteria 4918
525 Ga0501283_001414 3300049779 Bacteria 3125
526 nmdc:mga0yw44_189101_c1 3300050492 Bacteria 1357
527 nmdc:mga06r32_62768_c1 3300050510 Bacteria 3580
528 nmdc:mga08y16_72472_c1 3300050511 Bacteria 3589
529 nmdc:mga0a205_8452_c1 3300050515 Bacteria 9369
530 Ga0500658_0000585 3300053134 Bacteria 15336
531 Ga0466962_0014837 3300061719 Bacteria 3753

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_100222182 Ga0307409_1002221822 262
2 3300032005 Ga0307411_10461077 Ga0307411_104610771 262
3 3300006038 Ga0075365_10125145 Ga0075365_101251452 264
4 3300050492 nmdc:mga0yw44_189101_c1 nmdc:mga0yw44_189101_c1_139_1068 264
5 3300046691 Ga0495670_0110461 Ga0495670_0110461_124_978 268
6 3300028380 Ga0268265_10009320 Ga0268265_100093202 270
7 3300005331 Ga0070670_100003354 Ga0070670_1000033544 271
8 3300025925 Ga0207650_10011136 Ga0207650_100111369 271
9 3300031903 Ga0307407_10068145 Ga0307407_100681452 271
10 3300032005 Ga0307411_10015264 Ga0307411_100152646 271
11 3300046528 Ga0495642_0190633 Ga0495642_0190633_35_859 271
12 3300006847 Ga0075431_100010549 Ga0075431_10001054911 272
13 3300042004 Ga0439445_0016147 Ga0439445_0016147_292_1215 272
14 3300049513 Ga0501290_001519 Ga0501290_001519_151_1119 272
15 3300049515 Ga0501292_000012 Ga0501292_000012_50376_51347 272
16 3300049517 Ga0501294_000207 Ga0501294_000207_5344_6315 272
17 3300049652 Ga0501202_011211 Ga0501202_011211_334_1305 272
18 3300049662 Ga0501222_001760 Ga0501222_001760_1945_2916 272
19 3300049665 Ga0501227_005638 Ga0501227_005638_161_1132 272
20 3300049669 Ga0501235_005673 Ga0501235_005673_1187_2158 272
21 3300049688 Ga0501259_001670 Ga0501259_001670_1147_2118 272
22 3300049690 Ga0501261_000031 Ga0501261_000031_29286_30257 272
23 3300049708 Ga0501245_000094 Ga0501245_000094_4239_5210 272
24 3300049775 Ga0501279_000004 Ga0501279_000004_7575_8546 272
25 3300049776 Ga0501280_000052 Ga0501280_000052_14682_15650 272
26 3300049778 Ga0501282_000448 Ga0501282_000448_1582_2553 272
27 3300050510 nmdc:mga06r32_62768_c1 nmdc:mga06r32_62768_c1_342_1265 272
28 3300031995 Ga0307409_100051618 Ga0307409_1000516184 273
29 3300013297 Ga0157378_10192935 Ga0157378_101929352 274
30 3300005548 Ga0070665_100531964 Ga0070665_1005319641 275
31 3300028379 Ga0268266_10514137 Ga0268266_105141372 275
32 3300005843 Ga0068860_100139575 Ga0068860_1001395752 276
33 3300028381 Ga0268264_10069255 Ga0268264_100692552 276
34 3300031911 Ga0307412_10126865 Ga0307412_101268652 276
35 3300044842 Ga0466957_0053703 Ga0466957_0053703_680_1606 276
36 3300046684 Ga0495669_0011512 Ga0495669_0011512_238_1176 276
37 3300011119 Ga0105246_10099425 Ga0105246_100994251 277
38 3300028794 Ga0307515_10313652 Ga0307515_103136521 277
39 3300044694 Ga0466963_0138165 Ga0466963_0138165_548_1474 277
40 3300044842 Ga0466957_0002469 Ga0466957_0002469_3778_4716 277
41 3300045836 Ga0466958_0000506 Ga0466958_0000506_11235_12173 277
42 3300045976 Ga0466967_0122115 Ga0466967_0122115_497_1423 277
43 3300049779 Ga0501283_001414 Ga0501283_001414_1145_2116 277
44 3300061719 Ga0466962_0014837 Ga0466962_0014837_2297_3235 277
45 3300031852 Ga0307410_10001680 Ga0307410_100016807 278
46 3300031548 Ga0307408_100009963 Ga0307408_1000099635 279
47 3300009148 Ga0105243_10121626 Ga0105243_101216262 281
48 3300005338 Ga0068868_100012162 Ga0068868_1000121628 282
49 3300005354 Ga0070675_100142739 Ga0070675_1001427392 282
50 3300005367 Ga0070667_100074000 Ga0070667_1000740004 282
51 3300005545 Ga0070695_100089243 Ga0070695_1000892432 282
52 3300005577 Ga0068857_100120729 Ga0068857_1001207292 282
53 3300005617 Ga0068859_100165200 Ga0068859_1001652003 282
54 3300005841 Ga0068863_100076125 Ga0068863_1000761255 282
55 3300005842 Ga0068858_100001826 Ga0068858_10000182616 282
56 3300005843 Ga0068860_100402921 Ga0068860_1004029212 282
57 3300005844 Ga0068862_100168947 Ga0068862_1001689472 282
58 3300005844 Ga0068862_100510388 Ga0068862_1005103881 282
59 3300006852 Ga0075433_10014104 Ga0075433_100141045 282
60 3300006871 Ga0075434_100715366 Ga0075434_1007153662 282
61 3300006931 Ga0097620_100165205 Ga0097620_1001652052 282
62 3300009148 Ga0105243_10192522 Ga0105243_101925222 282
63 3300009174 Ga0105241_10118518 Ga0105241_101185182 282
64 3300013308 Ga0157375_10264587 Ga0157375_102645872 282
65 3300025927 Ga0207687_10000473 Ga0207687_100004736 282
66 3300025927 Ga0207687_10200344 Ga0207687_102003442 282
67 3300025933 Ga0207706_10353785 Ga0207706_103537852 282
68 3300025934 Ga0207686_10100883 Ga0207686_101008832 282
69 3300025935 Ga0207709_10136150 Ga0207709_101361502 282
70 3300025942 Ga0207689_10026313 Ga0207689_100263135 282
71 3300025945 Ga0207679_10260474 Ga0207679_102604742 282
72 3300025986 Ga0207658_10063735 Ga0207658_100637352 282
73 3300026035 Ga0207703_10000974 Ga0207703_100009747 282
74 3300026088 Ga0207641_10102376 Ga0207641_101023762 282
75 3300026095 Ga0207676_10245491 Ga0207676_102454912 282
76 3300026116 Ga0207674_10112180 Ga0207674_101121802 282
77 3300028380 Ga0268265_10014584 Ga0268265_100145841 282
78 3300028380 Ga0268265_10280166 Ga0268265_102801662 282
79 3300050515 nmdc:mga0a205_8452_c1 nmdc:mga0a205_8452_c1_5827_6744 282
80 3300014326 Ga0157380_10026069 Ga0157380_100260692 283
81 3300005295 Ga0065707_10187989 Ga0065707_101879892 289
82 3300031616 Ga0307508_10003647 Ga0307508_100036472 289
83 3300046557 Ga0495622_0053575 Ga0495622_0053575_616_1542 289
84 3300005457 Ga0070662_100155823 Ga0070662_1001558232 290
85 3300005548 Ga0070665_100019092 Ga0070665_1000190924 290
86 3300005614 Ga0068856_100318087 Ga0068856_1003180872 290
87 3300005617 Ga0068859_100173686 Ga0068859_1001736861 290
88 3300006931 Ga0097620_100173689 Ga0097620_1001736891 290
89 3300009174 Ga0105241_10130783 Ga0105241_101307832 290
90 3300009177 Ga0105248_10000416 Ga0105248_1000041628 290
91 3300013102 Ga0157371_10003313 Ga0157371_100033132 290
92 3300014325 Ga0163163_10001818 Ga0163163_1000181813 290
93 3300014968 Ga0157379_10034021 Ga0157379_100340215 290
94 3300025925 Ga0207650_10311402 Ga0207650_103114022 290
95 3300025940 Ga0207691_10085676 Ga0207691_100856761 290
96 3300025945 Ga0207679_10364554 Ga0207679_103645542 290
97 3300031731 Ga0307405_10320050 Ga0307405_103200502 290
98 3300031824 Ga0307413_10220035 Ga0307413_102200352 290
99 3300031901 Ga0307406_10056920 Ga0307406_100569204 290
100 3300031911 Ga0307412_10039765 Ga0307412_100397652 290
101 3300031995 Ga0307409_100096176 Ga0307409_1000961764 290
102 3300032005 Ga0307411_10378487 Ga0307411_103784872 290
103 3300032126 Ga0307415_100019776 Ga0307415_1000197762 290
104 3300035085 Ga0373929_0022189 Ga0373929_0022189_389_1261 290
105 3300035207 Ga0373942_0014208 Ga0373942_0014208_456_1328 290
106 iso_pu_bacteria 2993356040 2993356161 290
107 3300005543 Ga0070672_100228970 Ga0070672_1002289702 291
108 3300005834 Ga0068851_10009273 Ga0068851_100092735 291
109 3300005844 Ga0068862_100024686 Ga0068862_1000246866 291
110 3300009551 Ga0105238_10227595 Ga0105238_102275951 291
111 3300013100 Ga0157373_10313498 Ga0157373_103134982 291
112 3300025321 Ga0207656_10004954 Ga0207656_100049545 291
113 3300026116 Ga0207674_10013457 Ga0207674_1001345711 291
114 3300037471 Ga0395905_0380202 Ga0395905_0380202_156_1079 291
115 3300044694 Ga0466963_0216413 Ga0466963_0216413_49_984 291
116 3300048910 Ga0496107_0052549 Ga0496107_0052549_267_1202 291
117 3300001989 JGI24739J22299_10006708 JGI24739J22299_100067083 292
118 3300001990 JGI24737J22298_10002015 JGI24737J22298_100020155 292
119 3300002067 JGI24735J21928_10005958 JGI24735J21928_100059585 292
120 3300002075 JGI24738J21930_10000573 JGI24738J21930_100005739 292
121 3300002459 JGI24751J29686_10012503 JGI24751J29686_100125031 292
122 3300005293 Ga0065715_10000657 Ga0065715_100006577 292
123 3300005327 Ga0070658_10000171 Ga0070658_1000017136 292
124 3300005327 Ga0070658_10033779 Ga0070658_100337794 292
125 3300005327 Ga0070658_10087297 Ga0070658_100872972 292
126 3300005327 Ga0070658_10100876 Ga0070658_101008762 292
127 3300005327 Ga0070658_10158512 Ga0070658_101585122 292
128 3300005327 Ga0070658_10199594 Ga0070658_101995942 292
129 3300005328 Ga0070676_10010325 Ga0070676_100103252 292
130 3300005329 Ga0070683_100000608 Ga0070683_10000060813 292
131 3300005329 Ga0070683_100007839 Ga0070683_1000078398 292
132 3300005331 Ga0070670_100003856 Ga0070670_1000038566 292
133 3300005331 Ga0070670_100006052 Ga0070670_1000060529 292
134 3300005331 Ga0070670_100114834 Ga0070670_1001148342 292
135 3300005333 Ga0070677_10023631 Ga0070677_100236312 292
136 3300005333 Ga0070677_10047636 Ga0070677_100476362 292
137 3300005333 Ga0070677_10072970 Ga0070677_100729702 292
138 3300005334 Ga0068869_100022765 Ga0068869_1000227651 292
139 3300005334 Ga0068869_100211196 Ga0068869_1002111962 292
140 3300005335 Ga0070666_10001125 Ga0070666_100011258 292
141 3300005335 Ga0070666_10114778 Ga0070666_101147782 292
142 3300005336 Ga0070680_100017399 Ga0070680_1000173998 292
143 3300005338 Ga0068868_100164845 Ga0068868_1001648452 292
144 3300005338 Ga0068868_100407658 Ga0068868_1004076581 292
145 3300005339 Ga0070660_100000134 Ga0070660_10000013424 292
146 3300005339 Ga0070660_100254911 Ga0070660_1002549111 292
147 3300005345 Ga0070692_10014989 Ga0070692_100149895 292
148 3300005347 Ga0070668_100011424 Ga0070668_1000114246 292
149 3300005347 Ga0070668_100013414 Ga0070668_1000134142 292
150 3300005347 Ga0070668_100131808 Ga0070668_1001318082 292
151 3300005353 Ga0070669_100000722 Ga0070669_10000072231 292
152 3300005353 Ga0070669_100040561 Ga0070669_1000405612 292
153 3300005353 Ga0070669_100043918 Ga0070669_1000439182 292
154 3300005353 Ga0070669_100099686 Ga0070669_1000996862 292
155 3300005353 Ga0070669_100184063 Ga0070669_1001840632 292
156 3300005354 Ga0070675_100001154 Ga0070675_10000115416 292
157 3300005354 Ga0070675_100006153 Ga0070675_1000061537 292
158 3300005354 Ga0070675_100017077 Ga0070675_1000170774 292
159 3300005355 Ga0070671_100004634 Ga0070671_1000046347 292
160 3300005355 Ga0070671_100018188 Ga0070671_1000181882 292
161 3300005355 Ga0070671_100267356 Ga0070671_1002673562 292
162 3300005356 Ga0070674_100015601 Ga0070674_1000156012 292
163 3300005356 Ga0070674_100098294 Ga0070674_1000982942 292
164 3300005364 Ga0070673_100129541 Ga0070673_1001295412 292
165 3300005366 Ga0070659_100000067 Ga0070659_10000006724 292
166 3300005366 Ga0070659_100003069 Ga0070659_1000030695 292
167 3300005366 Ga0070659_100003694 Ga0070659_1000036942 292
168 3300005366 Ga0070659_100011112 Ga0070659_1000111127 292
169 3300005366 Ga0070659_100021627 Ga0070659_1000216278 292
170 3300005366 Ga0070659_100049919 Ga0070659_1000499195 292
171 3300005366 Ga0070659_100066382 Ga0070659_1000663822 292
172 3300005367 Ga0070667_100002206 Ga0070667_1000022068 292
173 3300005367 Ga0070667_100002611 Ga0070667_10000261116 292
174 3300005367 Ga0070667_100034609 Ga0070667_1000346092 292
175 3300005367 Ga0070667_100044663 Ga0070667_1000446635 292
176 3300005435 Ga0070714_100006574 Ga0070714_1000065749 292
177 3300005435 Ga0070714_100008901 Ga0070714_1000089012 292
178 3300005441 Ga0070700_100025242 Ga0070700_1000252422 292
179 3300005444 Ga0070694_100043673 Ga0070694_1000436732 292
180 3300005455 Ga0070663_100000671 Ga0070663_1000006712 292
181 3300005455 Ga0070663_100021761 Ga0070663_1000217616 292
182 3300005456 Ga0070678_100017303 Ga0070678_1000173032 292
183 3300005456 Ga0070678_100174356 Ga0070678_1001743562 292
184 3300005456 Ga0070678_100291627 Ga0070678_1002916272 292
185 3300005457 Ga0070662_100000250 Ga0070662_10000025024 292
186 3300005457 Ga0070662_100000873 Ga0070662_1000008733 292
187 3300005457 Ga0070662_100008790 Ga0070662_1000087903 292
188 3300005457 Ga0070662_100009066 Ga0070662_1000090665 292
189 3300005457 Ga0070662_100165610 Ga0070662_1001656102 292
190 3300005457 Ga0070662_100204277 Ga0070662_1002042772 292
191 3300005459 Ga0068867_100027613 Ga0068867_1000276135 292
192 3300005459 Ga0068867_100072236 Ga0068867_1000722362 292
193 3300005459 Ga0068867_100432471 Ga0068867_1004324712 292
194 3300005530 Ga0070679_100171474 Ga0070679_1001714742 292
195 3300005539 Ga0068853_100000366 Ga0068853_10000036617 292
196 3300005539 Ga0068853_100040983 Ga0068853_1000409833 292
197 3300005539 Ga0068853_100113071 Ga0068853_1001130713 292
198 3300005539 Ga0068853_100149091 Ga0068853_1001490912 292
199 3300005539 Ga0068853_100152170 Ga0068853_1001521702 292
200 3300005543 Ga0070672_100001931 Ga0070672_1000019312 292
201 3300005543 Ga0070672_100041672 Ga0070672_1000416724 292
202 3300005543 Ga0070672_100296593 Ga0070672_1002965932 292
203 3300005546 Ga0070696_100065949 Ga0070696_1000659492 292
204 3300005547 Ga0070693_100128311 Ga0070693_1001283112 292
205 3300005548 Ga0070665_100003424 Ga0070665_1000034248 292
206 3300005563 Ga0068855_100000434 Ga0068855_10000043448 292
207 3300005563 Ga0068855_100204717 Ga0068855_1002047172 292
208 3300005564 Ga0070664_100000170 Ga0070664_10000017013 292
209 3300005564 Ga0070664_100004225 Ga0070664_1000042259 292
210 3300005564 Ga0070664_100032810 Ga0070664_1000328104 292
211 3300005564 Ga0070664_100118384 Ga0070664_1001183841 292
212 3300005577 Ga0068857_100002151 Ga0068857_1000021512 292
213 3300005577 Ga0068857_100057883 Ga0068857_1000578834 292
214 3300005577 Ga0068857_100207471 Ga0068857_1002074712 292
215 3300005577 Ga0068857_100307635 Ga0068857_1003076351 292
216 3300005577 Ga0068857_100429180 Ga0068857_1004291802 292
217 3300005578 Ga0068854_100200748 Ga0068854_1002007482 292
218 3300005614 Ga0068856_100000793 Ga0068856_10000079325 292
219 3300005616 Ga0068852_100000251 Ga0068852_10000025122 292
220 3300005616 Ga0068852_100036355 Ga0068852_1000363552 292
221 3300005616 Ga0068852_100069958 Ga0068852_1000699582 292
222 3300005616 Ga0068852_100288877 Ga0068852_1002888772 292
223 3300005616 Ga0068852_100317568 Ga0068852_1003175682 292
224 3300005617 Ga0068859_100000136 Ga0068859_10000013619 292
225 3300005617 Ga0068859_100014991 Ga0068859_1000149912 292
226 3300005617 Ga0068859_100034799 Ga0068859_1000347995 292
227 3300005617 Ga0068859_100101739 Ga0068859_1001017391 292
228 3300005618 Ga0068864_100000651 Ga0068864_1000006516 292
229 3300005618 Ga0068864_100019582 Ga0068864_1000195827 292
230 3300005618 Ga0068864_100091745 Ga0068864_1000917452 292
231 3300005618 Ga0068864_100290563 Ga0068864_1002905632 292
232 3300005719 Ga0068861_100013259 Ga0068861_1000132597 292
233 3300005719 Ga0068861_100233189 Ga0068861_1002331892 292
234 3300005834 Ga0068851_10021086 Ga0068851_100210864 292
235 3300005841 Ga0068863_100000140 Ga0068863_10000014021 292
236 3300005841 Ga0068863_100013399 Ga0068863_1000133998 292
237 3300005841 Ga0068863_100044783 Ga0068863_1000447835 292
238 3300005842 Ga0068858_100005794 Ga0068858_10000579411 292
239 3300005842 Ga0068858_100093113 Ga0068858_1000931132 292
240 3300005843 Ga0068860_100004881 Ga0068860_1000048818 292
241 3300005843 Ga0068860_100008260 Ga0068860_1000082602 292
242 3300005843 Ga0068860_100229309 Ga0068860_1002293091 292
243 3300005843 Ga0068860_100253882 Ga0068860_1002538822 292
244 3300005843 Ga0068860_100386567 Ga0068860_1003865672 292
245 3300005844 Ga0068862_100003397 Ga0068862_10000339712 292
246 3300005844 Ga0068862_100070567 Ga0068862_1000705673 292
247 3300005844 Ga0068862_100078937 Ga0068862_1000789375 292
248 3300005844 Ga0068862_100090625 Ga0068862_1000906252 292
249 3300005844 Ga0068862_100220672 Ga0068862_1002206722 292
250 3300006237 Ga0097621_100429396 Ga0097621_1004293962 292
251 3300006358 Ga0068871_100084047 Ga0068871_1000840472 292
252 3300006358 Ga0068871_100170166 Ga0068871_1001701662 292
253 3300006881 Ga0068865_100055117 Ga0068865_1000551172 292
254 3300006931 Ga0097620_100000136 Ga0097620_10000013619 292
255 3300006931 Ga0097620_100014992 Ga0097620_1000149922 292
256 3300006931 Ga0097620_100034798 Ga0097620_1000347983 292
257 3300006931 Ga0097620_100101742 Ga0097620_1001017424 292
258 3300009092 Ga0105250_10006154 Ga0105250_100061545 292
259 3300009093 Ga0105240_10200961 Ga0105240_102009612 292
260 3300009094 Ga0111539_10016465 Ga0111539_100164655 292
261 3300009094 Ga0111539_10087692 Ga0111539_100876922 292
262 3300009094 Ga0111539_10359989 Ga0111539_103599892 292
263 3300009177 Ga0105248_10001074 Ga0105248_1000107413 292
264 3300009177 Ga0105248_10010278 Ga0105248_100102782 292
265 3300009177 Ga0105248_10010640 Ga0105248_100106408 292
266 3300009177 Ga0105248_10057097 Ga0105248_100570975 292
267 3300009177 Ga0105248_10233303 Ga0105248_102333032 292
268 3300009551 Ga0105238_10004794 Ga0105238_100047942 292
269 3300009551 Ga0105238_10198701 Ga0105238_101987012 292
270 3300009553 Ga0105249_10047155 Ga0105249_100471552 292
271 3300009553 Ga0105249_10085168 Ga0105249_100851682 292
272 3300013100 Ga0157373_10056276 Ga0157373_100562763 292
273 3300013100 Ga0157373_10162735 Ga0157373_101627352 292
274 3300013102 Ga0157371_10018061 Ga0157371_100180612 292
275 3300013102 Ga0157371_10337980 Ga0157371_103379801 292
276 3300013104 Ga0157370_10105456 Ga0157370_101054563 292
277 3300013104 Ga0157370_10143116 Ga0157370_101431162 292
278 3300013104 Ga0157370_10261271 Ga0157370_102612711 292
279 3300013105 Ga0157369_10002615 Ga0157369_100026155 292
280 3300013105 Ga0157369_10017149 Ga0157369_100171492 292
281 3300013105 Ga0157369_10162445 Ga0157369_101624452 292
282 3300013306 Ga0163162_10014337 Ga0163162_100143372 292
283 3300013307 Ga0157372_10002970 Ga0157372_1000297016 292
284 3300013308 Ga0157375_10057975 Ga0157375_100579755 292
285 3300013308 Ga0157375_10205807 Ga0157375_102058072 292
286 3300013308 Ga0157375_10619148 Ga0157375_106191481 292
287 3300014325 Ga0163163_10001010 Ga0163163_1000101010 292
288 3300014325 Ga0163163_10029780 Ga0163163_100297805 292
289 3300014326 Ga0157380_10011701 Ga0157380_100117012 292
290 3300014326 Ga0157380_10052391 Ga0157380_100523912 292
291 3300014968 Ga0157379_10005135 Ga0157379_1000513513 292
292 3300017792 Ga0163161_10083730 Ga0163161_100837302 292
293 3300017792 Ga0163161_10118315 Ga0163161_101183152 292
294 3300025315 Ga0207697_10004622 Ga0207697_100046223 292
295 3300025321 Ga0207656_10010956 Ga0207656_100109565 292
296 3300025893 Ga0207682_10000527 Ga0207682_100005272 292
297 3300025893 Ga0207682_10010107 Ga0207682_100101072 292
298 3300025901 Ga0207688_10010292 Ga0207688_100102922 292
299 3300025901 Ga0207688_10060488 Ga0207688_100604882 292
300 3300025901 Ga0207688_10178850 Ga0207688_101788502 292
301 3300025904 Ga0207647_10024741 Ga0207647_100247412 292
302 3300025904 Ga0207647_10072117 Ga0207647_100721172 292
303 3300025907 Ga0207645_10141728 Ga0207645_101417282 292
304 3300025907 Ga0207645_10142611 Ga0207645_101426112 292
305 3300025907 Ga0207645_10198911 Ga0207645_101989112 292
306 3300025909 Ga0207705_10000212 Ga0207705_1000021237 292
307 3300025909 Ga0207705_10012187 Ga0207705_100121873 292
308 3300025909 Ga0207705_10013882 Ga0207705_100138827 292
309 3300025909 Ga0207705_10026828 Ga0207705_100268283 292
310 3300025913 Ga0207695_10316623 Ga0207695_103166232 292
311 3300025917 Ga0207660_10009002 Ga0207660_100090025 292
312 3300025917 Ga0207660_10285476 Ga0207660_102854762 292
313 3300025919 Ga0207657_10000638 Ga0207657_1000063824 292
314 3300025919 Ga0207657_10007988 Ga0207657_1000798810 292
315 3300025919 Ga0207657_10111679 Ga0207657_101116792 292
316 3300025919 Ga0207657_10165519 Ga0207657_101655192 292
317 3300025920 Ga0207649_10000304 Ga0207649_1000030425 292
318 3300025920 Ga0207649_10029557 Ga0207649_100295572 292
319 3300025921 Ga0207652_10112754 Ga0207652_101127542 292
320 3300025923 Ga0207681_10002811 Ga0207681_1000281110 292
321 3300025923 Ga0207681_10027816 Ga0207681_100278164 292
322 3300025923 Ga0207681_10036269 Ga0207681_100362692 292
323 3300025923 Ga0207681_10157473 Ga0207681_101574731 292
324 3300025923 Ga0207681_10193124 Ga0207681_101931242 292
325 3300025923 Ga0207681_10306939 Ga0207681_103069392 292
326 3300025924 Ga0207694_10020412 Ga0207694_100204128 292
327 3300025924 Ga0207694_10200087 Ga0207694_102000872 292
328 3300025925 Ga0207650_10002625 Ga0207650_100026258 292
329 3300025925 Ga0207650_10008254 Ga0207650_100082548 292
330 3300025925 Ga0207650_10011146 Ga0207650_100111467 292
331 3300025925 Ga0207650_10018464 Ga0207650_100184646 292
332 3300025925 Ga0207650_10021270 Ga0207650_100212702 292
333 3300025926 Ga0207659_10000877 Ga0207659_100008779 292
334 3300025926 Ga0207659_10036003 Ga0207659_100360035 292
335 3300025926 Ga0207659_10114456 Ga0207659_101144561 292
336 3300025929 Ga0207664_10006488 Ga0207664_100064888 292
337 3300025929 Ga0207664_10007948 Ga0207664_1000794811 292
338 3300025931 Ga0207644_10001989 Ga0207644_100019899 292
339 3300025931 Ga0207644_10011810 Ga0207644_100118106 292
340 3300025931 Ga0207644_10018897 Ga0207644_100188975 292
341 3300025931 Ga0207644_10028914 Ga0207644_100289142 292
342 3300025931 Ga0207644_10031819 Ga0207644_100318193 292
343 3300025932 Ga0207690_10000264 Ga0207690_1000026418 292
344 3300025932 Ga0207690_10069941 Ga0207690_100699412 292
345 3300025933 Ga0207706_10000639 Ga0207706_1000063924 292
346 3300025933 Ga0207706_10001215 Ga0207706_1000121519 292
347 3300025933 Ga0207706_10008348 Ga0207706_100083487 292
348 3300025933 Ga0207706_10021226 Ga0207706_100212263 292
349 3300025933 Ga0207706_10099314 Ga0207706_100993142 292
350 3300025933 Ga0207706_10309549 Ga0207706_103095492 292
351 3300025934 Ga0207686_10123039 Ga0207686_101230392 292
352 3300025937 Ga0207669_10008218 Ga0207669_100082183 292
353 3300025938 Ga0207704_10202735 Ga0207704_102027352 292
354 3300025940 Ga0207691_10000878 Ga0207691_100008783 292
355 3300025940 Ga0207691_10010146 Ga0207691_100101468 292
356 3300025940 Ga0207691_10123357 Ga0207691_101233572 292
357 3300025941 Ga0207711_10000105 Ga0207711_1000010513 292
358 3300025941 Ga0207711_10001216 Ga0207711_1000121610 292
359 3300025941 Ga0207711_10006500 Ga0207711_100065004 292
360 3300025941 Ga0207711_10019212 Ga0207711_100192126 292
361 3300025941 Ga0207711_10075817 Ga0207711_100758173 292
362 3300025942 Ga0207689_10199171 Ga0207689_101991712 292
363 3300025942 Ga0207689_10264803 Ga0207689_102648032 292
364 3300025944 Ga0207661_10001647 Ga0207661_100016475 292
365 3300025944 Ga0207661_10009350 Ga0207661_100093509 292
366 3300025944 Ga0207661_10264956 Ga0207661_102649562 292
367 3300025945 Ga0207679_10000191 Ga0207679_1000019153 292
368 3300025945 Ga0207679_10002027 Ga0207679_1000202710 292
369 3300025945 Ga0207679_10033400 Ga0207679_100334002 292
370 3300025945 Ga0207679_10095670 Ga0207679_100956701 292
371 3300025945 Ga0207679_10310641 Ga0207679_103106412 292
372 3300025949 Ga0207667_10001227 Ga0207667_1000122711 292
373 3300025949 Ga0207667_10070885 Ga0207667_100708854 292
374 3300025960 Ga0207651_10007231 Ga0207651_100072318 292
375 3300025960 Ga0207651_10062498 Ga0207651_100624982 292
376 3300025960 Ga0207651_10126433 Ga0207651_101264332 292
377 3300025960 Ga0207651_10155666 Ga0207651_101556662 292
378 3300025961 Ga0207712_10013271 Ga0207712_100132715 292
379 3300025961 Ga0207712_10034390 Ga0207712_100343902 292
380 3300025972 Ga0207668_10493337 Ga0207668_104933372 292
381 3300025981 Ga0207640_10061806 Ga0207640_100618062 292
382 3300025981 Ga0207640_10208454 Ga0207640_102084542 292
383 3300025986 Ga0207658_10003869 Ga0207658_100038695 292
384 3300025986 Ga0207658_10010411 Ga0207658_100104115 292
385 3300025986 Ga0207658_10017239 Ga0207658_100172398 292
386 3300025986 Ga0207658_10189557 Ga0207658_101895572 292
387 3300026035 Ga0207703_10026142 Ga0207703_100261423 292
388 3300026041 Ga0207639_10000179 Ga0207639_1000017943 292
389 3300026041 Ga0207639_10002119 Ga0207639_100021194 292
390 3300026041 Ga0207639_10073426 Ga0207639_100734261 292
391 3300026041 Ga0207639_10107765 Ga0207639_101077652 292
392 3300026041 Ga0207639_10116685 Ga0207639_101166852 292
393 3300026067 Ga0207678_10002101 Ga0207678_100021012 292
394 3300026067 Ga0207678_10018822 Ga0207678_100188226 292
395 3300026067 Ga0207678_10132933 Ga0207678_101329333 292
396 3300026075 Ga0207708_10048527 Ga0207708_100485274 292
397 3300026078 Ga0207702_10000413 Ga0207702_1000041325 292
398 3300026078 Ga0207702_10372358 Ga0207702_103723582 292
399 3300026088 Ga0207641_10000172 Ga0207641_1000017282 292
400 3300026088 Ga0207641_10109019 Ga0207641_101090192 292
401 3300026089 Ga0207648_10009427 Ga0207648_100094278 292
402 3300026089 Ga0207648_10032670 Ga0207648_100326702 292
403 3300026095 Ga0207676_10002051 Ga0207676_1000205113 292
404 3300026095 Ga0207676_10098256 Ga0207676_100982561 292
405 3300026095 Ga0207676_10101102 Ga0207676_101011022 292
406 3300026116 Ga0207674_10006642 Ga0207674_100066424 292
407 3300026116 Ga0207674_10074107 Ga0207674_100741072 292
408 3300026118 Ga0207675_100010422 Ga0207675_1000104227 292
409 3300026121 Ga0207683_10012717 Ga0207683_100127175 292
410 3300026142 Ga0207698_10002088 Ga0207698_1000208810 292
411 3300026142 Ga0207698_10013588 Ga0207698_100135886 292
412 3300026142 Ga0207698_10025863 Ga0207698_100258632 292
413 3300026142 Ga0207698_10151533 Ga0207698_101515332 292
414 3300026142 Ga0207698_10245407 Ga0207698_102454072 292
415 3300028379 Ga0268266_10003318 Ga0268266_100033188 292
416 3300028379 Ga0268266_10367226 Ga0268266_103672262 292
417 3300028380 Ga0268265_10002567 Ga0268265_100025678 292
418 3300028380 Ga0268265_10053264 Ga0268265_100532642 292
419 3300028380 Ga0268265_10054823 Ga0268265_100548233 292
420 3300028380 Ga0268265_10074093 Ga0268265_100740932 292
421 3300028381 Ga0268264_10001846 Ga0268264_1000184614 292
422 3300028381 Ga0268264_10069881 Ga0268264_100698812 292
423 3300031548 Ga0307408_100371900 Ga0307408_1003719002 292
424 3300031731 Ga0307405_10039549 Ga0307405_100395493 292
425 3300031731 Ga0307405_10147199 Ga0307405_101471992 292
426 3300031731 Ga0307405_10235658 Ga0307405_102356581 292
427 3300031824 Ga0307413_10010653 Ga0307413_100106535 292
428 3300031852 Ga0307410_10006193 Ga0307410_100061937 292
429 3300031852 Ga0307410_10028784 Ga0307410_100287841 292
430 3300031901 Ga0307406_10119732 Ga0307406_101197322 292
431 3300031901 Ga0307406_10162844 Ga0307406_101628442 292
432 3300031901 Ga0307406_10204208 Ga0307406_102042082 292
433 3300031901 Ga0307406_10275826 Ga0307406_102758262 292
434 3300031903 Ga0307407_10007557 Ga0307407_100075572 292
435 3300031911 Ga0307412_10037987 Ga0307412_100379871 292
436 3300031911 Ga0307412_10092000 Ga0307412_100920002 292
437 3300031995 Ga0307409_100004691 Ga0307409_10000469111 292
438 3300031995 Ga0307409_100220886 Ga0307409_1002208862 292
439 3300032002 Ga0307416_100008568 Ga0307416_1000085686 292
440 3300032002 Ga0307416_100010906 Ga0307416_1000109068 292
441 3300032002 Ga0307416_100103781 Ga0307416_1001037812 292
442 3300032002 Ga0307416_100211707 Ga0307416_1002117072 292
443 3300032002 Ga0307416_100276593 Ga0307416_1002765932 292
444 3300032002 Ga0307416_100286425 Ga0307416_1002864251 292
445 3300032002 Ga0307416_100472651 Ga0307416_1004726512 292
446 3300032004 Ga0307414_10002944 Ga0307414_100029445 292
447 3300032004 Ga0307414_10006121 Ga0307414_100061217 292
448 3300032004 Ga0307414_10006145 Ga0307414_100061454 292
449 3300032004 Ga0307414_10116153 Ga0307414_101161532 292
450 3300032005 Ga0307411_10000586 Ga0307411_100005863 292
451 3300032005 Ga0307411_10080211 Ga0307411_100802112 292
452 3300032005 Ga0307411_10463512 Ga0307411_104635121 292
453 3300032126 Ga0307415_100043322 Ga0307415_1000433225 292
454 3300037312 Ga0395899_0002299 Ga0395899_0002299_2229_3167 292
455 3300037312 Ga0395899_0018642 Ga0395899_0018642_3958_4881 292
456 3300037312 Ga0395899_0114131 Ga0395899_0114131_966_1886 292
457 3300037312 Ga0395899_0219863 Ga0395899_0219863_11_913 292
458 3300037418 Ga0395900_0001884 Ga0395900_0001884_4244_5182 292
459 3300037418 Ga0395900_0016277 Ga0395900_0016277_4634_5554 292
460 3300037418 Ga0395900_0020547 Ga0395900_0020547_887_1765 292
461 3300037418 Ga0395900_0044846 Ga0395900_0044846_1592_2530 292
462 3300037418 Ga0395900_0049948 Ga0395900_0049948_2225_3145 292
463 3300037418 Ga0395900_0091155 Ga0395900_0091155_2005_2928 292
464 3300037418 Ga0395900_0123505 Ga0395900_0123505_345_1265 292
465 3300037466 Ga0395898_0022238 Ga0395898_0022238_5307_6245 292
466 3300037466 Ga0395898_0043900 Ga0395898_0043900_935_1813 292
467 3300037466 Ga0395898_0123767 Ga0395898_0123767_1391_2314 292
468 3300037466 Ga0395898_0267226 Ga0395898_0267226_163_1101 292
469 3300037471 Ga0395905_0000940 Ga0395905_0000940_14204_15082 292
470 3300037471 Ga0395905_0015335 Ga0395905_0015335_4869_5807 292
471 3300037471 Ga0395905_0023644 Ga0395905_0023644_968_1888 292
472 3300037471 Ga0395905_0031015 Ga0395905_0031015_2633_3571 292
473 3300037471 Ga0395905_0033319 Ga0395905_0033319_3515_4453 292
474 3300037471 Ga0395905_0037428 Ga0395905_0037428_121_1047 292
475 3300037471 Ga0395905_0053971 Ga0395905_0053971_833_1753 292
476 3300037471 Ga0395905_0089990 Ga0395905_0089990_803_1786 292
477 3300037471 Ga0395905_0139689 Ga0395905_0139689_1294_2172 292
478 3300037471 Ga0395905_0144989 Ga0395905_0144989_55_933 292
479 3300037471 Ga0395905_0256585 Ga0395905_0256585_360_1283 292
480 3300037471 Ga0395905_0647545 Ga0395905_0647545_52_930 292
481 3300038443 Ga0395901_0001289 Ga0395901_0001289_5047_5985 292
482 3300038443 Ga0395901_0011872 Ga0395901_0011872_3277_4215 292
483 3300038443 Ga0395901_0012548 Ga0395901_0012548_3347_4267 292
484 3300038443 Ga0395901_0037623 Ga0395901_0037623_946_1866 292
485 3300038443 Ga0395901_0053642 Ga0395901_0053642_3037_3915 292
486 3300038443 Ga0395901_0492091 Ga0395901_0492091_204_1082 292
487 3300042120 Ga0450917_001103 Ga0450917_001103_339_1262 292
488 3300042144 Ga0450889_003880 Ga0450889_003880_128_1051 292
489 3300044684 Ga0466966_0000021 Ga0466966_0000021_28421_29398 292
490 3300044693 Ga0466961_0067351 Ga0466961_0067351_484_1410 292
491 3300044693 Ga0466961_0088698 Ga0466961_0088698_907_1833 292
492 3300044694 Ga0466963_0016310 Ga0466963_0016310_2811_3737 292
493 3300044842 Ga0466957_0000196 Ga0466957_0000196_17791_18717 292
494 3300045049 Ga0466959_0010835 Ga0466959_0010835_426_1352 292
495 3300045976 Ga0466967_0003640 Ga0466967_0003640_4366_5292 292
496 3300045976 Ga0466967_0021699 Ga0466967_0021699_2652_3590 292
497 3300045976 Ga0466967_0352859 Ga0466967_0352859_205_1143 292
498 3300046492 Ga0495585_0010304 Ga0495585_0010304_4003_4926 292
499 3300046525 Ga0495663_0001608 Ga0495663_0001608_4098_5021 292
500 3300046525 Ga0495663_0001665 Ga0495663_0001665_1792_2715 292
501 3300046528 Ga0495642_0021481 Ga0495642_0021481_532_1455 292
502 3300046537 Ga0495598_0000355 Ga0495598_0000355_4107_5030 292
503 3300046537 Ga0495598_0007997 Ga0495598_0007997_1373_2296 292
504 3300046537 Ga0495598_0013226 Ga0495598_0013226_524_1450 292
505 3300046539 Ga0495621_0001079 Ga0495621_0001079_4246_5169 292
506 3300046539 Ga0495621_0003905 Ga0495621_0003905_2312_3238 292
507 3300046539 Ga0495621_0005019 Ga0495621_0005019_657_1580 292
508 3300046539 Ga0495621_0025089 Ga0495621_0025089_853_1776 292
509 3300046539 Ga0495621_0059896 Ga0495621_0059896_180_1058 292
510 3300046558 Ga0495633_0010639 Ga0495633_0010639_1906_2829 292
511 3300046616 Ga0495668_0003644 Ga0495668_0003644_9036_9959 292
512 3300046664 Ga0495659_0003377 Ga0495659_0003377_2337_3260 292
513 3300046664 Ga0495659_0005087 Ga0495659_0005087_1101_2024 292
514 3300046664 Ga0495659_0042444 Ga0495659_0042444_391_1317 292
515 3300046665 Ga0495661_0016408 Ga0495661_0016408_2370_3293 292
516 3300046684 Ga0495669_0000570 Ga0495669_0000570_11122_12045 292
517 3300046684 Ga0495669_0016808 Ga0495669_0016808_842_1765 292
518 3300046691 Ga0495670_0015651 Ga0495670_0015651_1791_2714 292
519 3300046691 Ga0495670_0028722 Ga0495670_0028722_1558_2481 292
520 3300046691 Ga0495670_0036816 Ga0495670_0036816_615_1538 292
521 3300046691 Ga0495670_0047004 Ga0495670_0047004_979_1899 292
522 3300047445 Ga0495677_0003145 Ga0495677_0003145_4633_5556 292
523 3300047445 Ga0495677_0087165 Ga0495677_0087165_13_936 292
524 3300048903 Ga0496100_0059744 Ga0496100_0059744_77_955 292
525 3300048904 Ga0496101_0011204 Ga0496101_0011204_3333_4211 292
526 3300048904 Ga0496101_0354588 Ga0496101_0354588_91_1023 292
527 3300048912 Ga0496109_0017447 Ga0496109_0017447_5310_6233 292
528 3300048913 Ga0496110_0002543 Ga0496110_0002543_5614_6537 292
529 3300048914 Ga0496111_0004244 Ga0496111_0004244_2447_3370 292
530 3300048917 Ga0496114_0087718 Ga0496114_0087718_341_1219 292
531 3300050511 nmdc:mga08y16_72472_c1 nmdc:mga08y16_72472_c1_2407_3333 292
532 3300053134 Ga0500658_0000585 Ga0500658_0000585_13403_14329 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01112

Asparaginase_2

Asparaginase

10

307

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gez-assembly1.cif.gz_A crystal structure of potassium-independent plant asparaginase 0.9645 1 144
7qyx-assembly1.cif.gz_BBB structure of e.coli class 2 l-asparaginase ecaiii, mutant rdm1-24 (r207a, d210s, s211t) 0.9619 156 286
8bqo-assembly1.cif.gz_AAA structure of e.coli class 2 l-asparaginase ecaiii, mutant m200i 0.9619 1 145
8bkf-assembly1.cif.gz_BBB structure of e. coli class 2 l-asparaginase ecaiii, mutant m200t (crystal m200t#o) 0.9618 156 287
8bqo-assembly1.cif.gz_DDD structure of e.coli class 2 l-asparaginase ecaiii, mutant m200i 0.9616 156 286
ID Description Score Start End Superfamily
1k2xB00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase 0.9627 156 287 3.60.20.30
af_Q7L266_168_305_3.60.20.30 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase 0.9475 156 287 3.60.20.30
af_E7FA20_798_925_3.60.20.30 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase 0.9449 156 284 3.60.20.30
af_Q9VXT7_188_321_3.60.20.30 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase 0.9425 156 287 3.60.20.30
1k2xB00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase 0.9351 156 287 3.60.20.30
ID Description Score Start End GO Terms
AF-A0A4S2GQC2-F1-model_v4 Isoaspartyl peptidase/L-asparaginase 0.9766 179 264 GO:0016787
AF-A0A4Y9RHV3-F1-model_v4 Beta-aspartyl-peptidase 0.9762 1 145 GO:0016787
AF-A0A534CLU1-F1-model_v4 Isoaspartyl peptidase/L-asparaginase 0.9753 1 134 GO:0016787
AF-A0A7X1K5G9-F1-model_v4 deleted 0.9745 33 142
AF-A0A521W9I7-F1-model_v4 Isoaspartyl peptidase/L-asparaginase 0.9744 1 140 GO:0016787

Feature Viewer

pLDDT pTM Quality
86.47 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map