F460283

General Info

Members Datasets Scaffolds Average Seq Length
532 260 1064 107

Family's Representative Sequence

Representative Sequence 3300026088|Ga0207641_10383355|Ga0207641_103833551
Length 123
Sequence MNLQLTGHHVDITPAIRKYVVTKLERIERHFDHVIDVNVVMTVEKLDQKIEANVHLAGKEIHCECHEVDMYAAIDGLIDKLDRQVVKHKEKFKSNTRHSPGTIRQLPALGAKSAGSGFSSQVA

Samples

Sample ID Description Type Environment
1 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
191 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
203 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
204 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
205 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
206 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
207 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
212 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
213 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
214 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
217 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
241 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
242 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
243 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
244 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
245 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
246 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
258 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
260 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0.94
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.76
Nodule 0
Rhizoplane 1.69
Rhizosphere 93.42
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207641_10383355 3300026088 Bacteria 1347
2 Ga0070658_10004064 3300005327 Bacteria 11996
3 Ga0070658_10440947 3300005327 Bacteria 1121
4 Ga0070658_11897317 3300005327 Bacteria 515
5 Ga0070676_10498886 3300005328 Bacteria 864
6 Ga0070676_10519757 3300005328 Bacteria 848
7 Ga0070676_11274005 3300005328 Bacteria 561
8 Ga0070683_100012926 3300005329 Bacteria 7266
9 Ga0070683_101077456 3300005329 Bacteria 772
10 Ga0070690_101040006 3300005330 Bacteria 647
11 Ga0070690_101342169 3300005330 Bacteria 574
12 Ga0070670_101993366 3300005331 Bacteria 535
13 Ga0070677_10039108 3300005333 Bacteria 1860
14 Ga0068869_100261777 3300005334 Bacteria 1385
15 Ga0070666_10744898 3300005335 Bacteria 720
16 Ga0070680_100017626 3300005336 Bacteria 5633
17 Ga0070680_100096304 3300005336 Bacteria 2454
18 Ga0070680_100431467 3300005336 Bacteria 1125
19 Ga0070682_100040696 3300005337 Bacteria 2860
20 Ga0068868_100025276 3300005338 Bacteria 4515
21 Ga0068868_100291409 3300005338 Bacteria 1384
22 Ga0068868_100877802 3300005338 Bacteria 814
23 Ga0068868_101837936 3300005338 Bacteria 573
24 Ga0070660_100355743 3300005339 Bacteria 1206
25 Ga0070660_100522465 3300005339 Bacteria 989
26 Ga0070689_100193767 3300005340 Bacteria 1656
27 Ga0070689_100721829 3300005340 Bacteria 872
28 Ga0070687_100239719 3300005343 Bacteria 1121
29 Ga0070687_100309199 3300005343 Bacteria 1006
30 Ga0070661_100036646 3300005344 Bacteria 3565
31 Ga0070661_100970726 3300005344 Bacteria 704
32 Ga0070692_10124298 3300005345 Bacteria 1443
33 Ga0070692_10797424 3300005345 Bacteria 645
34 Ga0070692_11007303 3300005345 Bacteria 583
35 Ga0070692_11064705 3300005345 Bacteria 569
36 Ga0070669_100344351 3300005353 Bacteria 1209
37 Ga0070675_100037600 3300005354 Bacteria 3944
38 Ga0070675_100045961 3300005354 Bacteria 3575
39 Ga0070675_100722622 3300005354 Bacteria 908
40 Ga0070671_100559463 3300005355 Bacteria 987
41 Ga0070671_100611987 3300005355 Bacteria 942
42 Ga0070674_100260273 3300005356 Bacteria 1366
43 Ga0070674_100378668 3300005356 Bacteria 1151
44 Ga0070674_100409536 3300005356 Bacteria 1110
45 Ga0070674_100495373 3300005356 Bacteria 1017
46 Ga0070673_100079991 3300005364 Bacteria 2647
47 Ga0070673_100146317 3300005364 Bacteria 1998
48 Ga0070688_100069533 3300005365 Bacteria 2248
49 Ga0070688_100124016 3300005365 Bacteria 1734
50 Ga0070659_100433286 3300005366 Bacteria 1113
51 Ga0070667_101425491 3300005367 Bacteria 650
52 Ga0070709_10529888 3300005434 Bacteria 899
53 Ga0070714_100095163 3300005435 Bacteria 2615
54 Ga0070714_100353336 3300005435 Bacteria 1381
55 Ga0070713_100604658 3300005436 Bacteria 1042
56 Ga0070713_100651500 3300005436 Bacteria 1003
57 Ga0070713_101545841 3300005436 Bacteria 644
58 Ga0070710_10706671 3300005437 Bacteria 712
59 Ga0070710_11102760 3300005437 Bacteria 583
60 Ga0070701_10105202 3300005438 Bacteria 1569
61 Ga0070701_10154080 3300005438 Bacteria 1326
62 Ga0070711_100204511 3300005439 Bacteria 1526
63 Ga0070705_100143439 3300005440 Bacteria 1575
64 Ga0070705_101164941 3300005440 Bacteria 634
65 Ga0070700_100080910 3300005441 Bacteria 2097
66 Ga0070700_100910586 3300005441 Bacteria 717
67 Ga0070694_101893563 3300005444 Bacteria 509
68 Ga0070678_100262245 3300005456 Bacteria 1454
69 Ga0070678_100655920 3300005456 Bacteria 942
70 Ga0070662_100952363 3300005457 Bacteria 734
71 Ga0070681_10018054 3300005458 Bacteria 7049
72 Ga0070681_10526151 3300005458 Bacteria 1096
73 Ga0070681_10854633 3300005458 Bacteria 828
74 Ga0070681_11459983 3300005458 Bacteria 608
75 Ga0068867_100085893 3300005459 Bacteria 2379
76 Ga0068867_100692315 3300005459 Bacteria 898
77 Ga0068867_101567209 3300005459 Bacteria 615
78 Ga0068867_102276773 3300005459 Bacteria 515
79 Ga0070685_10041658 3300005466 Bacteria 2618
80 Ga0070685_10197822 3300005466 Bacteria 1305
81 Ga0070706_102049065 3300005467 Bacteria 518
82 Ga0070698_100131883 3300005471 Bacteria 2454
83 Ga0070699_100052995 3300005518 Bacteria 3511
84 Ga0070699_101038095 3300005518 Bacteria 752
85 Ga0070679_100068758 3300005530 Bacteria 3533
86 Ga0070679_100088421 3300005530 Bacteria 3085
87 Ga0070679_100288919 3300005530 Bacteria 1591
88 Ga0070679_100750450 3300005530 Bacteria 919
89 Ga0070684_100127461 3300005535 Bacteria 2294
90 Ga0070684_100474389 3300005535 Bacteria 1158
91 Ga0070697_100358949 3300005536 Bacteria 1260
92 Ga0070697_101846306 3300005536 Bacteria 541
93 Ga0068853_100019107 3300005539 Bacteria 5678
94 Ga0068853_100022090 3300005539 Bacteria 5310
95 Ga0068853_101737457 3300005539 Bacteria 605
96 Ga0070672_100051228 3300005543 Bacteria 3218
97 Ga0070672_100210086 3300005543 Bacteria 1630
98 Ga0070686_100687275 3300005544 Bacteria 815
99 Ga0070695_101719974 3300005545 Bacteria 525
100 Ga0070696_100043500 3300005546 Bacteria 3107
101 Ga0070696_100393971 3300005546 Bacteria 1082
102 Ga0070693_100055279 3300005547 Bacteria 2286
103 Ga0070693_100173541 3300005547 Bacteria 1382
104 Ga0070665_100313519 3300005548 Bacteria 1573
105 Ga0070665_101697586 3300005548 Bacteria 639
106 Ga0070704_100190839 3300005549 Bacteria 1647
107 Ga0068855_100004693 3300005563 Bacteria 16702
108 Ga0068855_100014349 3300005563 Bacteria 9539
109 Ga0068855_100871823 3300005563 Bacteria 952
110 Ga0070664_100112044 3300005564 Bacteria 2382
111 Ga0070664_100795994 3300005564 Bacteria 884
112 Ga0070664_102384259 3300005564 Bacteria 502
113 Ga0068857_100013438 3300005577 Bacteria 7132
114 Ga0068857_100025753 3300005577 Bacteria 5179
115 Ga0068857_100505164 3300005577 Bacteria 1135
116 Ga0068854_100006930 3300005578 Bacteria 7228
117 Ga0068854_100590415 3300005578 Bacteria 947
118 Ga0068856_100142967 3300005614 Bacteria 2400
119 Ga0068856_100156552 3300005614 Bacteria 2288
120 Ga0068856_100518030 3300005614 Bacteria 1214
121 Ga0070702_100105946 3300005615 Bacteria 1734
122 Ga0070702_100261937 3300005615 Bacteria 1178
123 Ga0068852_100000254 3300005616 Bacteria 36057
124 Ga0068852_100009086 3300005616 Bacteria 7359
125 Ga0068852_100012864 3300005616 Bacteria 6378
126 Ga0068852_100052417 3300005616 Bacteria 3506
127 Ga0068852_100060465 3300005616 Bacteria 3288
128 Ga0068852_101109983 3300005616 Bacteria 811
129 Ga0068852_101209744 3300005616 Bacteria 777
130 Ga0068852_101795580 3300005616 Bacteria 636
131 Ga0068859_100081573 3300005617 Bacteria 3277
132 Ga0068866_10392667 3300005718 Bacteria 893
133 Ga0068866_10397816 3300005718 Bacteria 888
134 Ga0068861_101684743 3300005719 Bacteria 627
135 Ga0068851_10002016 3300005834 Bacteria 8953
136 Ga0068851_10144977 3300005834 Bacteria 1294
137 Ga0068851_10443678 3300005834 Bacteria 770
138 Ga0068870_10417926 3300005840 Bacteria 877
139 Ga0068870_10529767 3300005840 Bacteria 790
140 Ga0068863_100299770 3300005841 Bacteria 1559
141 Ga0068858_100311795 3300005842 Bacteria 1502
142 Ga0068858_100629534 3300005842 Bacteria 1042
143 Ga0068858_101629613 3300005842 Bacteria 637
144 Ga0068858_101766355 3300005842 Bacteria 611
145 Ga0070717_10069659 3300006028 Bacteria 2930
146 Ga0075365_10955660 3300006038 Bacteria 604
147 Ga0075363_100956590 3300006048 Bacteria 526
148 Ga0075364_10048752 3300006051 Bacteria 2760
149 Ga0075432_10082442 3300006058 Bacteria 1168
150 Ga0075432_10369678 3300006058 Bacteria 612
151 Ga0075432_10377136 3300006058 Bacteria 607
152 Ga0075362_10362239 3300006177 Bacteria 727
153 Ga0075362_10451335 3300006177 Bacteria 653
154 Ga0075367_10796467 3300006178 Bacteria 602
155 Ga0075369_10071963 3300006186 Bacteria 1523
156 Ga0075366_10019840 3300006195 Bacteria 3895
157 Ga0075366_10021104 3300006195 Bacteria 3786
158 Ga0075366_10430853 3300006195 Bacteria 813
159 Ga0097621_100012830 3300006237 Bacteria 6224
160 Ga0097621_100605586 3300006237 Bacteria 1002
161 Ga0097621_100902496 3300006237 Bacteria 823
162 Ga0068871_100041820 3300006358 Bacteria 3676
163 Ga0068871_100232069 3300006358 Bacteria 1602
164 Ga0068871_100594736 3300006358 Bacteria 1006
165 Ga0068871_100898810 3300006358 Bacteria 821
166 Ga0075428_100011836 3300006844 Bacteria 9708
167 Ga0075431_101071846 3300006847 Bacteria 771
168 Ga0075433_10218148 3300006852 Bacteria 1695
169 Ga0075433_11580461 3300006852 Bacteria 566
170 Ga0075434_100059321 3300006871 Bacteria 3804
171 Ga0075434_101838901 3300006871 Bacteria 612
172 Ga0068865_100875388 3300006881 Bacteria 780
173 Ga0075436_100002584 3300006914 Bacteria 12445
174 Ga0075436_100790606 3300006914 Bacteria 706
175 Ga0097620_100081575 3300006931 Bacteria 3277
176 Ga0075435_100194025 3300007076 Bacteria 1719
177 Ga0105240_10035335 3300009093 Bacteria 6442
178 Ga0105240_10056757 3300009093 Bacteria 4897
179 Ga0105240_10063439 3300009093 Bacteria 4596
180 Ga0105240_10874831 3300009093 Bacteria 968
181 Ga0111539_10001826 3300009094 Bacteria 28335
182 Ga0105245_10316194 3300009098 Bacteria 1537
183 Ga0105245_10421741 3300009098 Bacteria 1337
184 Ga0105245_10522438 3300009098 Bacteria 1206
185 Ga0105245_10912224 3300009098 Bacteria 920
186 Ga0105245_11393342 3300009098 Bacteria 751
187 Ga0105243_10365631 3300009148 Bacteria 1329
188 Ga0105243_10452292 3300009148 Bacteria 1205
189 Ga0105243_11195692 3300009148 Bacteria 773
190 Ga0105243_11296390 3300009148 Bacteria 745
191 Ga0105243_11300737 3300009148 Bacteria 744
192 Ga0105241_10011678 3300009174 Bacteria 6447
193 Ga0105241_10023794 3300009174 Bacteria 4545
194 Ga0105241_10206681 3300009174 Bacteria 1643
195 Ga0105241_10299669 3300009174 Bacteria 1379
196 Ga0105242_10004748 3300009176 Bacteria 10522
197 Ga0105242_10401168 3300009176 Bacteria 1280
198 Ga0105242_10562595 3300009176 Bacteria 1095
199 Ga0105242_13269424 3300009176 Bacteria 504
200 Ga0105248_10045282 3300009177 Bacteria 4934
201 Ga0105248_10327004 3300009177 Bacteria 1727
202 Ga0105248_11303228 3300009177 Bacteria 822
203 Ga0105248_11317214 3300009177 Bacteria 817
204 Ga0105248_11786028 3300009177 Bacteria 697
205 Ga0105248_12540795 3300009177 Bacteria 584
206 Ga0105237_10229657 3300009545 Bacteria 1857
207 Ga0105237_10794417 3300009545 Bacteria 953
208 Ga0105237_11112653 3300009545 Bacteria 797
209 Ga0105237_11696419 3300009545 Bacteria 639
210 Ga0105238_10003397 3300009551 Bacteria 15895
211 Ga0105238_10022825 3300009551 Bacteria 6378
212 Ga0105238_10039577 3300009551 Bacteria 4780
213 Ga0105238_10292407 3300009551 Bacteria 1611
214 Ga0105238_10313222 3300009551 Bacteria 1555
215 Ga0105238_10655444 3300009551 Bacteria 1060
216 Ga0105238_11282119 3300009551 Bacteria 758
217 Ga0105238_11512570 3300009551 Bacteria 700
218 Ga0105249_10467964 3300009553 Bacteria 1301
219 Ga0105249_11154889 3300009553 Bacteria 845
220 Ga0105239_10279615 3300010375 Bacteria 1879
221 Ga0105239_10853422 3300010375 Bacteria 1044
222 Ga0105239_12442180 3300010375 Bacteria 609
223 Ga0105239_12619759 3300010375 Bacteria 588
224 Ga0157329_1012060 3300012491 Bacteria 702
225 Ga0157373_10383110 3300013100 Bacteria 1006
226 Ga0157371_10023455 3300013102 Bacteria 4512
227 Ga0157371_10088807 3300013102 Bacteria 2189
228 Ga0157370_10814645 3300013104 Bacteria 849
229 Ga0157369_10002524 3300013105 Bacteria 21881
230 Ga0157369_10077702 3300013105 Bacteria 3557
231 Ga0157369_10370990 3300013105 Bacteria 1486
232 Ga0157369_11800162 3300013105 Bacteria 622
233 Ga0157374_11913233 3300013296 Bacteria 619
234 Ga0157378_10615262 3300013297 Bacteria 1099
235 Ga0157378_11178592 3300013297 Bacteria 805
236 Ga0163162_10065955 3300013306 Bacteria 3669
237 Ga0163162_10135416 3300013306 Bacteria 2574
238 Ga0163162_11356620 3300013306 Bacteria 809
239 Ga0163162_12894147 3300013306 Bacteria 552
240 Ga0157372_10026804 3300013307 Bacteria 6273
241 Ga0157372_10046255 3300013307 Bacteria 4831
242 Ga0157372_10098767 3300013307 Bacteria 3331
243 Ga0157372_10762777 3300013307 Bacteria 1125
244 Ga0157372_12666676 3300013307 Bacteria 573
245 Ga0157375_10139435 3300013308 Bacteria 2551
246 Ga0157375_12334193 3300013308 Bacteria 638
247 Ga0163163_10563540 3300014325 Bacteria 1202
248 Ga0157380_10017395 3300014326 Bacteria 5320
249 Ga0157380_10341719 3300014326 Bacteria 1397
250 Ga0157380_11721487 3300014326 Bacteria 685
251 Ga0157380_11849108 3300014326 Bacteria 664
252 Ga0157380_11989570 3300014326 Bacteria 643
253 Ga0157380_12205547 3300014326 Bacteria 615
254 Ga0182008_10047237 3300014497 Bacteria 2139
255 Ga0157377_10164309 3300014745 Bacteria 1383
256 Ga0157377_10277736 3300014745 Bacteria 1097
257 Ga0157379_10027667 3300014968 Bacteria 5048
258 Ga0157379_11538894 3300014968 Bacteria 648
259 Ga0157379_11652689 3300014968 Bacteria 626
260 Ga0157376_10163539 3300014969 Bacteria 2020
261 Ga0157376_11952083 3300014969 Bacteria 624
262 Ga0157376_12887834 3300014969 Bacteria 520
263 Ga0163161_10070314 3300017792 Bacteria 2559
264 Ga0163161_10389773 3300017792 Bacteria 1115
265 Ga0197907_10049381 3300020069 Bacteria 1700
266 Ga0206356_10632517 3300020070 Bacteria 3643
267 Ga0206352_10660858 3300020078 Bacteria 755
268 Ga0206353_10160707 3300020082 Bacteria 2009
269 Ga0213876_10044224 3300021384 Bacteria 2354
270 Ga0224712_10089071 3300022467 Bacteria 1289
271 Ga0207697_10111586 3300025315 Bacteria 1171
272 Ga0207656_10001529 3300025321 Bacteria 7668
273 Ga0207656_10236800 3300025321 Bacteria 891
274 Ga0207682_10036379 3300025893 Bacteria 1992
275 Ga0207642_10231403 3300025899 Bacteria 1038
276 Ga0207688_10060868 3300025901 Bacteria 2128
277 Ga0207699_10013459 3300025906 Bacteria 4189
278 Ga0207699_10133860 3300025906 Bacteria 1621
279 Ga0207645_10064415 3300025907 Bacteria 2342
280 Ga0207645_10383085 3300025907 Bacteria 944
281 Ga0207643_10099266 3300025908 Bacteria 1706
282 Ga0207705_10039760 3300025909 Bacteria 3371
283 Ga0207705_10170151 3300025909 Bacteria 1640
284 Ga0207705_10181384 3300025909 Bacteria 1589
285 Ga0207705_10691712 3300025909 Bacteria 793
286 Ga0207705_10945429 3300025909 Bacteria 667
287 Ga0207705_10997907 3300025909 Bacteria 647
288 Ga0207654_10005423 3300025911 Bacteria 6451
289 Ga0207654_10204345 3300025911 Bacteria 1302
290 Ga0207654_10530228 3300025911 Bacteria 834
291 Ga0207654_10766535 3300025911 Bacteria 696
292 Ga0207707_10004510 3300025912 Bacteria 12245
293 Ga0207707_10012172 3300025912 Bacteria 7478
294 Ga0207707_10697395 3300025912 Bacteria 853
295 Ga0207707_10988679 3300025912 Bacteria 691
296 Ga0207695_10022239 3300025913 Bacteria 7209
297 Ga0207695_10026267 3300025913 Bacteria 6500
298 Ga0207695_10141166 3300025913 Bacteria 2357
299 Ga0207695_10229975 3300025913 Bacteria 1759
300 Ga0207695_11672402 3300025913 Bacteria 517
301 Ga0207693_11295217 3300025915 Bacteria 545
302 Ga0207660_10004556 3300025917 Bacteria 9038
303 Ga0207660_10387460 3300025917 Bacteria 1124
304 Ga0207660_11598150 3300025917 Bacteria 525
305 Ga0207662_10341206 3300025918 Bacteria 1004
306 Ga0207662_10345159 3300025918 Bacteria 998
307 Ga0207662_10500627 3300025918 Bacteria 836
308 Ga0207657_10098056 3300025919 Bacteria 2436
309 Ga0207657_10105831 3300025919 Bacteria 2328
310 Ga0207649_10005246 3300025920 Bacteria 7001
311 Ga0207649_10662840 3300025920 Bacteria 807
312 Ga0207652_10061303 3300025921 Bacteria 3248
313 Ga0207652_10097132 3300025921 Bacteria 2596
314 Ga0207652_10193426 3300025921 Bacteria 1830
315 Ga0207652_10784452 3300025921 Bacteria 847
316 Ga0207652_11007201 3300025921 Bacteria 732
317 Ga0207681_10592723 3300025923 Bacteria 915
318 Ga0207694_10079125 3300025924 Bacteria 2578
319 Ga0207694_10086086 3300025924 Bacteria 2474
320 Ga0207694_10130144 3300025924 Bacteria 2017
321 Ga0207694_10307487 3300025924 Bacteria 1306
322 Ga0207694_10345323 3300025924 Bacteria 1231
323 Ga0207694_10724986 3300025924 Bacteria 839
324 Ga0207659_10106035 3300025926 Bacteria 2127
325 Ga0207659_10223281 3300025926 Bacteria 1516
326 Ga0207659_10760082 3300025926 Bacteria 832
327 Ga0207659_11244628 3300025926 Bacteria 639
328 Ga0207687_10141398 3300025927 Bacteria 1826
329 Ga0207700_10250582 3300025928 Bacteria 1513
330 Ga0207700_10287154 3300025928 Bacteria 1417
331 Ga0207700_11126224 3300025928 Unclassified 701
332 Ga0207664_10091448 3300025929 Bacteria 2495
333 Ga0207664_10338678 3300025929 Bacteria 1330
334 Ga0207664_11528012 3300025929 Bacteria 589
335 Ga0207644_11721909 3300025931 Bacteria 525
336 Ga0207690_10475548 3300025932 Bacteria 1008
337 Ga0207706_10283926 3300025933 Bacteria 1443
338 Ga0207686_10004988 3300025934 Bacteria 7145
339 Ga0207686_10231769 3300025934 Bacteria 1339
340 Ga0207686_10276982 3300025934 Bacteria 1237
341 Ga0207686_11314680 3300025934 Bacteria 594
342 Ga0207686_11634682 3300025934 Bacteria 532
343 Ga0207709_10144368 3300025935 Bacteria 1640
344 Ga0207709_10266167 3300025935 Bacteria 1259
345 Ga0207709_10628029 3300025935 Bacteria 853
346 Ga0207670_10014182 3300025936 Bacteria 4722
347 Ga0207670_10064119 3300025936 Bacteria 2517
348 Ga0207669_10087677 3300025937 Bacteria 2016
349 Ga0207691_10018917 3300025940 Bacteria 6525
350 Ga0207691_10056959 3300025940 Bacteria 3559
351 Ga0207691_11540320 3300025940 Bacteria 542
352 Ga0207711_11214029 3300025941 Bacteria 696
353 Ga0207711_11519926 3300025941 Bacteria 613
354 Ga0207661_10907760 3300025944 Bacteria 811
355 Ga0207679_10260394 3300025945 Bacteria 1479
356 Ga0207667_10002090 3300025949 Bacteria 25032
357 Ga0207667_10009605 3300025949 Bacteria 11381
358 Ga0207667_10042923 3300025949 Bacteria 4802
359 Ga0207667_10180054 3300025949 Bacteria 2171
360 Ga0207651_10072026 3300025960 Bacteria 2452
361 Ga0207651_10094883 3300025960 Bacteria 2195
362 Ga0207712_11449941 3300025961 Bacteria 614
363 Ga0207640_10066307 3300025981 Bacteria 2412
364 Ga0207640_11126020 3300025981 Bacteria 695
365 Ga0207640_11504722 3300025981 Bacteria 605
366 Ga0207640_12015853 3300025981 Bacteria 523
367 Ga0207658_10447077 3300025986 Bacteria 1144
368 Ga0207677_10025133 3300026023 Bacteria 3711
369 Ga0207677_10129855 3300026023 Bacteria 1911
370 Ga0207703_10020762 3300026035 Bacteria 5139
371 Ga0207703_12183990 3300026035 Bacteria 530
372 Ga0207639_10021692 3300026041 Bacteria 4616
373 Ga0207639_10117579 3300026041 Bacteria 2179
374 Ga0207639_10353481 3300026041 Bacteria 1313
375 Ga0207639_10439388 3300026041 Bacteria 1183
376 Ga0207708_10058790 3300026075 Bacteria 2933
377 Ga0207708_11089683 3300026075 Bacteria 696
378 Ga0207702_10065510 3300026078 Bacteria 3112
379 Ga0207702_10102183 3300026078 Bacteria 2533
380 Ga0207702_10190514 3300026078 Bacteria 1894
381 Ga0207641_10252317 3300026088 Bacteria 1648
382 Ga0207641_10881878 3300026088 Bacteria 888
383 Ga0207648_10018110 3300026089 Bacteria 6378
384 Ga0207648_10085800 3300026089 Bacteria 2746
385 Ga0207648_10277286 3300026089 Bacteria 1499
386 Ga0207648_11050370 3300026089 Bacteria 763
387 Ga0207648_11282696 3300026089 Bacteria 688
388 Ga0207674_10005717 3300026116 Bacteria 14740
389 Ga0207675_100165704 3300026118 Bacteria 2110
390 Ga0207675_100333271 3300026118 Bacteria 1484
391 Ga0207675_100479836 3300026118 Bacteria 1236
392 Ga0207675_102036041 3300026118 Bacteria 591
393 Ga0207683_10380383 3300026121 Bacteria 1298
394 Ga0207683_10637211 3300026121 Bacteria 987
395 Ga0207698_10005304 3300026142 Bacteria 7941
396 Ga0207698_10038333 3300026142 Bacteria 3540
397 Ga0207698_10054525 3300026142 Bacteria 3076
398 Ga0207698_10120570 3300026142 Bacteria 2219
399 Ga0207698_11582852 3300026142 Bacteria 671
400 Ga0207698_11984628 3300026142 Bacteria 596
401 Ga0207698_12219418 3300026142 Bacteria 562
402 Ga0209974_10251462 3300027876 Bacteria 665
403 Ga0207428_10143936 3300027907 Bacteria 1818
404 Ga0207428_10166875 3300027907 Bacteria 1669
405 Ga0268266_10125834 3300028379 Bacteria 2287
406 Ga0268264_10131961 3300028381 Bacteria 2216
407 Ga0265332_10129594 3300031238 Bacteria 1058
408 Ga0265340_10170561 3300031247 Bacteria 986
409 Ga0265331_10192213 3300031250 Bacteria 921
410 Ga0307509_10459264 3300031507 Bacteria 966
411 Ga0307408_100257524 3300031548 Bacteria 1442
412 Ga0307408_100361392 3300031548 Bacteria 1235
413 Ga0307408_100499636 3300031548 Bacteria 1064
414 Ga0307405_10121518 3300031731 Bacteria 1788
415 Ga0307405_10235718 3300031731 Bacteria 1352
416 Ga0307405_11098042 3300031731 Bacteria 683
417 Ga0307405_11197564 3300031731 Bacteria 657
418 Ga0307413_10709002 3300031824 Bacteria 837
419 Ga0307410_10814151 3300031852 Bacteria 795
420 Ga0307410_11427218 3300031852 Bacteria 608
421 Ga0307410_12043220 3300031852 Bacteria 512
422 Ga0307406_10366554 3300031901 Bacteria 1131
423 Ga0307412_10079185 3300031911 Bacteria 2266
424 Ga0307412_10463975 3300031911 Bacteria 1046
425 Ga0307412_10556420 3300031911 Bacteria 964
426 Ga0307412_11416722 3300031911 Bacteria 629
427 Ga0307409_100022877 3300031995 Bacteria 4317
428 Ga0307409_100461735 3300031995 Bacteria 1228
429 Ga0307416_100236042 3300032002 Bacteria 1767
430 Ga0307416_100279764 3300032002 Bacteria 1644
431 Ga0307416_100291293 3300032002 Bacteria 1616
432 Ga0307416_100574914 3300032002 Bacteria 1203
433 Ga0307416_100645272 3300032002 Bacteria 1143
434 Ga0307416_101479350 3300032002 Bacteria 785
435 Ga0307416_102340339 3300032002 Bacteria 634
436 Ga0307414_10127559 3300032004 Bacteria 1969
437 Ga0307411_10556711 3300032005 Bacteria 979
438 Ga0307411_10567222 3300032005 Bacteria 971
439 Ga0307411_10901140 3300032005 Bacteria 786
440 Ga0307411_12107524 3300032005 Bacteria 528
441 Ga0307415_100475356 3300032126 Bacteria 1087
442 Ga0307415_101111480 3300032126 Bacteria 740
443 Ga0307415_101174116 3300032126 Bacteria 722
444 Ga0373958_0139674 3300034819 Bacteria 599
445 Ga0373944_0354465 3300035089 Bacteria 559
446 Ga0373931_0065454 3300035691 Bacteria 1970
447 Ga0373931_0203394 3300035691 Bacteria 1184
448 Ga0373931_0861773 3300035691 Bacteria 607
449 Ga0373935_0048668 3300035692 Bacteria 2685
450 Ga0373927_0286701 3300035695 Bacteria 1083
451 Ga0373937_0049030 3300036401 Bacteria 3867
452 Ga0373925_0515651 3300037068 Bacteria 982
453 Ga0395900_0063575 3300037418 Bacteria 3794
454 Ga0395900_0578879 3300037418 Bacteria 1065
455 Ga0395898_0130221 3300037466 Bacteria 2410
456 Ga0395898_1784719 3300037466 Bacteria 537
457 Ga0395905_0031170 3300037471 Bacteria 5021
458 Ga0395905_0293325 3300037471 Bacteria 1513
459 Ga0395901_0043034 3300038443 Bacteria 4684
460 Ga0395901_0412004 3300038443 Bacteria 1387
461 Ga0436365_1596890 3300039437 Bacteria 4923
462 Ga0439447_099941 3300041407 Bacteria 666
463 Ga0439453_0059022 3300041408 Bacteria 791
464 Ga0451789_0632955 3300041443 Bacteria 510
465 Ga0451793_1922151 3300041452 Bacteria 1083
466 Ga0451795_0081561 3300041456 Bacteria 673
467 Ga0451800_1189066 3300041459 Bacteria 512
468 Ga0451807_1253253 3300041486 Bacteria 765
469 Ga0451835_0967853 3300041492 Bacteria 622
470 Ga0451853_0166656 3300041512 Bacteria 2036
471 Ga0439441_007124 3300042001 Bacteria 1791
472 Ga0450923_036574 3300042125 Bacteria 1019
473 Ga0439446_0251782 3300042156 Bacteria 609
474 Ga0439435_0170362 3300042436 Bacteria 707
475 Ga0451577_0376517 3300042876 Bacteria 1288
476 Ga0466972_0211306 3300044658 Bacteria 908
477 Ga0453683_0253939 3300044673 Bacteria 1121
478 Ga0466966_0147805 3300044684 Bacteria 1434
479 Ga0466961_0032363 3300044693 Bacteria 3360
480 Ga0466963_0944117 3300044694 Bacteria 607
481 Ga0453684_1707413 3300044712 Bacteria 643
482 Ga0466971_0321607 3300044719 Bacteria 745
483 Ga0466957_0014006 3300044842 Bacteria 4664
484 Ga0466957_0718109 3300044842 Bacteria 706
485 Ga0466959_0464468 3300045049 Bacteria 857
486 Ga0451576_0452060 3300045051 Bacteria 1349
487 Ga0451576_0790020 3300045051 Bacteria 997
488 Ga0466958_0049225 3300045836 Bacteria 2549
489 Ga0466967_1184361 3300045976 Bacteria 761
490 Ga0495663_0253830 3300046525 Bacteria 625
491 Ga0495621_0008698 3300046539 Bacteria 3053
492 Ga0495621_0041524 3300046539 Bacteria 1616
493 Ga0495621_0067402 3300046539 Bacteria 1311
494 Ga0495635_1000095 3300046663 Bacteria 532
495 Ga0495646_0608555 3300046680 Bacteria 555
496 Ga0495658_0191631 3300046683 Bacteria 1271
497 Ga0495589_0168476 3300046794 Bacteria 1042
498 Ga0496104_0029274 3300048907 Bacteria 5108
499 Ga0496109_0103498 3300048912 Bacteria 2643
500 Ga0496110_0019539 3300048913 Bacteria 5704
501 Ga0496111_0582813 3300048914 Bacteria 820
502 Ga0501039_0547834 3300049575 Bacteria 908
503 Ga0501042_1354590 3300049578 Bacteria 519
504 Ga0501199_067193 3300049650 Bacteria 509
505 Ga0501217_067366 3300049661 Bacteria 968
506 Ga0501249_092341 3300049679 Bacteria 719
507 Ga0501261_062421 3300049690 Bacteria 636
508 Ga0501269_018763 3300049766 Bacteria 858
509 nmdc:mga03683_117006_c1 3300050489 Bacteria 1182
510 nmdc:mga03n38_882147_c1 3300050490 Bacteria 525
511 nmdc:mga00v17_48221_c1 3300050491 Bacteria 2581
512 nmdc:mga0k408_165272_c1 3300050493 Bacteria 1319
513 nmdc:mga0k408_23222_c1 3300050493 Bacteria 3497
514 nmdc:mga0k408_281452_c1 3300050493 Bacteria 993
515 nmdc:mga0k408_745634_c1 3300050493 Bacteria 572
516 nmdc:mga07m45_323760_c1 3300050496 Bacteria 896
517 nmdc:mga05p37_496227_c1 3300050507 Bacteria 1402
518 nmdc:mga09592_455373_c1 3300050508 Bacteria 1103
519 nmdc:mga08y16_295931_c1 3300050511 Bacteria 1669
520 nmdc:mga0n895_1538283_c1 3300050512 Bacteria 631
521 nmdc:mga0n895_317164_c1 3300050512 Bacteria 1580
522 nmdc:mga0rr50_179914_c1 3300050513 Bacteria 1728
523 nmdc:mga0rr50_375493_c1 3300050513 Bacteria 1198
524 nmdc:mga0rr50_573347_c1 3300050513 Bacteria 961
525 nmdc:mga0rr50_955338_c1 3300050513 Bacteria 730
526 nmdc:mga08x19_1030383_c1 3300050514 Bacteria 584
527 nmdc:mga08x19_3628_c1 3300050514 Bacteria 9188
528 nmdc:mga0a205_201645_c1 3300050515 Bacteria 1880
529 nmdc:mga0sz30_89787_c1 3300050516 Bacteria 1336
530 Ga0500641_0323433 3300053096 Bacteria 627
531 Ga0466962_0070638 3300061719 Bacteria 1668
532 2574429213 2574179768 Bacteria 4907129
533 Ga0207641_10383355
534 Ga0070658_10004064
535 Ga0070658_10440947
536 Ga0070658_11897317
537 Ga0070676_10498886
538 Ga0070676_10519757
539 Ga0070676_11274005
540 Ga0070683_100012926
541 Ga0070683_101077456
542 Ga0070690_101040006
543 Ga0070690_101342169
544 Ga0070670_101993366
545 Ga0070677_10039108
546 Ga0068869_100261777
547 Ga0070666_10744898
548 Ga0070680_100017626
549 Ga0070680_100096304
550 Ga0070680_100431467
551 Ga0070682_100040696
552 Ga0068868_100025276
553 Ga0068868_100291409
554 Ga0068868_100877802
555 Ga0068868_101837936
556 Ga0070660_100355743
557 Ga0070660_100522465
558 Ga0070689_100193767
559 Ga0070689_100721829
560 Ga0070687_100239719
561 Ga0070687_100309199
562 Ga0070661_100036646
563 Ga0070661_100970726
564 Ga0070692_10124298
565 Ga0070692_10797424
566 Ga0070692_11007303
567 Ga0070692_11064705
568 Ga0070669_100344351
569 Ga0070675_100037600
570 Ga0070675_100045961
571 Ga0070675_100722622
572 Ga0070671_100559463
573 Ga0070671_100611987
574 Ga0070674_100260273
575 Ga0070674_100378668
576 Ga0070674_100409536
577 Ga0070674_100495373
578 Ga0070673_100079991
579 Ga0070673_100146317
580 Ga0070688_100069533
581 Ga0070688_100124016
582 Ga0070659_100433286
583 Ga0070667_101425491
584 Ga0070709_10529888
585 Ga0070714_100095163
586 Ga0070714_100353336
587 Ga0070713_100604658
588 Ga0070713_100651500
589 Ga0070713_101545841
590 Ga0070710_10706671
591 Ga0070710_11102760
592 Ga0070701_10105202
593 Ga0070701_10154080
594 Ga0070711_100204511
595 Ga0070705_100143439
596 Ga0070705_101164941
597 Ga0070700_100080910
598 Ga0070700_100910586
599 Ga0070694_101893563
600 Ga0070678_100262245
601 Ga0070678_100655920
602 Ga0070662_100952363
603 Ga0070681_10018054
604 Ga0070681_10526151
605 Ga0070681_10854633
606 Ga0070681_11459983
607 Ga0068867_100085893
608 Ga0068867_100692315
609 Ga0068867_101567209
610 Ga0068867_102276773
611 Ga0070685_10041658
612 Ga0070685_10197822
613 Ga0070706_102049065
614 Ga0070698_100131883
615 Ga0070699_100052995
616 Ga0070699_101038095
617 Ga0070679_100068758
618 Ga0070679_100088421
619 Ga0070679_100288919
620 Ga0070679_100750450
621 Ga0070684_100127461
622 Ga0070684_100474389
623 Ga0070697_100358949
624 Ga0070697_101846306
625 Ga0068853_100019107
626 Ga0068853_100022090
627 Ga0068853_101737457
628 Ga0070672_100051228
629 Ga0070672_100210086
630 Ga0070686_100687275
631 Ga0070695_101719974
632 Ga0070696_100043500
633 Ga0070696_100393971
634 Ga0070693_100055279
635 Ga0070693_100173541
636 Ga0070665_100313519
637 Ga0070665_101697586
638 Ga0070704_100190839
639 Ga0068855_100004693
640 Ga0068855_100014349
641 Ga0068855_100871823
642 Ga0070664_100112044
643 Ga0070664_100795994
644 Ga0070664_102384259
645 Ga0068857_100013438
646 Ga0068857_100025753
647 Ga0068857_100505164
648 Ga0068854_100006930
649 Ga0068854_100590415
650 Ga0068856_100142967
651 Ga0068856_100156552
652 Ga0068856_100518030
653 Ga0070702_100105946
654 Ga0070702_100261937
655 Ga0068852_100000254
656 Ga0068852_100009086
657 Ga0068852_100012864
658 Ga0068852_100052417
659 Ga0068852_100060465
660 Ga0068852_101109983
661 Ga0068852_101209744
662 Ga0068852_101795580
663 Ga0068859_100081573
664 Ga0068866_10392667
665 Ga0068866_10397816
666 Ga0068861_101684743
667 Ga0068851_10002016
668 Ga0068851_10144977
669 Ga0068851_10443678
670 Ga0068870_10417926
671 Ga0068870_10529767
672 Ga0068863_100299770
673 Ga0068858_100311795
674 Ga0068858_100629534
675 Ga0068858_101629613
676 Ga0068858_101766355
677 Ga0070717_10069659
678 Ga0075365_10955660
679 Ga0075363_100956590
680 Ga0075364_10048752
681 Ga0075432_10082442
682 Ga0075432_10369678
683 Ga0075432_10377136
684 Ga0075362_10362239
685 Ga0075362_10451335
686 Ga0075367_10796467
687 Ga0075369_10071963
688 Ga0075366_10019840
689 Ga0075366_10021104
690 Ga0075366_10430853
691 Ga0097621_100012830
692 Ga0097621_100605586
693 Ga0097621_100902496
694 Ga0068871_100041820
695 Ga0068871_100232069
696 Ga0068871_100594736
697 Ga0068871_100898810
698 Ga0075428_100011836
699 Ga0075431_101071846
700 Ga0075433_10218148
701 Ga0075433_11580461
702 Ga0075434_100059321
703 Ga0075434_101838901
704 Ga0068865_100875388
705 Ga0075436_100002584
706 Ga0075436_100790606
707 Ga0097620_100081575
708 Ga0075435_100194025
709 Ga0105240_10035335
710 Ga0105240_10056757
711 Ga0105240_10063439
712 Ga0105240_10874831
713 Ga0111539_10001826
714 Ga0105245_10316194
715 Ga0105245_10421741
716 Ga0105245_10522438
717 Ga0105245_10912224
718 Ga0105245_11393342
719 Ga0105243_10365631
720 Ga0105243_10452292
721 Ga0105243_11195692
722 Ga0105243_11296390
723 Ga0105243_11300737
724 Ga0105241_10011678
725 Ga0105241_10023794
726 Ga0105241_10206681
727 Ga0105241_10299669
728 Ga0105242_10004748
729 Ga0105242_10401168
730 Ga0105242_10562595
731 Ga0105242_13269424
732 Ga0105248_10045282
733 Ga0105248_10327004
734 Ga0105248_11303228
735 Ga0105248_11317214
736 Ga0105248_11786028
737 Ga0105248_12540795
738 Ga0105237_10229657
739 Ga0105237_10794417
740 Ga0105237_11112653
741 Ga0105237_11696419
742 Ga0105238_10003397
743 Ga0105238_10022825
744 Ga0105238_10039577
745 Ga0105238_10292407
746 Ga0105238_10313222
747 Ga0105238_10655444
748 Ga0105238_11282119
749 Ga0105238_11512570
750 Ga0105249_10467964
751 Ga0105249_11154889
752 Ga0105239_10279615
753 Ga0105239_10853422
754 Ga0105239_12442180
755 Ga0105239_12619759
756 Ga0157329_1012060
757 Ga0157373_10383110
758 Ga0157371_10023455
759 Ga0157371_10088807
760 Ga0157370_10814645
761 Ga0157369_10002524
762 Ga0157369_10077702
763 Ga0157369_10370990
764 Ga0157369_11800162
765 Ga0157374_11913233
766 Ga0157378_10615262
767 Ga0157378_11178592
768 Ga0163162_10065955
769 Ga0163162_10135416
770 Ga0163162_11356620
771 Ga0163162_12894147
772 Ga0157372_10026804
773 Ga0157372_10046255
774 Ga0157372_10098767
775 Ga0157372_10762777
776 Ga0157372_12666676
777 Ga0157375_10139435
778 Ga0157375_12334193
779 Ga0163163_10563540
780 Ga0157380_10017395
781 Ga0157380_10341719
782 Ga0157380_11721487
783 Ga0157380_11849108
784 Ga0157380_11989570
785 Ga0157380_12205547
786 Ga0182008_10047237
787 Ga0157377_10164309
788 Ga0157377_10277736
789 Ga0157379_10027667
790 Ga0157379_11538894
791 Ga0157379_11652689
792 Ga0157376_10163539
793 Ga0157376_11952083
794 Ga0157376_12887834
795 Ga0163161_10070314
796 Ga0163161_10389773
797 Ga0197907_10049381
798 Ga0206356_10632517
799 Ga0206352_10660858
800 Ga0206353_10160707
801 Ga0213876_10044224
802 Ga0224712_10089071
803 Ga0207697_10111586
804 Ga0207656_10001529
805 Ga0207656_10236800
806 Ga0207682_10036379
807 Ga0207642_10231403
808 Ga0207688_10060868
809 Ga0207699_10013459
810 Ga0207699_10133860
811 Ga0207645_10064415
812 Ga0207645_10383085
813 Ga0207643_10099266
814 Ga0207705_10039760
815 Ga0207705_10170151
816 Ga0207705_10181384
817 Ga0207705_10691712
818 Ga0207705_10945429
819 Ga0207705_10997907
820 Ga0207654_10005423
821 Ga0207654_10204345
822 Ga0207654_10530228
823 Ga0207654_10766535
824 Ga0207707_10004510
825 Ga0207707_10012172
826 Ga0207707_10697395
827 Ga0207707_10988679
828 Ga0207695_10022239
829 Ga0207695_10026267
830 Ga0207695_10141166
831 Ga0207695_10229975
832 Ga0207695_11672402
833 Ga0207693_11295217
834 Ga0207660_10004556
835 Ga0207660_10387460
836 Ga0207660_11598150
837 Ga0207662_10341206
838 Ga0207662_10345159
839 Ga0207662_10500627
840 Ga0207657_10098056
841 Ga0207657_10105831
842 Ga0207649_10005246
843 Ga0207649_10662840
844 Ga0207652_10061303
845 Ga0207652_10097132
846 Ga0207652_10193426
847 Ga0207652_10784452
848 Ga0207652_11007201
849 Ga0207681_10592723
850 Ga0207694_10079125
851 Ga0207694_10086086
852 Ga0207694_10130144
853 Ga0207694_10307487
854 Ga0207694_10345323
855 Ga0207694_10724986
856 Ga0207659_10106035
857 Ga0207659_10223281
858 Ga0207659_10760082
859 Ga0207659_11244628
860 Ga0207687_10141398
861 Ga0207700_10250582
862 Ga0207700_10287154
863 Ga0207700_11126224
864 Ga0207664_10091448
865 Ga0207664_10338678
866 Ga0207664_11528012
867 Ga0207644_11721909
868 Ga0207690_10475548
869 Ga0207706_10283926
870 Ga0207686_10004988
871 Ga0207686_10231769
872 Ga0207686_10276982
873 Ga0207686_11314680
874 Ga0207686_11634682
875 Ga0207709_10144368
876 Ga0207709_10266167
877 Ga0207709_10628029
878 Ga0207670_10014182
879 Ga0207670_10064119
880 Ga0207669_10087677
881 Ga0207691_10018917
882 Ga0207691_10056959
883 Ga0207691_11540320
884 Ga0207711_11214029
885 Ga0207711_11519926
886 Ga0207661_10907760
887 Ga0207679_10260394
888 Ga0207667_10002090
889 Ga0207667_10009605
890 Ga0207667_10042923
891 Ga0207667_10180054
892 Ga0207651_10072026
893 Ga0207651_10094883
894 Ga0207712_11449941
895 Ga0207640_10066307
896 Ga0207640_11126020
897 Ga0207640_11504722
898 Ga0207640_12015853
899 Ga0207658_10447077
900 Ga0207677_10025133
901 Ga0207677_10129855
902 Ga0207703_10020762
903 Ga0207703_12183990
904 Ga0207639_10021692
905 Ga0207639_10117579
906 Ga0207639_10353481
907 Ga0207639_10439388
908 Ga0207708_10058790
909 Ga0207708_11089683
910 Ga0207702_10065510
911 Ga0207702_10102183
912 Ga0207702_10190514
913 Ga0207641_10252317
914 Ga0207641_10881878
915 Ga0207648_10018110
916 Ga0207648_10085800
917 Ga0207648_10277286
918 Ga0207648_11050370
919 Ga0207648_11282696
920 Ga0207674_10005717
921 Ga0207675_100165704
922 Ga0207675_100333271
923 Ga0207675_100479836
924 Ga0207675_102036041
925 Ga0207683_10380383
926 Ga0207683_10637211
927 Ga0207698_10005304
928 Ga0207698_10038333
929 Ga0207698_10054525
930 Ga0207698_10120570
931 Ga0207698_11582852
932 Ga0207698_11984628
933 Ga0207698_12219418
934 Ga0209974_10251462
935 Ga0207428_10143936
936 Ga0207428_10166875
937 Ga0268266_10125834
938 Ga0268264_10131961
939 Ga0265332_10129594
940 Ga0265340_10170561
941 Ga0265331_10192213
942 Ga0307509_10459264
943 Ga0307408_100257524
944 Ga0307408_100361392
945 Ga0307408_100499636
946 Ga0307405_10121518
947 Ga0307405_10235718
948 Ga0307405_11098042
949 Ga0307405_11197564
950 Ga0307413_10709002
951 Ga0307410_10814151
952 Ga0307410_11427218
953 Ga0307410_12043220
954 Ga0307406_10366554
955 Ga0307412_10079185
956 Ga0307412_10463975
957 Ga0307412_10556420
958 Ga0307412_11416722
959 Ga0307409_100022877
960 Ga0307409_100461735
961 Ga0307416_100236042
962 Ga0307416_100279764
963 Ga0307416_100291293
964 Ga0307416_100574914
965 Ga0307416_100645272
966 Ga0307416_101479350
967 Ga0307416_102340339
968 Ga0307414_10127559
969 Ga0307411_10556711
970 Ga0307411_10567222
971 Ga0307411_10901140
972 Ga0307411_12107524
973 Ga0307415_100475356
974 Ga0307415_101111480
975 Ga0307415_101174116
976 Ga0373958_0139674
977 Ga0373944_0354465
978 Ga0373931_0065454
979 Ga0373931_0203394
980 Ga0373931_0861773
981 Ga0373935_0048668
982 Ga0373927_0286701
983 Ga0373937_0049030
984 Ga0373925_0515651
985 Ga0395900_0063575
986 Ga0395900_0578879
987 Ga0395898_0130221
988 Ga0395898_1784719
989 Ga0395905_0031170
990 Ga0395905_0293325
991 Ga0395901_0043034
992 Ga0395901_0412004
993 Ga0436365_1596890
994 Ga0439447_099941
995 Ga0439453_0059022
996 Ga0451789_0632955
997 Ga0451793_1922151
998 Ga0451795_0081561
999 Ga0451800_1189066
1000 Ga0451807_1253253
1001 Ga0451835_0967853
1002 Ga0451853_0166656
1003 Ga0439441_007124
1004 Ga0450923_036574
1005 Ga0439446_0251782
1006 Ga0439435_0170362
1007 Ga0451577_0376517
1008 Ga0466972_0211306
1009 Ga0453683_0253939
1010 Ga0466966_0147805
1011 Ga0466961_0032363
1012 Ga0466963_0944117
1013 Ga0453684_1707413
1014 Ga0466971_0321607
1015 Ga0466957_0014006
1016 Ga0466957_0718109
1017 Ga0466959_0464468
1018 Ga0451576_0452060
1019 Ga0451576_0790020
1020 Ga0466958_0049225
1021 Ga0466967_1184361
1022 Ga0495663_0253830
1023 Ga0495621_0008698
1024 Ga0495621_0041524
1025 Ga0495621_0067402
1026 Ga0495635_1000095
1027 Ga0495646_0608555
1028 Ga0495658_0191631
1029 Ga0495589_0168476
1030 Ga0496104_0029274
1031 Ga0496109_0103498
1032 Ga0496110_0019539
1033 Ga0496111_0582813
1034 Ga0501039_0547834
1035 Ga0501042_1354590
1036 Ga0501199_067193
1037 Ga0501217_067366
1038 Ga0501249_092341
1039 Ga0501261_062421
1040 Ga0501269_018763
1041 nmdc:mga03683_117006_c1
1042 nmdc:mga03n38_882147_c1
1043 nmdc:mga00v17_48221_c1
1044 nmdc:mga0k408_165272_c1
1045 nmdc:mga0k408_23222_c1
1046 nmdc:mga0k408_281452_c1
1047 nmdc:mga0k408_745634_c1
1048 nmdc:mga07m45_323760_c1
1049 nmdc:mga05p37_496227_c1
1050 nmdc:mga09592_455373_c1
1051 nmdc:mga08y16_295931_c1
1052 nmdc:mga0n895_1538283_c1
1053 nmdc:mga0n895_317164_c1
1054 nmdc:mga0rr50_179914_c1
1055 nmdc:mga0rr50_375493_c1
1056 nmdc:mga0rr50_573347_c1
1057 nmdc:mga0rr50_955338_c1
1058 nmdc:mga08x19_1030383_c1
1059 nmdc:mga08x19_3628_c1
1060 nmdc:mga0a205_201645_c1
1061 nmdc:mga0sz30_89787_c1
1062 Ga0500641_0323433
1063 Ga0466962_0070638
1064 2574429213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02482

Ribosomal_S30AE

Sigma 54 modulation protein / S30EA ribosomal protein

3

93

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hei-assembly1.cif.gz_A 2a x-ray structure of hpf from vibrio cholerae 0.9676 1 91
5zep-assembly1.cif.gz_x m. smegmatis hibernating state 70s ribosome structure 0.9521 1 89
6h4n-assembly1.cif.gz_x structure of a hibernating 100s ribosome reveals an inactive conformation of the ribosomal protein s1 - 70s hibernating e. coli ribosome 0.9513 1 95
4hei-assembly1.cif.gz_A 2a x-ray structure of hpf from vibrio cholerae 0.9474 1 91
4v8h-assembly2.cif.gz_CX crystal structure of hpf bound to the 70s ribosome. 0.947 1 95
ID Description Score Start End Superfamily
af_I1KB15_71_175_3.30.160.100 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.9571 2 95 3.30.160.100
af_O05886_21_120_3.30.160.100 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.9462 4 93 3.30.160.100
3v26X00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.9436 1 95 3.30.160.100
3v26X00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.9342 1 95 3.30.160.100
3tqmD00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.9247 2 90 3.30.160.100
ID Description Score Start End GO Terms
AF-A0A368WJ10-F1-model_v4 deleted 0.991 1 96
AF-A0A6I8MAB8-F1-model_v4 Sigma 54 modulation protein/30S ribosomal protein S30EA 0.987 1 90 GO:0022627
GO:0043024
GO:0045900
AF-X1KU52-F1-model_v4 Sigma 54 modulation/S30EA ribosomal protein C-terminal domain-containing protein 0.9856 1 91 GO:0022627
GO:0043024
GO:0045900
AF-W7QDR6-F1-model_v4 Ribosome hibernation promoting factor (Hibernation factor HPF) 0.9854 1 67 GO:0022627
GO:0043024
GO:0045900
AF-A0A2E6KPT6-F1-model_v4 Ribosome hibernation promoting factor (Hibernation factor HPF) 0.9847 1 95 GO:0022627
GO:0043024
GO:0045900

Map