F460300

General Info

Members Datasets Scaffolds Average Seq Length
532 222 1064 234

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0440541|Ga0373925_0440541_195_902
Length 227
Sequence MTALPTFEIPTVPIHGGAERFPVRHVYCVGRNYAEHAKEMGGDASKEPPFFFTKAADSVVPVVPPAVGSIAYPLATKNFHHEIELVVAIGGRGARLPPERALSVVFGYAVGLDMTRRDLQSDMREKKRPWDIGKSFAGAAPIVGHLARGAIWVDVNGTRRQTGDLADMIWDVPHTLAFLSQYYELLPGDLVFTGTPSGVGPVVAGDRLDGGIDALGSLAVTVGPPIL

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.82
Rhizosphere 96.99
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0440541 3300037068 Bacteria 1066
2 JGI24752J21851_1007012 3300001976 Bacteria 1472
3 JGI24746J21847_1020783 3300001977 Bacteria 920
4 JGI24749J21850_1002611 3300002076 Bacteria 2527
5 JGI24035J26624_1009658 3300002126 Bacteria 952
6 Ga0065715_10186585 3300005293 Bacteria 1441
7 Ga0070676_10002968 3300005328 Bacteria 8766
8 Ga0070676_10010362 3300005328 Bacteria 5056
9 Ga0070676_10038133 3300005328 Bacteria 2775
10 Ga0070676_10124284 3300005328 Bacteria 1623
11 Ga0070683_100064230 3300005329 Bacteria 3417
12 Ga0070683_100240109 3300005329 Bacteria 1723
13 Ga0070683_100563981 3300005329 Bacteria 1089
14 Ga0070690_100170974 3300005330 Bacteria 1495
15 Ga0070690_100363437 3300005330 Bacteria 1054
16 Ga0070670_100065001 3300005331 Bacteria 3130
17 Ga0070670_100120456 3300005331 Bacteria 2263
18 Ga0070670_100232967 3300005331 Bacteria 1603
19 Ga0070670_100311616 3300005331 Bacteria 1378
20 Ga0070677_10000399 3300005333 Bacteria 15153
21 Ga0070677_10002466 3300005333 Bacteria 5923
22 Ga0070677_10004021 3300005333 Bacteria 4775
23 Ga0068869_100000108 3300005334 Bacteria 39249
24 Ga0068869_100020312 3300005334 Bacteria 4553
25 Ga0070666_10001754 3300005335 Bacteria 13241
26 Ga0070666_10026451 3300005335 Bacteria 3791
27 Ga0070666_10038220 3300005335 Bacteria 3193
28 Ga0070680_100095133 3300005336 Bacteria 2469
29 Ga0070680_100135663 3300005336 Bacteria 2061
30 Ga0070680_100857832 3300005336 Bacteria 783
31 Ga0070682_100221197 3300005337 Bacteria 1348
32 Ga0068868_100006441 3300005338 Bacteria 8309
33 Ga0068868_100011862 3300005338 Bacteria 6355
34 Ga0068868_100056259 3300005338 Bacteria 3106
35 Ga0068868_100090852 3300005338 Bacteria 2460
36 Ga0068868_100181487 3300005338 Bacteria 1746
37 Ga0070660_100012123 3300005339 Bacteria 6154
38 Ga0070660_100066098 3300005339 Bacteria 2814
39 Ga0070660_100464495 3300005339 Bacteria 1051
40 Ga0070660_100468949 3300005339 Bacteria 1046
41 Ga0070689_100014335 3300005340 Bacteria 5756
42 Ga0070689_100114572 3300005340 Bacteria 2148
43 Ga0070689_100141774 3300005340 Bacteria 1933
44 Ga0070689_100658069 3300005340 Bacteria 912
45 Ga0070687_100384223 3300005343 Bacteria 916
46 Ga0070661_100005143 3300005344 Bacteria 9010
47 Ga0070661_100007131 3300005344 Bacteria 7706
48 Ga0070661_100016337 3300005344 Bacteria 5246
49 Ga0070661_100033352 3300005344 Bacteria 3729
50 Ga0070661_100057780 3300005344 Bacteria 2842
51 Ga0070661_100065403 3300005344 Bacteria 2672
52 Ga0070661_100351859 3300005344 Bacteria 1156
53 Ga0070661_100508687 3300005344 Bacteria 965
54 Ga0070668_100025885 3300005347 Bacteria 4449
55 Ga0070668_100031665 3300005347 Bacteria 4024
56 Ga0070668_100037182 3300005347 Bacteria 3717
57 Ga0070668_100090578 3300005347 Bacteria 2409
58 Ga0070668_100090767 3300005347 Bacteria 2407
59 Ga0070669_100000482 3300005353 Bacteria 30329
60 Ga0070669_100028863 3300005353 Bacteria 3996
61 Ga0070675_100005354 3300005354 Bacteria 9811
62 Ga0070675_100038658 3300005354 Bacteria 3890
63 Ga0070675_100120329 3300005354 Bacteria 2230
64 Ga0070671_100004778 3300005355 Bacteria 10770
65 Ga0070671_100005229 3300005355 Bacteria 10344
66 Ga0070671_100051697 3300005355 Bacteria 3418
67 Ga0070671_100749280 3300005355 Bacteria 849
68 Ga0070674_100004774 3300005356 Bacteria 7764
69 Ga0070674_100031998 3300005356 Bacteria 3491
70 Ga0070674_100193973 3300005356 Bacteria 1564
71 Ga0070674_100434996 3300005356 Bacteria 1079
72 Ga0070673_100001176 3300005364 Bacteria 15032
73 Ga0070673_100027742 3300005364 Bacteria 4200
74 Ga0070688_100016771 3300005365 Bacteria 4193
75 Ga0070688_100020439 3300005365 Bacteria 3851
76 Ga0070688_100199834 3300005365 Bacteria 1398
77 Ga0070659_100022667 3300005366 Bacteria 4795
78 Ga0070659_100075387 3300005366 Bacteria 2689
79 Ga0070659_100092659 3300005366 Bacteria 2423
80 Ga0070659_100120210 3300005366 Bacteria 2127
81 Ga0070667_100001817 3300005367 Bacteria 19009
82 Ga0070667_100003815 3300005367 Bacteria 12806
83 Ga0070667_100022212 3300005367 Bacteria 5264
84 Ga0070667_100041022 3300005367 Bacteria 3883
85 Ga0070667_100059966 3300005367 Bacteria 3220
86 Ga0070667_100100736 3300005367 Bacteria 2495
87 Ga0070667_100269379 3300005367 Bacteria 1527
88 Ga0070667_100426498 3300005367 Bacteria 1210
89 Ga0070709_10189103 3300005434 Bacteria 1451
90 Ga0070714_100004596 3300005435 Bacteria 10409
91 Ga0070714_100007506 3300005435 Bacteria 8487
92 Ga0070714_100022875 3300005435 Bacteria 5128
93 Ga0070713_100026589 3300005436 Bacteria 4546
94 Ga0070713_100318343 3300005436 Bacteria 1436
95 Ga0070710_10000687 3300005437 Bacteria 16064
96 Ga0070711_100030508 3300005439 Bacteria 3569
97 Ga0070711_100088699 3300005439 Bacteria 2223
98 Ga0070663_100008998 3300005455 Bacteria 6165
99 Ga0070663_100607683 3300005455 Bacteria 920
100 Ga0070678_100016839 3300005456 Bacteria 4687
101 Ga0070678_100020355 3300005456 Bacteria 4352
102 Ga0070678_100171756 3300005456 Bacteria 1766
103 Ga0070662_100095159 3300005457 Bacteria 2244
104 Ga0070662_100484910 3300005457 Bacteria 1030
105 Ga0070681_10012832 3300005458 Bacteria 8318
106 Ga0070681_10253132 3300005458 Bacteria 1673
107 Ga0068867_100001466 3300005459 Bacteria 16338
108 Ga0068867_100002533 3300005459 Bacteria 12859
109 Ga0068867_100009464 3300005459 Bacteria 6871
110 Ga0068867_100175113 3300005459 Bacteria 1702
111 Ga0068867_100851509 3300005459 Bacteria 817
112 Ga0070707_100881527 3300005468 Bacteria 859
113 Ga0070699_100039227 3300005518 Bacteria 4101
114 Ga0070679_100008089 3300005530 Bacteria 9883
115 Ga0070679_100012228 3300005530 Bacteria 8198
116 Ga0070679_100030058 3300005530 Bacteria 5362
117 Ga0070679_100057307 3300005530 Bacteria 3883
118 Ga0070679_100097318 3300005530 Bacteria 2930
119 Ga0070679_100206760 3300005530 Bacteria 1927
120 Ga0070684_100001542 3300005535 Bacteria 16627
121 Ga0070684_100033871 3300005535 Bacteria 4364
122 Ga0070684_100274283 3300005535 Bacteria 1544
123 Ga0070684_100385040 3300005535 Bacteria 1292
124 Ga0068853_100033222 3300005539 Bacteria 4375
125 Ga0068853_100080703 3300005539 Bacteria 2847
126 Ga0068853_100085998 3300005539 Bacteria 2757
127 Ga0068853_100373923 3300005539 Bacteria 1330
128 Ga0068853_100519419 3300005539 Bacteria 1126
129 Ga0070672_100001353 3300005543 Bacteria 15124
130 Ga0070672_100001874 3300005543 Bacteria 13152
131 Ga0070672_100156020 3300005543 Bacteria 1891
132 Ga0070672_100385641 3300005543 Bacteria 1199
133 Ga0070672_100484680 3300005543 Bacteria 1068
134 Ga0070696_100014222 3300005546 Bacteria 5340
135 Ga0070693_100318270 3300005547 Bacteria 1055
136 Ga0070665_100001984 3300005548 Bacteria 23024
137 Ga0070665_100063857 3300005548 Bacteria 3692
138 Ga0070665_100365677 3300005548 Bacteria 1449
139 Ga0068855_100019744 3300005563 Bacteria 8092
140 Ga0068855_100187278 3300005563 Bacteria 2337
141 Ga0070664_100002461 3300005564 Bacteria 14911
142 Ga0070664_100045817 3300005564 Bacteria 3693
143 Ga0070664_100057489 3300005564 Bacteria 3306
144 Ga0070664_100095464 3300005564 Bacteria 2579
145 Ga0070664_100181088 3300005564 Bacteria 1873
146 Ga0070664_100274808 3300005564 Bacteria 1518
147 Ga0068857_100002627 3300005577 Bacteria 14748
148 Ga0068857_100114401 3300005577 Bacteria 2426
149 Ga0068857_100153625 3300005577 Bacteria 2086
150 Ga0068854_100002763 3300005578 Bacteria 10903
151 Ga0068856_100003325 3300005614 Bacteria 16338
152 Ga0068856_100003654 3300005614 Bacteria 15456
153 Ga0068856_100012536 3300005614 Bacteria 8206
154 Ga0070702_100021708 3300005615 Bacteria 3383
155 Ga0068852_100004888 3300005616 Bacteria 9517
156 Ga0068852_100010061 3300005616 Bacteria 7039
157 Ga0068852_100017500 3300005616 Bacteria 5625
158 Ga0068852_100686830 3300005616 Bacteria 1033
159 Ga0068859_100000217 3300005617 Bacteria 56968
160 Ga0068859_100002842 3300005617 Bacteria 17566
161 Ga0068859_100087220 3300005617 Bacteria 3168
162 Ga0068859_100551534 3300005617 Bacteria 1247
163 Ga0068864_100015296 3300005618 Bacteria 6381
164 Ga0068864_100025290 3300005618 Bacteria 4999
165 Ga0068864_100066851 3300005618 Bacteria 3121
166 Ga0068864_100317733 3300005618 Bacteria 1462
167 Ga0068866_10033930 3300005718 Bacteria 2481
168 Ga0068861_100040936 3300005719 Bacteria 3468
169 Ga0068861_100691751 3300005719 Bacteria 946
170 Ga0068851_10000506 3300005834 Bacteria 17035
171 Ga0068851_10000682 3300005834 Bacteria 14458
172 Ga0068851_10009081 3300005834 Bacteria 4614
173 Ga0068851_10038811 3300005834 Bacteria 2390
174 Ga0068870_10005548 3300005840 Bacteria 5510
175 Ga0068863_100030801 3300005841 Bacteria 5123
176 Ga0068863_100127597 3300005841 Bacteria 2427
177 Ga0068863_100137327 3300005841 Bacteria 2336
178 Ga0068863_100616755 3300005841 Bacteria 1074
179 Ga0068858_100004830 3300005842 Bacteria 13204
180 Ga0068858_100016224 3300005842 Bacteria 6998
181 Ga0068858_100075295 3300005842 Bacteria 3135
182 Ga0068858_100134563 3300005842 Bacteria 2319
183 Ga0068858_100151332 3300005842 Bacteria 2182
184 Ga0068858_100154739 3300005842 Bacteria 2157
185 Ga0068858_100372346 3300005842 Bacteria 1370
186 Ga0068860_100011373 3300005843 Bacteria 8772
187 Ga0068860_100024360 3300005843 Bacteria 5848
188 Ga0068860_100323708 3300005843 Bacteria 1513
189 Ga0068862_100031836 3300005844 Bacteria 4454
190 Ga0068862_100068977 3300005844 Bacteria 3051
191 Ga0068862_100324696 3300005844 Bacteria 1422
192 Ga0068862_100973969 3300005844 Bacteria 838
193 Ga0097621_100000380 3300006237 Bacteria 30961
194 Ga0097621_100734776 3300006237 Unclassified 911
195 Ga0068871_100330931 3300006358 Bacteria 1343
196 Ga0075428_100027029 3300006844 Bacteria 6353
197 Ga0068865_100003738 3300006881 Bacteria 9139
198 Ga0068865_100253326 3300006881 Bacteria 1390
199 Ga0097620_100000217 3300006931 Bacteria 56968
200 Ga0097620_100002842 3300006931 Bacteria 17566
201 Ga0097620_100087224 3300006931 Bacteria 3168
202 Ga0097620_100551407 3300006931 Bacteria 1247
203 Ga0105240_10013105 3300009093 Bacteria 11409
204 Ga0105240_10021400 3300009093 Bacteria 8601
205 Ga0111539_10055286 3300009094 Bacteria 4718
206 Ga0105243_10202859 3300009148 Bacteria 1740
207 Ga0105241_10044414 3300009174 Bacteria 3367
208 Ga0105241_10089214 3300009174 Bacteria 2429
209 Ga0105242_10244688 3300009176 Bacteria 1614
210 Ga0105248_10002088 3300009177 Bacteria 22111
211 Ga0105248_10002614 3300009177 Bacteria 20045
212 Ga0105248_10245953 3300009177 Bacteria 2013
213 Ga0105248_10560600 3300009177 Bacteria 1289
214 Ga0105248_10736469 3300009177 Unclassified 1112
215 Ga0105237_10030494 3300009545 Bacteria 5476
216 Ga0105237_10193568 3300009545 Bacteria 2033
217 Ga0105237_10433164 3300009545 Bacteria 1321
218 Ga0105238_10010467 3300009551 Bacteria 9309
219 Ga0105249_10238954 3300009553 Bacteria 1795
220 Ga0105239_10099207 3300010375 Bacteria 3220
221 Ga0157373_10035784 3300013100 Bacteria 3563
222 Ga0157373_10077649 3300013100 Bacteria 2343
223 Ga0157371_10020786 3300013102 Bacteria 4828
224 Ga0157371_10118647 3300013102 Bacteria 1881
225 Ga0157371_10338601 3300013102 Bacteria 1094
226 Ga0157370_10000893 3300013104 Bacteria 37892
227 Ga0157370_10011952 3300013104 Bacteria 9048
228 Ga0157370_10038691 3300013104 Bacteria 4613
229 Ga0157370_10218720 3300013104 Bacteria 1764
230 Ga0157370_10381747 3300013104 Bacteria 1298
231 Ga0157369_10005334 3300013105 Bacteria 14979
232 Ga0157369_10006475 3300013105 Bacteria 13573
233 Ga0157369_10038630 3300013105 Bacteria 5219
234 Ga0157369_10095984 3300013105 Bacteria 3163
235 Ga0157369_10140396 3300013105 Bacteria 2557
236 Ga0157374_10026894 3300013296 Bacteria 5181
237 Ga0157374_10048901 3300013296 Bacteria 3925
238 Ga0157374_10052217 3300013296 Bacteria 3806
239 Ga0157374_10642424 3300013296 Bacteria 1073
240 Ga0157378_10471659 3300013297 Bacteria 1249
241 Ga0163162_10001723 3300013306 Bacteria 20486
242 Ga0163162_10268141 3300013306 Bacteria 1839
243 Ga0157372_10012901 3300013307 Bacteria 8908
244 Ga0157372_10063295 3300013307 Bacteria 4147
245 Ga0157372_10094978 3300013307 Bacteria 3396
246 Ga0157372_10142657 3300013307 Bacteria 2761
247 Ga0157372_10198419 3300013307 Bacteria 2324
248 Ga0157372_10259244 3300013307 Bacteria 2019
249 Ga0157372_10259930 3300013307 Bacteria 2016
250 Ga0157372_10734768 3300013307 Bacteria 1148
251 Ga0157372_10979218 3300013307 Bacteria 980
252 Ga0157375_10003757 3300013308 Bacteria 13163
253 Ga0157375_10009466 3300013308 Bacteria 8553
254 Ga0157375_10032850 3300013308 Bacteria 4925
255 Ga0157375_10265728 3300013308 Bacteria 1877
256 Ga0157375_10594153 3300013308 Bacteria 1266
257 Ga0163163_10027486 3300014325 Bacteria 5450
258 Ga0163163_10066448 3300014325 Bacteria 3581
259 Ga0157380_10047964 3300014326 Bacteria 3362
260 Ga0182008_10123840 3300014497 Bacteria 1286
261 Ga0157377_10004959 3300014745 Bacteria 6205
262 Ga0157379_10003822 3300014968 Bacteria 12838
263 Ga0157379_10015344 3300014968 Bacteria 6721
264 Ga0157379_10402239 3300014968 Bacteria 1259
265 Ga0157376_10033384 3300014969 Bacteria 4143
266 Ga0157376_10292704 3300014969 Bacteria 1538
267 Ga0163161_10021774 3300017792 Bacteria 4507
268 Ga0163161_10031650 3300017792 Bacteria 3771
269 Ga0206356_10593666 3300020070 Bacteria 1245
270 Ga0206354_11341275 3300020081 Bacteria 1404
271 Ga0207673_1003898 3300025290 Bacteria 1760
272 Ga0207697_10000319 3300025315 Bacteria 26864
273 Ga0207656_10004660 3300025321 Bacteria 4807
274 Ga0207656_10017184 3300025321 Bacteria 2829
275 Ga0207656_10037161 3300025321 Bacteria 2048
276 Ga0207682_10000075 3300025893 Bacteria 43404
277 Ga0207682_10002499 3300025893 Bacteria 8216
278 Ga0207692_10051069 3300025898 Bacteria 2095
279 Ga0207688_10070330 3300025901 Bacteria 1984
280 Ga0207688_10148368 3300025901 Bacteria 1384
281 Ga0207680_10000486 3300025903 Bacteria 18844
282 Ga0207680_10001434 3300025903 Bacteria 11296
283 Ga0207680_10267069 3300025903 Bacteria 1186
284 Ga0207699_10003665 3300025906 Bacteria 7336
285 Ga0207645_10000152 3300025907 Bacteria 54586
286 Ga0207645_10002330 3300025907 Bacteria 15002
287 Ga0207645_10012159 3300025907 Bacteria 5846
288 Ga0207645_10046452 3300025907 Bacteria 2774
289 Ga0207645_10073475 3300025907 Bacteria 2189
290 Ga0207643_10000851 3300025908 Bacteria 18500
291 Ga0207643_10144732 3300025908 Bacteria 1421
292 Ga0207705_10034967 3300025909 Bacteria 3594
293 Ga0207654_10025709 3300025911 Bacteria 3180
294 Ga0207707_10013313 3300025912 Bacteria 7169
295 Ga0207707_10019919 3300025912 Bacteria 5856
296 Ga0207707_10068931 3300025912 Bacteria 3082
297 Ga0207695_10026649 3300025913 Bacteria 6450
298 Ga0207695_10045749 3300025913 Bacteria 4644
299 Ga0207671_10200979 3300025914 Bacteria 1556
300 Ga0207693_10133207 3300025915 Bacteria 1953
301 Ga0207663_10113573 3300025916 Bacteria 1842
302 Ga0207663_10348085 3300025916 Bacteria 1121
303 Ga0207660_10002028 3300025917 Bacteria 13478
304 Ga0207662_10111056 3300025918 Bacteria 1709
305 Ga0207662_10507058 3300025918 Bacteria 831
306 Ga0207657_10000093 3300025919 Bacteria 85263
307 Ga0207657_10001139 3300025919 Bacteria 28216
308 Ga0207657_10006415 3300025919 Bacteria 12199
309 Ga0207657_10022789 3300025919 Bacteria 5848
310 Ga0207657_10150293 3300025919 Bacteria 1897
311 Ga0207657_10167995 3300025919 Bacteria 1778
312 Ga0207649_10004462 3300025920 Bacteria 7599
313 Ga0207649_10006859 3300025920 Bacteria 6185
314 Ga0207649_10016245 3300025920 Bacteria 4194
315 Ga0207649_10437260 3300025920 Bacteria 985
316 Ga0207652_10004714 3300025921 Bacteria 11056
317 Ga0207652_10009141 3300025921 Bacteria 7976
318 Ga0207652_10064338 3300025921 Bacteria 3174
319 Ga0207652_10138820 3300025921 Bacteria 2172
320 Ga0207652_10187597 3300025921 Bacteria 1859
321 Ga0207681_10003320 3300025923 Bacteria 10074
322 Ga0207681_10150652 3300025923 Bacteria 1742
323 Ga0207681_10169607 3300025923 Bacteria 1653
324 Ga0207694_10002004 3300025924 Bacteria 16854
325 Ga0207694_10011390 3300025924 Bacteria 6712
326 Ga0207650_10003684 3300025925 Bacteria 10477
327 Ga0207650_10006975 3300025925 Bacteria 7702
328 Ga0207650_10010136 3300025925 Bacteria 6458
329 Ga0207650_10054956 3300025925 Bacteria 2954
330 Ga0207650_10058669 3300025925 Bacteria 2866
331 Ga0207650_10092059 3300025925 Bacteria 2318
332 Ga0207650_10300226 3300025925 Bacteria 1311
333 Ga0207650_10484410 3300025925 Bacteria 1032
334 Ga0207659_10002569 3300025926 Bacteria 10806
335 Ga0207659_10003749 3300025926 Bacteria 9163
336 Ga0207659_10037947 3300025926 Bacteria 3348
337 Ga0207700_10000045 3300025928 Bacteria 88536
338 Ga0207700_10192761 3300025928 Bacteria 1713
339 Ga0207700_10401948 3300025928 Bacteria 1201
340 Ga0207664_10001519 3300025929 Bacteria 15217
341 Ga0207664_10015073 3300025929 Bacteria 5600
342 Ga0207664_10021433 3300025929 Bacteria 4805
343 Ga0207664_10556819 3300025929 Bacteria 1029
344 Ga0207644_10000862 3300025931 Bacteria 19192
345 Ga0207644_10018400 3300025931 Bacteria 4726
346 Ga0207644_10200671 3300025931 Bacteria 1573
347 Ga0207644_10207115 3300025931 Bacteria 1549
348 Ga0207690_10092775 3300025932 Bacteria 2138
349 Ga0207690_10167015 3300025932 Bacteria 1645
350 Ga0207690_10256461 3300025932 Bacteria 1353
351 Ga0207706_10007913 3300025933 Bacteria 9809
352 Ga0207706_10105624 3300025933 Bacteria 2478
353 Ga0207670_10131084 3300025936 Bacteria 1837
354 Ga0207670_10277682 3300025936 Bacteria 1304
355 Ga0207669_10001543 3300025937 Bacteria 9822
356 Ga0207669_10085108 3300025937 Bacteria 2040
357 Ga0207669_10116847 3300025937 Bacteria 1801
358 Ga0207704_10002721 3300025938 Bacteria 7973
359 Ga0207704_10127659 3300025938 Bacteria 1754
360 Ga0207691_10000006 3300025940 Bacteria 161922
361 Ga0207691_10009804 3300025940 Bacteria 9197
362 Ga0207691_10010195 3300025940 Bacteria 9014
363 Ga0207691_10040936 3300025940 Bacteria 4280
364 Ga0207691_10095166 3300025940 Bacteria 2664
365 Ga0207691_10665614 3300025940 Bacteria 879
366 Ga0207711_10026184 3300025941 Bacteria 4893
367 Ga0207711_10069173 3300025941 Bacteria 3059
368 Ga0207711_10187691 3300025941 Bacteria 1883
369 Ga0207711_10261159 3300025941 Bacteria 1592
370 Ga0207689_10000030 3300025942 Bacteria 97584
371 Ga0207689_10002080 3300025942 Bacteria 18880
372 Ga0207661_10082071 3300025944 Bacteria 2664
373 Ga0207661_10433289 3300025944 Bacteria 1195
374 Ga0207679_10008964 3300025945 Bacteria 6391
375 Ga0207679_10022620 3300025945 Bacteria 4283
376 Ga0207679_10048385 3300025945 Bacteria 3095
377 Ga0207679_10092208 3300025945 Bacteria 2346
378 Ga0207679_10832526 3300025945 Bacteria 842
379 Ga0207667_10000410 3300025949 Bacteria 58059
380 Ga0207667_10003249 3300025949 Bacteria 20059
381 Ga0207667_10088541 3300025949 Bacteria 3201
382 Ga0207667_10119726 3300025949 Bacteria 2713
383 Ga0207651_10003988 3300025960 Bacteria 7337
384 Ga0207651_10009648 3300025960 Bacteria 5301
385 Ga0207651_10344074 3300025960 Bacteria 1254
386 Ga0207712_10051920 3300025961 Bacteria 2869
387 Ga0207668_10009342 3300025972 Bacteria 5870
388 Ga0207668_10079566 3300025972 Bacteria 2371
389 Ga0207668_10212219 3300025972 Bacteria 1549
390 Ga0207668_10453904 3300025972 Bacteria 1094
391 Ga0207640_10034409 3300025981 Bacteria 3162
392 Ga0207640_10041560 3300025981 Bacteria 2925
393 Ga0207640_10103740 3300025981 Bacteria 2000
394 Ga0207640_10293905 3300025981 Bacteria 1282
395 Ga0207640_10525445 3300025981 Unclassified 990
396 Ga0207658_10002793 3300025986 Bacteria 12571
397 Ga0207658_10003664 3300025986 Bacteria 10837
398 Ga0207658_10010570 3300025986 Bacteria 6272
399 Ga0207658_10033513 3300025986 Bacteria 3665
400 Ga0207658_10076087 3300025986 Bacteria 2556
401 Ga0207658_10149631 3300025986 Bacteria 1900
402 Ga0207677_10010904 3300026023 Bacteria 5160
403 Ga0207677_10068808 3300026023 Bacteria 2487
404 Ga0207677_10271219 3300026023 Bacteria 1388
405 Ga0207677_10579480 3300026023 Bacteria 982
406 Ga0207703_10018924 3300026035 Bacteria 5380
407 Ga0207703_10039927 3300026035 Bacteria 3753
408 Ga0207703_10102256 3300026035 Bacteria 2431
409 Ga0207703_10429091 3300026035 Bacteria 1231
410 Ga0207639_10003283 3300026041 Bacteria 10888
411 Ga0207639_10032420 3300026041 Bacteria 3846
412 Ga0207639_10060361 3300026041 Bacteria 2925
413 Ga0207639_10282537 3300026041 Bacteria 1460
414 Ga0207678_10004977 3300026067 Bacteria 11917
415 Ga0207678_10008744 3300026067 Bacteria 8913
416 Ga0207678_10070138 3300026067 Bacteria 3005
417 Ga0207678_10283352 3300026067 Bacteria 1422
418 Ga0207708_10026820 3300026075 Bacteria 4361
419 Ga0207702_10002033 3300026078 Bacteria 19598
420 Ga0207702_10002576 3300026078 Bacteria 17051
421 Ga0207702_10013518 3300026078 Bacteria 6781
422 Ga0207641_10003854 3300026088 Bacteria 13135
423 Ga0207641_10026143 3300026088 Bacteria 4816
424 Ga0207641_10048697 3300026088 Bacteria 3578
425 Ga0207641_10177746 3300026088 Bacteria 1947
426 Ga0207648_10003534 3300026089 Bacteria 16341
427 Ga0207648_10006993 3300026089 Bacteria 11157
428 Ga0207648_10027992 3300026089 Bacteria 5000
429 Ga0207648_10226715 3300026089 Bacteria 1661
430 Ga0207676_10005417 3300026095 Bacteria 9032
431 Ga0207676_10015541 3300026095 Bacteria 5493
432 Ga0207676_10048815 3300026095 Bacteria 3288
433 Ga0207674_10000205 3300026116 Bacteria 73346
434 Ga0207674_10000749 3300026116 Bacteria 42581
435 Ga0207674_10012924 3300026116 Bacteria 9311
436 Ga0207674_10028634 3300026116 Bacteria 5876
437 Ga0207675_100000852 3300026118 Bacteria 30393
438 Ga0207675_100003107 3300026118 Bacteria 16280
439 Ga0207683_10000056 3300026121 Bacteria 84718
440 Ga0207683_10000700 3300026121 Bacteria 30630
441 Ga0207683_10044769 3300026121 Bacteria 3869
442 Ga0207683_10313336 3300026121 Bacteria 1437
443 Ga0207698_10000366 3300026142 Bacteria 26504
444 Ga0207698_10023043 3300026142 Bacteria 4343
445 Ga0207698_10081713 3300026142 Bacteria 2609
446 Ga0207698_10579271 3300026142 Bacteria 1104
447 Ga0209969_1009951 3300027360 Bacteria 1358
448 Ga0209981_1009038 3300027378 Bacteria 1359
449 Ga0209970_1014088 3300027614 Bacteria 1327
450 Ga0209983_1016009 3300027665 Bacteria 1547
451 Ga0209971_1001234 3300027682 Bacteria 6406
452 Ga0268266_10014129 3300028379 Bacteria 6874
453 Ga0268266_10014630 3300028379 Bacteria 6743
454 Ga0268266_10277589 3300028379 Bacteria 1557
455 Ga0268266_10567288 3300028379 Bacteria 1089
456 Ga0268265_10433055 3300028380 Bacteria 1224
457 Ga0268265_10440983 3300028380 Bacteria 1214
458 Ga0268265_10565708 3300028380 Bacteria 1081
459 Ga0268264_10003459 3300028381 Bacteria 13616
460 Ga0268264_10008098 3300028381 Bacteria 8742
461 Ga0268264_10170995 3300028381 Bacteria 1965
462 Ga0307408_100006423 3300031548 Bacteria 7795
463 Ga0307405_10021290 3300031731 Bacteria 3641
464 Ga0307413_10663931 3300031824 Bacteria 861
465 Ga0307410_10004248 3300031852 Bacteria 7370
466 Ga0307406_10053508 3300031901 Bacteria 2571
467 Ga0307407_10001704 3300031903 Bacteria 8175
468 Ga0307412_10007574 3300031911 Bacteria 6165
469 Ga0307409_100001026 3300031995 Bacteria 13083
470 Ga0307409_100561904 3300031995 Bacteria 1122
471 Ga0307416_100142446 3300032002 Bacteria 2181
472 Ga0307414_10770928 3300032004 Bacteria 875
473 Ga0307411_10000807 3300032005 Bacteria 11702
474 Ga0307415_100026473 3300032126 Bacteria 3659
475 Ga0373954_0124080 3300035118 Bacteria 1255
476 Ga0373956_0082341 3300035119 Bacteria 1478
477 Ga0373946_0123107 3300035171 Bacteria 1186
478 Ga0373955_0244910 3300035172 Bacteria 1074
479 Ga0373924_0004339 3300035410 Bacteria 4950
480 Ga0373927_0040790 3300035695 Bacteria 3011
481 Ga0373947_0267278 3300035725 Bacteria 1134
482 Ga0373937_0033401 3300036401 Bacteria 4672
483 Ga0373937_0878888 3300036401 Bacteria 845
484 Ga0373925_0271217 3300037068 Bacteria 1365
485 Ga0373925_0942757 3300037068 Bacteria 711
486 Ga0395900_0048985 3300037418 Bacteria 4352
487 Ga0395898_0024992 3300037466 Bacteria 6022
488 Ga0395905_0261715 3300037471 Bacteria 1615
489 Ga0451845_0985314 3300041501 Bacteria 1280
490 Ga0466963_0068802 3300044694 Bacteria 2379
491 Ga0451576_0497140 3300045051 Bacteria 1281
492 Ga0495580_0023904 3300046472 Bacteria 4480
493 Ga0495580_0275544 3300046472 Bacteria 1148
494 Ga0495580_0503482 3300046472 Bacteria 808
495 Ga0495582_0428295 3300046473 Bacteria 763
496 Ga0495630_0532298 3300046517 Bacteria 901
497 Ga0495598_0034946 3300046537 Bacteria 1436
498 Ga0495658_0196516 3300046683 Bacteria 1256
499 Ga0495658_0199792 3300046683 Bacteria 1246
500 Ga0495604_0427283 3300047317 Bacteria 869
501 Ga0496104_0014540 3300048907 Bacteria 7109
502 Ga0496105_0381768 3300048908 Bacteria 1121
503 Ga0496106_0061640 3300048909 Bacteria 2846
504 Ga0496106_0441980 3300048909 Bacteria 1045
505 Ga0496107_0040743 3300048910 Bacteria 3335
506 Ga0496108_0034386 3300048911 Bacteria 4211
507 Ga0496108_0039168 3300048911 Bacteria 3952
508 Ga0496109_0120495 3300048912 Bacteria 2444
509 Ga0496109_0322347 3300048912 Bacteria 1458
510 Ga0496110_0063038 3300048913 Bacteria 3275
511 Ga0496110_0423288 3300048913 Bacteria 1214
512 Ga0496110_0741641 3300048913 Bacteria 885
513 Ga0496112_0001802 3300048915 Bacteria 16862
514 Ga0496113_0348320 3300048916 Bacteria 1188
515 Ga0496114_0138207 3300048917 Bacteria 2107
516 Ga0501034_0028364 3300049571 Bacteria 5696
517 Ga0501041_0132662 3300049577 Bacteria 1552
518 Ga0501042_0280679 3300049578 Bacteria 1203
519 Ga0501047_0105302 3300049581 Bacteria 2701
520 Ga0501048_0097229 3300049582 Bacteria 2077
521 Ga0501070_0011144 3300049586 Bacteria 7588
522 Ga0501070_0616242 3300049586 Bacteria 864
523 Ga0501071_0525767 3300049587 Bacteria 908
524 Ga0501072_0169526 3300049588 Bacteria 1742
525 Ga0501080_0000772 3300049742 Bacteria 26012
526 Ga0501081_0442986 3300049743 Bacteria 964
527 Ga0501083_0240904 3300049744 Bacteria 1177
528 Ga0501035_0143882 3300049822 Bacteria 2072
529 nmdc:mga08y16_38103_c1 3300050511 Bacteria 5048
530 nmdc:mga08x19_855708_c1 3300050514 Bacteria 646
531 Ga0501084_0145961 3300054114 Bacteria 1993
532 Ga0501082_0127999 3300060353 Bacteria 2203
533 Ga0373925_0440541
534 JGI24752J21851_1007012
535 JGI24746J21847_1020783
536 JGI24749J21850_1002611
537 JGI24035J26624_1009658
538 Ga0065715_10186585
539 Ga0070676_10002968
540 Ga0070676_10010362
541 Ga0070676_10038133
542 Ga0070676_10124284
543 Ga0070683_100064230
544 Ga0070683_100240109
545 Ga0070683_100563981
546 Ga0070690_100170974
547 Ga0070690_100363437
548 Ga0070670_100065001
549 Ga0070670_100120456
550 Ga0070670_100232967
551 Ga0070670_100311616
552 Ga0070677_10000399
553 Ga0070677_10002466
554 Ga0070677_10004021
555 Ga0068869_100000108
556 Ga0068869_100020312
557 Ga0070666_10001754
558 Ga0070666_10026451
559 Ga0070666_10038220
560 Ga0070680_100095133
561 Ga0070680_100135663
562 Ga0070680_100857832
563 Ga0070682_100221197
564 Ga0068868_100006441
565 Ga0068868_100011862
566 Ga0068868_100056259
567 Ga0068868_100090852
568 Ga0068868_100181487
569 Ga0070660_100012123
570 Ga0070660_100066098
571 Ga0070660_100464495
572 Ga0070660_100468949
573 Ga0070689_100014335
574 Ga0070689_100114572
575 Ga0070689_100141774
576 Ga0070689_100658069
577 Ga0070687_100384223
578 Ga0070661_100005143
579 Ga0070661_100007131
580 Ga0070661_100016337
581 Ga0070661_100033352
582 Ga0070661_100057780
583 Ga0070661_100065403
584 Ga0070661_100351859
585 Ga0070661_100508687
586 Ga0070668_100025885
587 Ga0070668_100031665
588 Ga0070668_100037182
589 Ga0070668_100090578
590 Ga0070668_100090767
591 Ga0070669_100000482
592 Ga0070669_100028863
593 Ga0070675_100005354
594 Ga0070675_100038658
595 Ga0070675_100120329
596 Ga0070671_100004778
597 Ga0070671_100005229
598 Ga0070671_100051697
599 Ga0070671_100749280
600 Ga0070674_100004774
601 Ga0070674_100031998
602 Ga0070674_100193973
603 Ga0070674_100434996
604 Ga0070673_100001176
605 Ga0070673_100027742
606 Ga0070688_100016771
607 Ga0070688_100020439
608 Ga0070688_100199834
609 Ga0070659_100022667
610 Ga0070659_100075387
611 Ga0070659_100092659
612 Ga0070659_100120210
613 Ga0070667_100001817
614 Ga0070667_100003815
615 Ga0070667_100022212
616 Ga0070667_100041022
617 Ga0070667_100059966
618 Ga0070667_100100736
619 Ga0070667_100269379
620 Ga0070667_100426498
621 Ga0070709_10189103
622 Ga0070714_100004596
623 Ga0070714_100007506
624 Ga0070714_100022875
625 Ga0070713_100026589
626 Ga0070713_100318343
627 Ga0070710_10000687
628 Ga0070711_100030508
629 Ga0070711_100088699
630 Ga0070663_100008998
631 Ga0070663_100607683
632 Ga0070678_100016839
633 Ga0070678_100020355
634 Ga0070678_100171756
635 Ga0070662_100095159
636 Ga0070662_100484910
637 Ga0070681_10012832
638 Ga0070681_10253132
639 Ga0068867_100001466
640 Ga0068867_100002533
641 Ga0068867_100009464
642 Ga0068867_100175113
643 Ga0068867_100851509
644 Ga0070707_100881527
645 Ga0070699_100039227
646 Ga0070679_100008089
647 Ga0070679_100012228
648 Ga0070679_100030058
649 Ga0070679_100057307
650 Ga0070679_100097318
651 Ga0070679_100206760
652 Ga0070684_100001542
653 Ga0070684_100033871
654 Ga0070684_100274283
655 Ga0070684_100385040
656 Ga0068853_100033222
657 Ga0068853_100080703
658 Ga0068853_100085998
659 Ga0068853_100373923
660 Ga0068853_100519419
661 Ga0070672_100001353
662 Ga0070672_100001874
663 Ga0070672_100156020
664 Ga0070672_100385641
665 Ga0070672_100484680
666 Ga0070696_100014222
667 Ga0070693_100318270
668 Ga0070665_100001984
669 Ga0070665_100063857
670 Ga0070665_100365677
671 Ga0068855_100019744
672 Ga0068855_100187278
673 Ga0070664_100002461
674 Ga0070664_100045817
675 Ga0070664_100057489
676 Ga0070664_100095464
677 Ga0070664_100181088
678 Ga0070664_100274808
679 Ga0068857_100002627
680 Ga0068857_100114401
681 Ga0068857_100153625
682 Ga0068854_100002763
683 Ga0068856_100003325
684 Ga0068856_100003654
685 Ga0068856_100012536
686 Ga0070702_100021708
687 Ga0068852_100004888
688 Ga0068852_100010061
689 Ga0068852_100017500
690 Ga0068852_100686830
691 Ga0068859_100000217
692 Ga0068859_100002842
693 Ga0068859_100087220
694 Ga0068859_100551534
695 Ga0068864_100015296
696 Ga0068864_100025290
697 Ga0068864_100066851
698 Ga0068864_100317733
699 Ga0068866_10033930
700 Ga0068861_100040936
701 Ga0068861_100691751
702 Ga0068851_10000506
703 Ga0068851_10000682
704 Ga0068851_10009081
705 Ga0068851_10038811
706 Ga0068870_10005548
707 Ga0068863_100030801
708 Ga0068863_100127597
709 Ga0068863_100137327
710 Ga0068863_100616755
711 Ga0068858_100004830
712 Ga0068858_100016224
713 Ga0068858_100075295
714 Ga0068858_100134563
715 Ga0068858_100151332
716 Ga0068858_100154739
717 Ga0068858_100372346
718 Ga0068860_100011373
719 Ga0068860_100024360
720 Ga0068860_100323708
721 Ga0068862_100031836
722 Ga0068862_100068977
723 Ga0068862_100324696
724 Ga0068862_100973969
725 Ga0097621_100000380
726 Ga0097621_100734776
727 Ga0068871_100330931
728 Ga0075428_100027029
729 Ga0068865_100003738
730 Ga0068865_100253326
731 Ga0097620_100000217
732 Ga0097620_100002842
733 Ga0097620_100087224
734 Ga0097620_100551407
735 Ga0105240_10013105
736 Ga0105240_10021400
737 Ga0111539_10055286
738 Ga0105243_10202859
739 Ga0105241_10044414
740 Ga0105241_10089214
741 Ga0105242_10244688
742 Ga0105248_10002088
743 Ga0105248_10002614
744 Ga0105248_10245953
745 Ga0105248_10560600
746 Ga0105248_10736469
747 Ga0105237_10030494
748 Ga0105237_10193568
749 Ga0105237_10433164
750 Ga0105238_10010467
751 Ga0105249_10238954
752 Ga0105239_10099207
753 Ga0157373_10035784
754 Ga0157373_10077649
755 Ga0157371_10020786
756 Ga0157371_10118647
757 Ga0157371_10338601
758 Ga0157370_10000893
759 Ga0157370_10011952
760 Ga0157370_10038691
761 Ga0157370_10218720
762 Ga0157370_10381747
763 Ga0157369_10005334
764 Ga0157369_10006475
765 Ga0157369_10038630
766 Ga0157369_10095984
767 Ga0157369_10140396
768 Ga0157374_10026894
769 Ga0157374_10048901
770 Ga0157374_10052217
771 Ga0157374_10642424
772 Ga0157378_10471659
773 Ga0163162_10001723
774 Ga0163162_10268141
775 Ga0157372_10012901
776 Ga0157372_10063295
777 Ga0157372_10094978
778 Ga0157372_10142657
779 Ga0157372_10198419
780 Ga0157372_10259244
781 Ga0157372_10259930
782 Ga0157372_10734768
783 Ga0157372_10979218
784 Ga0157375_10003757
785 Ga0157375_10009466
786 Ga0157375_10032850
787 Ga0157375_10265728
788 Ga0157375_10594153
789 Ga0163163_10027486
790 Ga0163163_10066448
791 Ga0157380_10047964
792 Ga0182008_10123840
793 Ga0157377_10004959
794 Ga0157379_10003822
795 Ga0157379_10015344
796 Ga0157379_10402239
797 Ga0157376_10033384
798 Ga0157376_10292704
799 Ga0163161_10021774
800 Ga0163161_10031650
801 Ga0206356_10593666
802 Ga0206354_11341275
803 Ga0207673_1003898
804 Ga0207697_10000319
805 Ga0207656_10004660
806 Ga0207656_10017184
807 Ga0207656_10037161
808 Ga0207682_10000075
809 Ga0207682_10002499
810 Ga0207692_10051069
811 Ga0207688_10070330
812 Ga0207688_10148368
813 Ga0207680_10000486
814 Ga0207680_10001434
815 Ga0207680_10267069
816 Ga0207699_10003665
817 Ga0207645_10000152
818 Ga0207645_10002330
819 Ga0207645_10012159
820 Ga0207645_10046452
821 Ga0207645_10073475
822 Ga0207643_10000851
823 Ga0207643_10144732
824 Ga0207705_10034967
825 Ga0207654_10025709
826 Ga0207707_10013313
827 Ga0207707_10019919
828 Ga0207707_10068931
829 Ga0207695_10026649
830 Ga0207695_10045749
831 Ga0207671_10200979
832 Ga0207693_10133207
833 Ga0207663_10113573
834 Ga0207663_10348085
835 Ga0207660_10002028
836 Ga0207662_10111056
837 Ga0207662_10507058
838 Ga0207657_10000093
839 Ga0207657_10001139
840 Ga0207657_10006415
841 Ga0207657_10022789
842 Ga0207657_10150293
843 Ga0207657_10167995
844 Ga0207649_10004462
845 Ga0207649_10006859
846 Ga0207649_10016245
847 Ga0207649_10437260
848 Ga0207652_10004714
849 Ga0207652_10009141
850 Ga0207652_10064338
851 Ga0207652_10138820
852 Ga0207652_10187597
853 Ga0207681_10003320
854 Ga0207681_10150652
855 Ga0207681_10169607
856 Ga0207694_10002004
857 Ga0207694_10011390
858 Ga0207650_10003684
859 Ga0207650_10006975
860 Ga0207650_10010136
861 Ga0207650_10054956
862 Ga0207650_10058669
863 Ga0207650_10092059
864 Ga0207650_10300226
865 Ga0207650_10484410
866 Ga0207659_10002569
867 Ga0207659_10003749
868 Ga0207659_10037947
869 Ga0207700_10000045
870 Ga0207700_10192761
871 Ga0207700_10401948
872 Ga0207664_10001519
873 Ga0207664_10015073
874 Ga0207664_10021433
875 Ga0207664_10556819
876 Ga0207644_10000862
877 Ga0207644_10018400
878 Ga0207644_10200671
879 Ga0207644_10207115
880 Ga0207690_10092775
881 Ga0207690_10167015
882 Ga0207690_10256461
883 Ga0207706_10007913
884 Ga0207706_10105624
885 Ga0207670_10131084
886 Ga0207670_10277682
887 Ga0207669_10001543
888 Ga0207669_10085108
889 Ga0207669_10116847
890 Ga0207704_10002721
891 Ga0207704_10127659
892 Ga0207691_10000006
893 Ga0207691_10009804
894 Ga0207691_10010195
895 Ga0207691_10040936
896 Ga0207691_10095166
897 Ga0207691_10665614
898 Ga0207711_10026184
899 Ga0207711_10069173
900 Ga0207711_10187691
901 Ga0207711_10261159
902 Ga0207689_10000030
903 Ga0207689_10002080
904 Ga0207661_10082071
905 Ga0207661_10433289
906 Ga0207679_10008964
907 Ga0207679_10022620
908 Ga0207679_10048385
909 Ga0207679_10092208
910 Ga0207679_10832526
911 Ga0207667_10000410
912 Ga0207667_10003249
913 Ga0207667_10088541
914 Ga0207667_10119726
915 Ga0207651_10003988
916 Ga0207651_10009648
917 Ga0207651_10344074
918 Ga0207712_10051920
919 Ga0207668_10009342
920 Ga0207668_10079566
921 Ga0207668_10212219
922 Ga0207668_10453904
923 Ga0207640_10034409
924 Ga0207640_10041560
925 Ga0207640_10103740
926 Ga0207640_10293905
927 Ga0207640_10525445
928 Ga0207658_10002793
929 Ga0207658_10003664
930 Ga0207658_10010570
931 Ga0207658_10033513
932 Ga0207658_10076087
933 Ga0207658_10149631
934 Ga0207677_10010904
935 Ga0207677_10068808
936 Ga0207677_10271219
937 Ga0207677_10579480
938 Ga0207703_10018924
939 Ga0207703_10039927
940 Ga0207703_10102256
941 Ga0207703_10429091
942 Ga0207639_10003283
943 Ga0207639_10032420
944 Ga0207639_10060361
945 Ga0207639_10282537
946 Ga0207678_10004977
947 Ga0207678_10008744
948 Ga0207678_10070138
949 Ga0207678_10283352
950 Ga0207708_10026820
951 Ga0207702_10002033
952 Ga0207702_10002576
953 Ga0207702_10013518
954 Ga0207641_10003854
955 Ga0207641_10026143
956 Ga0207641_10048697
957 Ga0207641_10177746
958 Ga0207648_10003534
959 Ga0207648_10006993
960 Ga0207648_10027992
961 Ga0207648_10226715
962 Ga0207676_10005417
963 Ga0207676_10015541
964 Ga0207676_10048815
965 Ga0207674_10000205
966 Ga0207674_10000749
967 Ga0207674_10012924
968 Ga0207674_10028634
969 Ga0207675_100000852
970 Ga0207675_100003107
971 Ga0207683_10000056
972 Ga0207683_10000700
973 Ga0207683_10044769
974 Ga0207683_10313336
975 Ga0207698_10000366
976 Ga0207698_10023043
977 Ga0207698_10081713
978 Ga0207698_10579271
979 Ga0209969_1009951
980 Ga0209981_1009038
981 Ga0209970_1014088
982 Ga0209983_1016009
983 Ga0209971_1001234
984 Ga0268266_10014129
985 Ga0268266_10014630
986 Ga0268266_10277589
987 Ga0268266_10567288
988 Ga0268265_10433055
989 Ga0268265_10440983
990 Ga0268265_10565708
991 Ga0268264_10003459
992 Ga0268264_10008098
993 Ga0268264_10170995
994 Ga0307408_100006423
995 Ga0307405_10021290
996 Ga0307413_10663931
997 Ga0307410_10004248
998 Ga0307406_10053508
999 Ga0307407_10001704
1000 Ga0307412_10007574
1001 Ga0307409_100001026
1002 Ga0307409_100561904
1003 Ga0307416_100142446
1004 Ga0307414_10770928
1005 Ga0307411_10000807
1006 Ga0307415_100026473
1007 Ga0373954_0124080
1008 Ga0373956_0082341
1009 Ga0373946_0123107
1010 Ga0373955_0244910
1011 Ga0373924_0004339
1012 Ga0373927_0040790
1013 Ga0373947_0267278
1014 Ga0373937_0033401
1015 Ga0373937_0878888
1016 Ga0373925_0271217
1017 Ga0373925_0942757
1018 Ga0395900_0048985
1019 Ga0395898_0024992
1020 Ga0395905_0261715
1021 Ga0451845_0985314
1022 Ga0466963_0068802
1023 Ga0451576_0497140
1024 Ga0495580_0023904
1025 Ga0495580_0275544
1026 Ga0495580_0503482
1027 Ga0495582_0428295
1028 Ga0495630_0532298
1029 Ga0495598_0034946
1030 Ga0495658_0196516
1031 Ga0495658_0199792
1032 Ga0495604_0427283
1033 Ga0496104_0014540
1034 Ga0496105_0381768
1035 Ga0496106_0061640
1036 Ga0496106_0441980
1037 Ga0496107_0040743
1038 Ga0496108_0034386
1039 Ga0496108_0039168
1040 Ga0496109_0120495
1041 Ga0496109_0322347
1042 Ga0496110_0063038
1043 Ga0496110_0423288
1044 Ga0496110_0741641
1045 Ga0496112_0001802
1046 Ga0496113_0348320
1047 Ga0496114_0138207
1048 Ga0501034_0028364
1049 Ga0501041_0132662
1050 Ga0501042_0280679
1051 Ga0501047_0105302
1052 Ga0501048_0097229
1053 Ga0501070_0011144
1054 Ga0501070_0616242
1055 Ga0501071_0525767
1056 Ga0501072_0169526
1057 Ga0501080_0000772
1058 Ga0501081_0442986
1059 Ga0501083_0240904
1060 Ga0501035_0143882
1061 nmdc:mga08y16_38103_c1
1062 nmdc:mga08x19_855708_c1
1063 Ga0501084_0145961
1064 Ga0501082_0127999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

25

223

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4maq-assembly1.cif.gz_B crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia 0.9322 1 234
4maq-assembly1.cif.gz_A crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia 0.9198 2 234
1saw-assembly1.cif.gz_A x-ray structure of homo sapiens protein flj36880 0.9144 25 234
6sbj-assembly2.cif.gz_C x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.9109 25 234
6foh-assembly1.cif.gz_A x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) at 1.56a resolution. 0.9102 25 234
ID Description Score Start End Superfamily
4maqA00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9198 2 234 3.90.850.10
4maqA00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.908 2 234 3.90.850.10
af_Q9VDE2_1_220_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8902 25 234 3.90.850.10
1wzoC02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8866 25 234 3.90.850.10
af_Q10B63_1_221_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8815 25 234 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A435SEY7-F1-model_v4 deleted 0.9443 73 233
AF-A0A226WXR6-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9422 88 233 GO:0018773
GO:0046872
AF-A0A812IQ58-F1-model_v4 deleted 0.9416 42 233
AF-A0A534JQW6-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9399 51 234 GO:0018773
GO:0046872
AF-A0A7V7X9R7-F1-model_v4 deleted 0.9381 80 233

Map