F460306
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 532 | 241 | 1064 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0523429|Ga0451577_0523429_91_1011 |
| Length | 293 |
| Sequence | MKNQLAQLAQYLNLSSGMDEKKKSGGGPTLIDGGKPKTEKPVDRRRPIRVLLLDDREENLLLRSTILRQHGYDVVSSASIEEAQKHLENIDIAVLDYHLGAGKFGTEVAESLRGERPQVPIIILSATLERKFGGIADMHLLKGYSTMDDLLAALRNFEAKRRGKPVVVDARDFYYSRISMAMGDDVVLEILDRDGNWQYVNDYFAALFERKRPYFVGKNMFESFPELGEEWKEIVRTVADTRETYIDRSFRGLPNLPTKNPRWVWNVLAFPLKLHDDRNGVALSARVIEKKSF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 73 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 74 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 75 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 121 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 122 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 123 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 127 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 128 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 129 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 130 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 131 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 132 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 133 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 134 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 135 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 136 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 137 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 139 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 140 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 142 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 143 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 144 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 147 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 148 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 149 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 150 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 151 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 152 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 153 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 154 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 155 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 156 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 157 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 158 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 159 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 212 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 215 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 216 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 217 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 218 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 219 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 220 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 238 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 239 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 240 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.5 |
| Metatranscriptomes | 1.32 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.75 |
| Nodule | 0 |
| Rhizoplane | 5.83 |
| Rhizosphere | 90.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451577_0523429 | 3300042876 | Bacteria | 1077 |
| 2 | LJNas_1001321 | 3300000546 | Bacteria | 3628 |
| 3 | rootH1_10332512 | 3300003323 | Bacteria | 1620 |
| 4 | rootH1_10365739 | 3300003323 | Bacteria | 1605 |
| 5 | Ga0058863_10011887 | 3300004799 | Bacteria | 2074 |
| 6 | Ga0058861_10043048 | 3300004800 | Bacteria | 1676 |
| 7 | Ga0058862_10220838 | 3300004803 | Bacteria | 2526 |
| 8 | Ga0070658_10000004 | 3300005327 | Bacteria | 402230 |
| 9 | Ga0070658_10009641 | 3300005327 | Bacteria | 7751 |
| 10 | Ga0070658_10024444 | 3300005327 | Bacteria | 4846 |
| 11 | Ga0070658_10027091 | 3300005327 | Bacteria | 4601 |
| 12 | Ga0070658_10031393 | 3300005327 | Bacteria | 4266 |
| 13 | Ga0070658_10182979 | 3300005327 | Bacteria | 1764 |
| 14 | Ga0070658_10258483 | 3300005327 | Bacteria | 1478 |
| 15 | Ga0070683_100026850 | 3300005329 | Bacteria | 5189 |
| 16 | Ga0070683_100031861 | 3300005329 | Bacteria | 4797 |
| 17 | Ga0070683_100109110 | 3300005329 | Bacteria | 2610 |
| 18 | Ga0070666_10194344 | 3300005335 | Bacteria | 1426 |
| 19 | Ga0070680_100031806 | 3300005336 | Unclassified | 4243 |
| 20 | Ga0070680_100033409 | 3300005336 | Bacteria | 4146 |
| 21 | Ga0070680_100069983 | 3300005336 | Unclassified | 2882 |
| 22 | Ga0070682_100007377 | 3300005337 | Bacteria | 6205 |
| 23 | Ga0068868_100019387 | 3300005338 | Bacteria | 5097 |
| 24 | Ga0070660_100012775 | 3300005339 | Bacteria | 6003 |
| 25 | Ga0070660_100014364 | 3300005339 | Bacteria | 5702 |
| 26 | Ga0070660_100049021 | 3300005339 | Bacteria | 3245 |
| 27 | Ga0070660_100123829 | 3300005339 | Bacteria | 2065 |
| 28 | Ga0070660_100138221 | 3300005339 | Bacteria | 1953 |
| 29 | Ga0070660_100299420 | 3300005339 | Unclassified | 1318 |
| 30 | Ga0070691_10072105 | 3300005341 | Bacteria | 1677 |
| 31 | Ga0070661_100042798 | 3300005344 | Unclassified | 3307 |
| 32 | Ga0070661_100054268 | 3300005344 | Unclassified | 2935 |
| 33 | Ga0070692_10086510 | 3300005345 | Bacteria | 1697 |
| 34 | Ga0070692_10336904 | 3300005345 | Bacteria | 933 |
| 35 | Ga0070671_100006455 | 3300005355 | Bacteria | 9374 |
| 36 | Ga0070673_100291137 | 3300005364 | Unclassified | 1435 |
| 37 | Ga0070659_100000601 | 3300005366 | Bacteria | 26412 |
| 38 | Ga0070709_10019087 | 3300005434 | Bacteria | 3956 |
| 39 | Ga0070714_100058263 | 3300005435 | Bacteria | 3309 |
| 40 | Ga0070714_100065367 | 3300005435 | Bacteria | 3132 |
| 41 | Ga0070714_100194322 | 3300005435 | Bacteria | 1853 |
| 42 | Ga0070713_100010252 | 3300005436 | Bacteria | 6765 |
| 43 | Ga0070713_100087268 | 3300005436 | Unclassified | 2676 |
| 44 | Ga0070713_100205797 | 3300005436 | Bacteria | 1779 |
| 45 | Ga0070713_100487848 | 3300005436 | Bacteria | 1161 |
| 46 | Ga0070710_10425401 | 3300005437 | Unclassified | 895 |
| 47 | Ga0070711_100026570 | 3300005439 | Bacteria | 3794 |
| 48 | Ga0070711_100308081 | 3300005439 | Bacteria | 1261 |
| 49 | Ga0070678_100260326 | 3300005456 | Bacteria | 1459 |
| 50 | Ga0070681_10009446 | 3300005458 | Bacteria | 9598 |
| 51 | Ga0070681_10040779 | 3300005458 | Unclassified | 4651 |
| 52 | Ga0070681_10043372 | 3300005458 | Bacteria | 4507 |
| 53 | Ga0070681_10073266 | 3300005458 | Bacteria | 3386 |
| 54 | Ga0070681_10147684 | 3300005458 | Bacteria | 2279 |
| 55 | Ga0070681_10158617 | 3300005458 | Bacteria | 2186 |
| 56 | Ga0070681_10203179 | 3300005458 | Bacteria | 1899 |
| 57 | Ga0070681_10379564 | 3300005458 | Bacteria | 1324 |
| 58 | Ga0070681_10674690 | 3300005458 | Bacteria | 949 |
| 59 | Ga0070679_100002283 | 3300005530 | Bacteria | 17337 |
| 60 | Ga0070679_100037253 | 3300005530 | Unclassified | 4830 |
| 61 | Ga0070679_100058910 | 3300005530 | Unclassified | 3827 |
| 62 | Ga0070679_100103720 | 3300005530 | Bacteria | 2830 |
| 63 | Ga0070679_100209546 | 3300005530 | Bacteria | 1913 |
| 64 | Ga0070684_100014368 | 3300005535 | Bacteria | 6411 |
| 65 | Ga0070684_100072207 | 3300005535 | Unclassified | 3038 |
| 66 | Ga0070684_100160153 | 3300005535 | Bacteria | 2041 |
| 67 | Ga0070697_100014663 | 3300005536 | Bacteria | 6153 |
| 68 | Ga0070697_100114667 | 3300005536 | Bacteria | 2249 |
| 69 | Ga0068853_100000100 | 3300005539 | Bacteria | 58118 |
| 70 | Ga0068853_100030975 | 3300005539 | Bacteria | 4522 |
| 71 | Ga0068853_100037552 | 3300005539 | Bacteria | 4121 |
| 72 | Ga0068853_100048137 | 3300005539 | Unclassified | 3661 |
| 73 | Ga0068853_100159694 | 3300005539 | Unclassified | 2033 |
| 74 | Ga0068853_100262814 | 3300005539 | Unclassified | 1587 |
| 75 | Ga0068853_100421609 | 3300005539 | Unclassified | 1251 |
| 76 | Ga0070695_100018465 | 3300005545 | Unclassified | 4236 |
| 77 | Ga0070696_100048934 | 3300005546 | Unclassified | 2935 |
| 78 | Ga0070693_100006969 | 3300005547 | Bacteria | 5500 |
| 79 | Ga0070665_100021347 | 3300005548 | Bacteria | 6513 |
| 80 | Ga0070665_100033876 | 3300005548 | Bacteria | 5138 |
| 81 | Ga0070665_100054614 | 3300005548 | Bacteria | 4006 |
| 82 | Ga0068855_100007892 | 3300005563 | Bacteria | 12855 |
| 83 | Ga0068855_100037522 | 3300005563 | Bacteria | 5761 |
| 84 | Ga0068855_100047543 | 3300005563 | Bacteria | 5068 |
| 85 | Ga0068855_100062699 | 3300005563 | Bacteria | 4339 |
| 86 | Ga0068855_100079747 | 3300005563 | Bacteria | 3796 |
| 87 | Ga0068855_100087189 | 3300005563 | Bacteria | 3608 |
| 88 | Ga0068855_100090590 | 3300005563 | Bacteria | 3529 |
| 89 | Ga0068855_100262295 | 3300005563 | Bacteria | 1924 |
| 90 | Ga0068855_100310312 | 3300005563 | Bacteria | 1745 |
| 91 | Ga0070664_100067129 | 3300005564 | Unclassified | 3065 |
| 92 | Ga0070664_100087569 | 3300005564 | Bacteria | 2693 |
| 93 | Ga0068857_100055905 | 3300005577 | Bacteria | 3502 |
| 94 | Ga0068854_100000074 | 3300005578 | Bacteria | 72015 |
| 95 | Ga0068854_100048369 | 3300005578 | Unclassified | 3034 |
| 96 | Ga0068854_100106515 | 3300005578 | Unclassified | 2109 |
| 97 | Ga0068854_100232696 | 3300005578 | Bacteria | 1463 |
| 98 | Ga0068854_100287006 | 3300005578 | Unclassified | 1327 |
| 99 | Ga0068856_100024943 | 3300005614 | Bacteria | 5827 |
| 100 | Ga0068856_100035422 | 3300005614 | Bacteria | 4892 |
| 101 | Ga0068856_100209104 | 3300005614 | Unclassified | 1966 |
| 102 | Ga0068856_100608136 | 3300005614 | Bacteria | 1114 |
| 103 | Ga0068852_100004648 | 3300005616 | Bacteria | 9731 |
| 104 | Ga0068852_100013376 | 3300005616 | Bacteria | 6281 |
| 105 | Ga0068852_100148906 | 3300005616 | Unclassified | 2174 |
| 106 | Ga0068852_100560529 | 3300005616 | Bacteria | 1144 |
| 107 | Ga0068864_100016174 | 3300005618 | Bacteria | 6209 |
| 108 | Ga0068864_100240106 | 3300005618 | Unclassified | 1679 |
| 109 | Ga0068851_10051566 | 3300005834 | Unclassified | 2091 |
| 110 | Ga0068863_100015404 | 3300005841 | Bacteria | 7351 |
| 111 | Ga0068858_100315072 | 3300005842 | Bacteria | 1494 |
| 112 | Ga0081540_1006852 | 3300005983 | Bacteria | 8224 |
| 113 | Ga0070717_10114921 | 3300006028 | Bacteria | 2300 |
| 114 | Ga0070716_100059017 | 3300006173 | Unclassified | 2210 |
| 115 | Ga0070716_100221623 | 3300006173 | Bacteria | 1271 |
| 116 | Ga0070712_100431882 | 3300006175 | Unclassified | 1093 |
| 117 | Ga0075434_100111154 | 3300006871 | Unclassified | 2751 |
| 118 | Ga0075436_100006391 | 3300006914 | Bacteria | 8076 |
| 119 | Ga0075436_100015574 | 3300006914 | Bacteria | 5205 |
| 120 | Ga0075436_100043592 | 3300006914 | Bacteria | 3093 |
| 121 | Ga0105240_10001235 | 3300009093 | Bacteria | 44371 |
| 122 | Ga0105240_10003079 | 3300009093 | Bacteria | 26206 |
| 123 | Ga0105240_10014142 | 3300009093 | Bacteria | 10903 |
| 124 | Ga0105240_10131799 | 3300009093 | Unclassified | 2998 |
| 125 | Ga0105240_10152462 | 3300009093 | Unclassified | 2751 |
| 126 | Ga0105240_10240786 | 3300009093 | Unclassified | 2097 |
| 127 | Ga0105240_10864438 | 3300009093 | Bacteria | 975 |
| 128 | Ga0105245_10029968 | 3300009098 | Bacteria | 4811 |
| 129 | Ga0105245_10181404 | 3300009098 | Bacteria | 2012 |
| 130 | Ga0114129_10106555 | 3300009147 | Unclassified | 3872 |
| 131 | Ga0105241_10261665 | 3300009174 | Bacteria | 1470 |
| 132 | Ga0105241_10563643 | 3300009174 | Bacteria | 1024 |
| 133 | Ga0105248_10014521 | 3300009177 | Bacteria | 8670 |
| 134 | Ga0105248_10110100 | 3300009177 | Bacteria | 3105 |
| 135 | Ga0105248_10627790 | 3300009177 | Unclassified | 1212 |
| 136 | Ga0105248_10876540 | 3300009177 | Unclassified | 1013 |
| 137 | Ga0105237_10012226 | 3300009545 | Bacteria | 9048 |
| 138 | Ga0105237_10194413 | 3300009545 | Unclassified | 2028 |
| 139 | Ga0105237_10273624 | 3300009545 | Unclassified | 1691 |
| 140 | Ga0105237_10774566 | 3300009545 | Bacteria | 966 |
| 141 | Ga0105238_10003571 | 3300009551 | Bacteria | 15505 |
| 142 | Ga0105238_10008859 | 3300009551 | Bacteria | 10066 |
| 143 | Ga0105238_10012260 | 3300009551 | Bacteria | 8645 |
| 144 | Ga0105238_10024665 | 3300009551 | Bacteria | 6130 |
| 145 | Ga0105238_10031252 | 3300009551 | Bacteria | 5420 |
| 146 | Ga0105238_10134679 | 3300009551 | Unclassified | 2448 |
| 147 | Ga0105238_10409069 | 3300009551 | Bacteria | 1350 |
| 148 | Ga0105249_10027220 | 3300009553 | Bacteria | 5158 |
| 149 | Ga0105239_10091987 | 3300010375 | Unclassified | 3347 |
| 150 | Ga0105239_10377975 | 3300010375 | Bacteria | 1601 |
| 151 | Ga0157373_10029579 | 3300013100 | Bacteria | 3945 |
| 152 | Ga0157373_10142761 | 3300013100 | Bacteria | 1684 |
| 153 | Ga0157373_10158566 | 3300013100 | Bacteria | 1592 |
| 154 | Ga0157371_10142235 | 3300013102 | Bacteria | 1709 |
| 155 | Ga0157370_10025296 | 3300013104 | Bacteria | 5876 |
| 156 | Ga0157370_10040457 | 3300013104 | Bacteria | 4501 |
| 157 | Ga0157370_10053172 | 3300013104 | Bacteria | 3863 |
| 158 | Ga0157370_10072305 | 3300013104 | Unclassified | 3254 |
| 159 | Ga0157370_10078802 | 3300013104 | Unclassified | 3102 |
| 160 | Ga0157370_10112312 | 3300013104 | Bacteria | 2547 |
| 161 | Ga0157370_10123159 | 3300013104 | Bacteria | 2421 |
| 162 | Ga0157370_10192381 | 3300013104 | Bacteria | 1894 |
| 163 | Ga0157370_10445656 | 3300013104 | Bacteria | 1190 |
| 164 | Ga0157369_10000442 | 3300013105 | Bacteria | 55048 |
| 165 | Ga0157369_10010057 | 3300013105 | Bacteria | 10801 |
| 166 | Ga0157369_10037540 | 3300013105 | Bacteria | 5304 |
| 167 | Ga0157369_10077474 | 3300013105 | Unclassified | 3563 |
| 168 | Ga0157369_10185635 | 3300013105 | Bacteria | 2187 |
| 169 | Ga0157369_10257396 | 3300013105 | Unclassified | 1821 |
| 170 | Ga0157369_10347084 | 3300013105 | Unclassified | 1542 |
| 171 | Ga0157374_10078895 | 3300013296 | Bacteria | 3119 |
| 172 | Ga0157374_10105455 | 3300013296 | Unclassified | 2707 |
| 173 | Ga0157374_10121862 | 3300013296 | Bacteria | 2517 |
| 174 | Ga0157374_10148518 | 3300013296 | Unclassified | 2278 |
| 175 | Ga0157374_10213067 | 3300013296 | Unclassified | 1894 |
| 176 | Ga0163162_10195832 | 3300013306 | Bacteria | 2149 |
| 177 | Ga0163162_10359752 | 3300013306 | Bacteria | 1588 |
| 178 | Ga0157372_10011458 | 3300013307 | Bacteria | 9428 |
| 179 | Ga0157372_10012096 | 3300013307 | Bacteria | 9192 |
| 180 | Ga0157372_10027551 | 3300013307 | Bacteria | 6191 |
| 181 | Ga0157372_10046707 | 3300013307 | Bacteria | 4807 |
| 182 | Ga0157372_10066432 | 3300013307 | Bacteria | 4052 |
| 183 | Ga0157372_10091926 | 3300013307 | Unclassified | 3451 |
| 184 | Ga0163163_10014577 | 3300014325 | Bacteria | 7231 |
| 185 | Ga0163163_10032768 | 3300014325 | Bacteria | 5021 |
| 186 | Ga0163163_10111459 | 3300014325 | Bacteria | 2765 |
| 187 | Ga0163163_10125578 | 3300014325 | Bacteria | 2603 |
| 188 | Ga0163163_10130084 | 3300014325 | Unclassified | 2557 |
| 189 | Ga0157376_10015169 | 3300014969 | Bacteria | 5812 |
| 190 | Ga0157376_10019146 | 3300014969 | Bacteria | 5268 |
| 191 | Ga0157376_10071351 | 3300014969 | Bacteria | 2951 |
| 192 | Ga0157376_10107877 | 3300014969 | Bacteria | 2445 |
| 193 | Ga0197907_10699666 | 3300020069 | Bacteria | 1737 |
| 194 | Ga0206351_10543794 | 3300020077 | Bacteria | 1530 |
| 195 | Ga0206350_10305681 | 3300020080 | Bacteria | 1529 |
| 196 | Ga0213873_10026075 | 3300021358 | Bacteria | 1417 |
| 197 | Ga0213872_10001885 | 3300021361 | Bacteria | 12929 |
| 198 | Ga0213872_10036642 | 3300021361 | Bacteria | 2241 |
| 199 | Ga0213874_10006679 | 3300021377 | Bacteria | 2738 |
| 200 | Ga0224712_10038652 | 3300022467 | Bacteria | 1784 |
| 201 | Ga0209233_1003364 | 3300025261 | Bacteria | 5652 |
| 202 | Ga0207656_10035881 | 3300025321 | Unclassified | 2079 |
| 203 | Ga0207692_10246187 | 3300025898 | Unclassified | 1069 |
| 204 | Ga0207680_10125310 | 3300025903 | Bacteria | 1685 |
| 205 | Ga0207647_10011377 | 3300025904 | Bacteria | 6241 |
| 206 | Ga0207647_10024120 | 3300025904 | Bacteria | 4012 |
| 207 | Ga0207699_10089170 | 3300025906 | Unclassified | 1932 |
| 208 | Ga0207699_10448075 | 3300025906 | Bacteria | 925 |
| 209 | Ga0207705_10000024 | 3300025909 | Bacteria | 259977 |
| 210 | Ga0207705_10004909 | 3300025909 | Bacteria | 10037 |
| 211 | Ga0207705_10008017 | 3300025909 | Bacteria | 7744 |
| 212 | Ga0207705_10032417 | 3300025909 | Bacteria | 3734 |
| 213 | Ga0207705_10091553 | 3300025909 | Bacteria | 2227 |
| 214 | Ga0207705_10227930 | 3300025909 | Bacteria | 1416 |
| 215 | Ga0207705_10321203 | 3300025909 | Bacteria | 1190 |
| 216 | Ga0207705_10372386 | 3300025909 | Bacteria | 1102 |
| 217 | Ga0207707_10001569 | 3300025912 | Bacteria | 21033 |
| 218 | Ga0207707_10031219 | 3300025912 | Bacteria | 4661 |
| 219 | Ga0207707_10037731 | 3300025912 | Unclassified | 4222 |
| 220 | Ga0207707_10139693 | 3300025912 | Bacteria | 2118 |
| 221 | Ga0207707_10145211 | 3300025912 | Unclassified | 2074 |
| 222 | Ga0207707_10165395 | 3300025912 | Bacteria | 1933 |
| 223 | Ga0207707_10196614 | 3300025912 | Bacteria | 1759 |
| 224 | Ga0207707_10258594 | 3300025912 | Bacteria | 1511 |
| 225 | Ga0207707_10391626 | 3300025912 | Bacteria | 1194 |
| 226 | Ga0207707_10404718 | 3300025912 | Bacteria | 1171 |
| 227 | Ga0207707_10504461 | 3300025912 | Unclassified | 1032 |
| 228 | Ga0207695_10000804 | 3300025913 | Bacteria | 58597 |
| 229 | Ga0207695_10025139 | 3300025913 | Bacteria | 6678 |
| 230 | Ga0207695_10043943 | 3300025913 | Bacteria | 4757 |
| 231 | Ga0207695_10169861 | 3300025913 | Bacteria | 2107 |
| 232 | Ga0207695_10210599 | 3300025913 | Bacteria | 1854 |
| 233 | Ga0207695_10281775 | 3300025913 | Bacteria | 1556 |
| 234 | Ga0207671_10102488 | 3300025914 | Unclassified | 2169 |
| 235 | Ga0207671_10151431 | 3300025914 | Bacteria | 1792 |
| 236 | Ga0207693_10072137 | 3300025915 | Unclassified | 2704 |
| 237 | Ga0207663_10035771 | 3300025916 | Unclassified | 2982 |
| 238 | Ga0207663_10363003 | 3300025916 | Bacteria | 1099 |
| 239 | Ga0207660_10019212 | 3300025917 | Bacteria | 4564 |
| 240 | Ga0207660_10100334 | 3300025917 | Bacteria | 2161 |
| 241 | Ga0207660_10121114 | 3300025917 | Bacteria | 1982 |
| 242 | Ga0207657_10001844 | 3300025919 | Bacteria | 22887 |
| 243 | Ga0207657_10014767 | 3300025919 | Bacteria | 7604 |
| 244 | Ga0207657_10050629 | 3300025919 | Bacteria | 3615 |
| 245 | Ga0207657_10119658 | 3300025919 | Unclassified | 2167 |
| 246 | Ga0207649_10004392 | 3300025920 | Bacteria | 7655 |
| 247 | Ga0207652_10007088 | 3300025921 | Bacteria | 9031 |
| 248 | Ga0207652_10009357 | 3300025921 | Bacteria | 7879 |
| 249 | Ga0207652_10022473 | 3300025921 | Bacteria | 5218 |
| 250 | Ga0207652_10040614 | 3300025921 | Unclassified | 3951 |
| 251 | Ga0207652_10080949 | 3300025921 | Bacteria | 2840 |
| 252 | Ga0207652_10199627 | 3300025921 | Bacteria | 1800 |
| 253 | Ga0207652_10301491 | 3300025921 | Unclassified | 1446 |
| 254 | Ga0207652_10637729 | 3300025921 | Unclassified | 953 |
| 255 | Ga0207694_10007068 | 3300025924 | Bacteria | 8523 |
| 256 | Ga0207694_10011356 | 3300025924 | Bacteria | 6723 |
| 257 | Ga0207694_10051295 | 3300025924 | Unclassified | 3198 |
| 258 | Ga0207694_10237382 | 3300025924 | Bacteria | 1489 |
| 259 | Ga0207650_10318291 | 3300025925 | Unclassified | 1274 |
| 260 | Ga0207687_10147516 | 3300025927 | Bacteria | 1791 |
| 261 | Ga0207687_10556714 | 3300025927 | Bacteria | 963 |
| 262 | Ga0207700_10029536 | 3300025928 | Bacteria | 3870 |
| 263 | Ga0207700_10081445 | 3300025928 | Bacteria | 2528 |
| 264 | Ga0207700_10111035 | 3300025928 | Bacteria | 2206 |
| 265 | Ga0207664_10017642 | 3300025929 | Bacteria | 5238 |
| 266 | Ga0207664_10062609 | 3300025929 | Bacteria | 2971 |
| 267 | Ga0207664_10194843 | 3300025929 | Unclassified | 1746 |
| 268 | Ga0207664_10254327 | 3300025929 | Bacteria | 1534 |
| 269 | Ga0207644_10036539 | 3300025931 | Bacteria | 3449 |
| 270 | Ga0207690_10000389 | 3300025932 | Bacteria | 29022 |
| 271 | Ga0207690_10132768 | 3300025932 | Unclassified | 1824 |
| 272 | Ga0207690_10165343 | 3300025932 | Bacteria | 1653 |
| 273 | Ga0207665_10028881 | 3300025939 | Bacteria | 3667 |
| 274 | Ga0207665_10178333 | 3300025939 | Unclassified | 1538 |
| 275 | Ga0207665_10250815 | 3300025939 | Bacteria | 1308 |
| 276 | Ga0207711_10122225 | 3300025941 | Bacteria | 2326 |
| 277 | Ga0207711_10318901 | 3300025941 | Bacteria | 1436 |
| 278 | Ga0207661_10010698 | 3300025944 | Bacteria | 6612 |
| 279 | Ga0207661_10012161 | 3300025944 | Bacteria | 6249 |
| 280 | Ga0207679_10074055 | 3300025945 | Bacteria | 2579 |
| 281 | Ga0207679_10114327 | 3300025945 | Bacteria | 2137 |
| 282 | Ga0207679_10246486 | 3300025945 | Bacteria | 1516 |
| 283 | Ga0207667_10000538 | 3300025949 | Bacteria | 50064 |
| 284 | Ga0207667_10001884 | 3300025949 | Bacteria | 26389 |
| 285 | Ga0207667_10025095 | 3300025949 | Bacteria | 6534 |
| 286 | Ga0207667_10044675 | 3300025949 | Bacteria | 4694 |
| 287 | Ga0207667_10046020 | 3300025949 | Unclassified | 4620 |
| 288 | Ga0207667_10111220 | 3300025949 | Bacteria | 2825 |
| 289 | Ga0207667_10262409 | 3300025949 | Bacteria | 1766 |
| 290 | Ga0207651_10440503 | 3300025960 | Unclassified | 1116 |
| 291 | Ga0207712_10060293 | 3300025961 | Bacteria | 2689 |
| 292 | Ga0207668_10033030 | 3300025972 | Bacteria | 3426 |
| 293 | Ga0207640_10000010 | 3300025981 | Bacteria | 275745 |
| 294 | Ga0207640_10043549 | 3300025981 | Unclassified | 2870 |
| 295 | Ga0207640_10356682 | 3300025981 | Bacteria | 1177 |
| 296 | Ga0207658_10574196 | 3300025986 | Bacteria | 1011 |
| 297 | Ga0207677_10064948 | 3300026023 | Unclassified | 2544 |
| 298 | Ga0207703_10206680 | 3300026035 | Bacteria | 1748 |
| 299 | Ga0207639_10000023 | 3300026041 | Bacteria | 215340 |
| 300 | Ga0207639_10007682 | 3300026041 | Bacteria | 7361 |
| 301 | Ga0207639_10016113 | 3300026041 | Bacteria | 5281 |
| 302 | Ga0207639_10021322 | 3300026041 | Unclassified | 4652 |
| 303 | Ga0207639_10065535 | 3300026041 | Unclassified | 2820 |
| 304 | Ga0207639_10231889 | 3300026041 | Unclassified | 1600 |
| 305 | Ga0207678_10002077 | 3300026067 | Bacteria | 18170 |
| 306 | Ga0207678_10003233 | 3300026067 | Bacteria | 14718 |
| 307 | Ga0207678_10008839 | 3300026067 | Bacteria | 8868 |
| 308 | Ga0207678_10122710 | 3300026067 | Bacteria | 2217 |
| 309 | Ga0207641_10094207 | 3300026088 | Bacteria | 2626 |
| 310 | Ga0207676_10066636 | 3300026095 | Bacteria | 2873 |
| 311 | Ga0207674_10001311 | 3300026116 | Bacteria | 32478 |
| 312 | Ga0207674_10070239 | 3300026116 | Bacteria | 3521 |
| 313 | Ga0207674_10137252 | 3300026116 | Unclassified | 2406 |
| 314 | Ga0207698_10008297 | 3300026142 | Bacteria | 6560 |
| 315 | Ga0207698_10011913 | 3300026142 | Bacteria | 5663 |
| 316 | Ga0207698_10126760 | 3300026142 | Bacteria | 2173 |
| 317 | Ga0207698_10508631 | 3300026142 | Unclassified | 1173 |
| 318 | Ga0207698_10788343 | 3300026142 | Unclassified | 952 |
| 319 | Ga0268266_10001615 | 3300028379 | Bacteria | 26291 |
| 320 | Ga0268266_10001974 | 3300028379 | Bacteria | 22989 |
| 321 | Ga0268266_10063331 | 3300028379 | Bacteria | 3192 |
| 322 | Ga0268266_10167249 | 3300028379 | Bacteria | 1993 |
| 323 | Ga0265338_10038803 | 3300028800 | Bacteria | 4505 |
| 324 | Ga0265332_10018877 | 3300031238 | Bacteria | 3045 |
| 325 | Ga0265328_10056903 | 3300031239 | Unclassified | 1435 |
| 326 | Ga0265325_10001599 | 3300031241 | Bacteria | 15804 |
| 327 | Ga0265325_10057004 | 3300031241 | Bacteria | 1993 |
| 328 | Ga0265340_10000590 | 3300031247 | Bacteria | 20174 |
| 329 | Ga0265340_10015596 | 3300031247 | Bacteria | 3946 |
| 330 | Ga0265331_10020545 | 3300031250 | Bacteria | 3388 |
| 331 | Ga0265331_10080910 | 3300031250 | Bacteria | 1509 |
| 332 | Ga0265327_10048045 | 3300031251 | Bacteria | 2247 |
| 333 | Ga0265316_10008885 | 3300031344 | Bacteria | 9277 |
| 334 | Ga0265316_10062596 | 3300031344 | Unclassified | 2887 |
| 335 | Ga0307408_100020476 | 3300031548 | Bacteria | 4467 |
| 336 | Ga0307413_10066196 | 3300031824 | Bacteria | 2254 |
| 337 | Ga0307406_10279894 | 3300031901 | Unclassified | 1272 |
| 338 | Ga0307407_10052077 | 3300031903 | Bacteria | 2349 |
| 339 | Ga0307409_100006808 | 3300031995 | Bacteria | 6762 |
| 340 | Ga0307416_100149218 | 3300032002 | Unclassified | 2141 |
| 341 | Ga0307415_100084395 | 3300032126 | Bacteria | 2279 |
| 342 | Ga0307510_10057512 | 3300033180 | Bacteria | 4035 |
| 343 | Ga0307510_10113543 | 3300033180 | Bacteria | 2442 |
| 344 | Ga0373926_0012764 | 3300035083 | Unclassified | 2843 |
| 345 | Ga0373944_0034888 | 3300035089 | Bacteria | 1531 |
| 346 | Ga0373936_0004381 | 3300035113 | Bacteria | 5338 |
| 347 | Ga0373945_0001513 | 3300035116 | Bacteria | 7100 |
| 348 | Ga0373943_0013220 | 3300035170 | Unclassified | 3725 |
| 349 | Ga0373924_0000059 | 3300035410 | Bacteria | 28501 |
| 350 | Ga0373935_0003805 | 3300035692 | Bacteria | 8813 |
| 351 | Ga0373935_0026176 | 3300035692 | Unclassified | 3598 |
| 352 | Ga0373935_0077297 | 3300035692 | Bacteria | 2157 |
| 353 | Ga0373927_0006966 | 3300035695 | Bacteria | 7673 |
| 354 | Ga0373927_0029166 | 3300035695 | Bacteria | 3596 |
| 355 | Ga0373933_0156249 | 3300035724 | Unclassified | 1447 |
| 356 | Ga0373947_0008862 | 3300035725 | Bacteria | 5788 |
| 357 | Ga0373947_0011661 | 3300035725 | Bacteria | 5042 |
| 358 | Ga0373937_0000408 | 3300036401 | Bacteria | 40094 |
| 359 | Ga0373937_0222236 | 3300036401 | Bacteria | 1778 |
| 360 | Ga0373925_0018521 | 3300037068 | Bacteria | 5061 |
| 361 | Ga0373925_0020358 | 3300037068 | Bacteria | 4829 |
| 362 | Ga0395900_0251721 | 3300037418 | Unclassified | 1768 |
| 363 | Ga0395900_0801027 | 3300037418 | Bacteria | 870 |
| 364 | Ga0395898_0117243 | 3300037466 | Bacteria | 2551 |
| 365 | Ga0395898_0199032 | 3300037466 | Bacteria | 1913 |
| 366 | Ga0395898_0263398 | 3300037466 | Bacteria | 1644 |
| 367 | Ga0395905_0018442 | 3300037471 | Bacteria | 6624 |
| 368 | Ga0395905_0032992 | 3300037471 | Unclassified | 4868 |
| 369 | Ga0395905_0035263 | 3300037471 | Bacteria | 4698 |
| 370 | Ga0395905_0101529 | 3300037471 | Bacteria | 2700 |
| 371 | Ga0395901_0298047 | 3300038443 | Bacteria | 1672 |
| 372 | Ga0436360_0105677 | 3300039438 | Unclassified | 1243 |
| 373 | Ga0436360_0366267 | 3300039438 | Unclassified | 2743 |
| 374 | Ga0436360_0505146 | 3300039438 | Bacteria | 2277 |
| 375 | Ga0436361_0330933 | 3300039447 | Bacteria | 3726 |
| 376 | Ga0436361_0861091 | 3300039447 | Bacteria | 5968 |
| 377 | Ga0436361_0889427 | 3300039447 | Unclassified | 2710 |
| 378 | Ga0436363_0707383 | 3300039450 | Bacteria | 7601 |
| 379 | Ga0436363_1127254 | 3300039450 | Bacteria | 1292 |
| 380 | Ga0436363_1443836 | 3300039450 | Bacteria | 8455 |
| 381 | Ga0436362_0930676 | 3300039453 | Bacteria | 2512 |
| 382 | Ga0466963_0044187 | 3300044694 | Unclassified | 2932 |
| 383 | Ga0466957_0000260 | 3300044842 | Bacteria | 25409 |
| 384 | Ga0466959_0014979 | 3300045049 | Bacteria | 5651 |
| 385 | Ga0466958_0052042 | 3300045836 | Bacteria | 2481 |
| 386 | Ga0466958_0157813 | 3300045836 | Unclassified | 1432 |
| 387 | Ga0466967_0223123 | 3300045976 | Bacteria | 1792 |
| 388 | Ga0466967_0365171 | 3300045976 | Bacteria | 1399 |
| 389 | Ga0466967_0609316 | 3300045976 | Bacteria | 1078 |
| 390 | Ga0466967_0677640 | 3300045976 | Unclassified | 1020 |
| 391 | Ga0466967_0695544 | 3300045976 | Bacteria | 1007 |
| 392 | Ga0466967_0881872 | 3300045976 | Bacteria | 889 |
| 393 | Ga0495629_0180025 | 3300046459 | Bacteria | 1465 |
| 394 | Ga0495638_0147454 | 3300046460 | Bacteria | 1367 |
| 395 | Ga0495651_0009116 | 3300046462 | Bacteria | 7617 |
| 396 | Ga0495651_0049678 | 3300046462 | Bacteria | 3238 |
| 397 | Ga0495651_0196009 | 3300046462 | Bacteria | 1417 |
| 398 | Ga0495651_0275500 | 3300046462 | Bacteria | 1139 |
| 399 | Ga0495653_0024553 | 3300046463 | Bacteria | 4856 |
| 400 | Ga0495650_0000029 | 3300046471 | Bacteria | 453466 |
| 401 | Ga0495650_0008610 | 3300046471 | Bacteria | 5921 |
| 402 | Ga0495650_0102368 | 3300046471 | Unclassified | 1074 |
| 403 | Ga0495580_0031276 | 3300046472 | Unclassified | 3847 |
| 404 | Ga0495580_0044017 | 3300046472 | Bacteria | 3176 |
| 405 | Ga0495580_0115857 | 3300046472 | Unclassified | 1861 |
| 406 | Ga0495580_0327922 | 3300046472 | Unclassified | 1040 |
| 407 | Ga0495582_0076700 | 3300046473 | Bacteria | 1853 |
| 408 | Ga0495582_0347273 | 3300046473 | Bacteria | 854 |
| 409 | Ga0495639_0016207 | 3300046475 | Bacteria | 3234 |
| 410 | Ga0495662_0002704 | 3300046476 | Bacteria | 8963 |
| 411 | Ga0495664_0020741 | 3300046477 | Bacteria | 3793 |
| 412 | Ga0495585_0043436 | 3300046492 | Bacteria | 2514 |
| 413 | Ga0495594_0002013 | 3300046499 | Bacteria | 10582 |
| 414 | Ga0495594_0035442 | 3300046499 | Bacteria | 2718 |
| 415 | Ga0495594_0091363 | 3300046499 | Unclassified | 1706 |
| 416 | Ga0495583_0067044 | 3300046506 | Bacteria | 1586 |
| 417 | Ga0495628_0064660 | 3300046516 | Bacteria | 2863 |
| 418 | Ga0495644_0000316 | 3300046523 | Bacteria | 22262 |
| 419 | Ga0495648_0175588 | 3300046524 | Bacteria | 1094 |
| 420 | Ga0495652_0049688 | 3300046529 | Bacteria | 3589 |
| 421 | Ga0495665_0019314 | 3300046531 | Bacteria | 3664 |
| 422 | Ga0495586_0222484 | 3300046535 | Unclassified | 1073 |
| 423 | Ga0495587_0041236 | 3300046536 | Bacteria | 2755 |
| 424 | Ga0495609_0161679 | 3300046538 | Bacteria | 949 |
| 425 | Ga0495645_0084570 | 3300046543 | Bacteria | 2272 |
| 426 | Ga0495622_0032861 | 3300046557 | Bacteria | 2422 |
| 427 | Ga0495633_0039548 | 3300046558 | Bacteria | 2251 |
| 428 | Ga0495667_0093843 | 3300046559 | Bacteria | 1943 |
| 429 | Ga0495667_0195659 | 3300046559 | Bacteria | 1295 |
| 430 | Ga0495634_0008386 | 3300046642 | Bacteria | 7700 |
| 431 | Ga0495611_0096048 | 3300046648 | Bacteria | 1372 |
| 432 | Ga0495625_0001024 | 3300046660 | Bacteria | 36797 |
| 433 | Ga0495625_0081381 | 3300046660 | Bacteria | 2254 |
| 434 | Ga0495625_0081636 | 3300046660 | Bacteria | 2250 |
| 435 | Ga0495635_0214844 | 3300046663 | Bacteria | 1302 |
| 436 | Ga0495659_0029110 | 3300046664 | Bacteria | 1916 |
| 437 | Ga0495661_0049964 | 3300046665 | Bacteria | 2534 |
| 438 | Ga0495599_0066149 | 3300046678 | Bacteria | 2258 |
| 439 | Ga0495623_0224509 | 3300046679 | Bacteria | 1068 |
| 440 | Ga0495646_0048054 | 3300046680 | Bacteria | 2595 |
| 441 | Ga0495669_0005797 | 3300046684 | Bacteria | 5151 |
| 442 | Ga0495669_0008085 | 3300046684 | Bacteria | 4415 |
| 443 | Ga0495669_0018724 | 3300046684 | Bacteria | 2980 |
| 444 | Ga0495669_0029510 | 3300046684 | Bacteria | 2405 |
| 445 | Ga0495669_0130409 | 3300046684 | Bacteria | 1183 |
| 446 | Ga0495613_0058072 | 3300046689 | Bacteria | 2840 |
| 447 | Ga0495624_0106983 | 3300046690 | Bacteria | 1721 |
| 448 | Ga0495600_0001535 | 3300046809 | Bacteria | 12828 |
| 449 | Ga0495600_0319121 | 3300046809 | Bacteria | 977 |
| 450 | Ga0495581_0003151 | 3300047315 | Bacteria | 9438 |
| 451 | Ga0495581_0081019 | 3300047315 | Unclassified | 1879 |
| 452 | Ga0495604_0035821 | 3300047317 | Bacteria | 3917 |
| 453 | Ga0495604_0044413 | 3300047317 | Bacteria | 3472 |
| 454 | Ga0495604_0181146 | 3300047317 | Unclassified | 1474 |
| 455 | Ga0495674_0233755 | 3300047319 | Bacteria | 1516 |
| 456 | Ga0495672_0009742 | 3300047320 | Bacteria | 6925 |
| 457 | Ga0495680_0044789 | 3300047322 | Bacteria | 3497 |
| 458 | Ga0495675_0011199 | 3300047444 | Bacteria | 5625 |
| 459 | Ga0495675_0082427 | 3300047444 | Bacteria | 2025 |
| 460 | Ga0495675_0296196 | 3300047444 | Bacteria | 962 |
| 461 | Ga0495684_0055408 | 3300047471 | Bacteria | 3024 |
| 462 | Ga0495684_0087056 | 3300047471 | Bacteria | 2368 |
| 463 | Ga0495686_0004468 | 3300047472 | Bacteria | 11510 |
| 464 | Ga0495686_0024612 | 3300047472 | Bacteria | 3953 |
| 465 | Ga0495593_0036788 | 3300047673 | Bacteria | 2653 |
| 466 | Ga0496100_0054934 | 3300048903 | Unclassified | 2600 |
| 467 | Ga0496102_0061394 | 3300048905 | Unclassified | 3440 |
| 468 | Ga0496102_0266559 | 3300048905 | Bacteria | 1615 |
| 469 | Ga0496102_0512211 | 3300048905 | Bacteria | 1122 |
| 470 | Ga0496103_0010051 | 3300048906 | Bacteria | 5595 |
| 471 | Ga0496104_0000648 | 3300048907 | Bacteria | 29835 |
| 472 | Ga0496104_0020982 | 3300048907 | Bacteria | 5994 |
| 473 | Ga0496104_0190632 | 3300048907 | Unclassified | 1961 |
| 474 | Ga0496104_0206936 | 3300048907 | Bacteria | 1874 |
| 475 | Ga0496104_0785562 | 3300048907 | Bacteria | 858 |
| 476 | Ga0496105_0000590 | 3300048908 | Bacteria | 24188 |
| 477 | Ga0496105_0077621 | 3300048908 | Bacteria | 2743 |
| 478 | Ga0496105_0227609 | 3300048908 | Bacteria | 1516 |
| 479 | Ga0496107_0595721 | 3300048910 | Unclassified | 817 |
| 480 | Ga0496108_0026130 | 3300048911 | Bacteria | 4816 |
| 481 | Ga0496109_0094912 | 3300048912 | Unclassified | 2761 |
| 482 | Ga0496109_0166095 | 3300048912 | Bacteria | 2069 |
| 483 | Ga0496110_0026711 | 3300048913 | Unclassified | 4944 |
| 484 | Ga0496110_0096398 | 3300048913 | Unclassified | 2651 |
| 485 | Ga0496111_0000490 | 3300048914 | Bacteria | 20373 |
| 486 | Ga0496111_0266855 | 3300048914 | Bacteria | 1270 |
| 487 | Ga0496111_0503889 | 3300048914 | Unclassified | 891 |
| 488 | Ga0496112_0023092 | 3300048915 | Bacteria | 5937 |
| 489 | Ga0496112_0088443 | 3300048915 | Bacteria | 3065 |
| 490 | Ga0496112_0091943 | 3300048915 | Bacteria | 3003 |
| 491 | Ga0496112_0189446 | 3300048915 | Bacteria | 2019 |
| 492 | Ga0496112_0306756 | 3300048915 | Bacteria | 1532 |
| 493 | Ga0496113_0004714 | 3300048916 | Bacteria | 8417 |
| 494 | Ga0496113_0115375 | 3300048916 | Bacteria | 2095 |
| 495 | Ga0496113_0144427 | 3300048916 | Unclassified | 1873 |
| 496 | Ga0496115_0166808 | 3300048918 | Bacteria | 1821 |
| 497 | Ga0496126_0000093 | 3300048929 | Bacteria | 208741 |
| 498 | Ga0496126_0000191 | 3300048929 | Bacteria | 137108 |
| 499 | Ga0496126_0001093 | 3300048929 | Bacteria | 45526 |
| 500 | Ga0496126_0002173 | 3300048929 | Bacteria | 27234 |
| 501 | Ga0496126_0003783 | 3300048929 | Bacteria | 18780 |
| 502 | Ga0496126_0640760 | 3300048929 | Unclassified | 833 |
| 503 | Ga0495682_0020941 | 3300049460 | Bacteria | 2452 |
| 504 | Ga0501031_0026645 | 3300049568 | Bacteria | 3768 |
| 505 | Ga0501032_0002834 | 3300049569 | Bacteria | 13488 |
| 506 | Ga0501032_0262515 | 3300049569 | Bacteria | 1120 |
| 507 | Ga0501034_0004264 | 3300049571 | Bacteria | 15952 |
| 508 | Ga0501037_0001771 | 3300049573 | Bacteria | 15679 |
| 509 | Ga0501037_0266183 | 3300049573 | Bacteria | 1197 |
| 510 | Ga0501038_0000845 | 3300049574 | Bacteria | 27143 |
| 511 | Ga0501038_0245752 | 3300049574 | Bacteria | 1419 |
| 512 | Ga0501039_0267728 | 3300049575 | Bacteria | 1343 |
| 513 | Ga0501043_0002287 | 3300049579 | Bacteria | 16248 |
| 514 | Ga0501046_0004323 | 3300049580 | Bacteria | 12931 |
| 515 | Ga0501047_0001407 | 3300049581 | Bacteria | 23589 |
| 516 | Ga0501047_0208206 | 3300049581 | Bacteria | 1815 |
| 517 | Ga0501073_0009655 | 3300049589 | Bacteria | 7115 |
| 518 | Ga0501073_0035998 | 3300049589 | Bacteria | 3518 |
| 519 | Ga0501080_0009311 | 3300049742 | Bacteria | 8955 |
| 520 | Ga0501035_0005515 | 3300049822 | Bacteria | 11956 |
| 521 | Ga0501035_0182020 | 3300049822 | Bacteria | 1810 |
| 522 | Ga0501044_0002709 | 3300049823 | Bacteria | 20135 |
| 523 | nmdc:mga05p37_201588_c1 | 3300050507 | Bacteria | 2409 |
| 524 | nmdc:mga0n895_111564_c1 | 3300050512 | Unclassified | 2751 |
| 525 | nmdc:mga08x19_14605_c1 | 3300050514 | Bacteria | 4765 |
| 526 | nmdc:mga08x19_374380_c1 | 3300050514 | Bacteria | 997 |
| 527 | nmdc:mga08x19_38896_c1 | 3300050514 | Bacteria | 3022 |
| 528 | Ga0500643_031044 | 3300053087 | Bacteria | 1632 |
| 529 | Ga0500651_0000008 | 3300053093 | Bacteria | 287738 |
| 530 | Ga0500595_000187 | 3300053119 | Bacteria | 42083 |
| 531 | Ga0501084_0030844 | 3300054114 | Bacteria | 4482 |
| 532 | 2884216953 | 2884215851 | Bacteria | 4554841 |
| 533 | Ga0451577_0523429 | |||
| 534 | LJNas_1001321 | |||
| 535 | rootH1_10332512 | |||
| 536 | rootH1_10365739 | |||
| 537 | Ga0058863_10011887 | |||
| 538 | Ga0058861_10043048 | |||
| 539 | Ga0058862_10220838 | |||
| 540 | Ga0070658_10000004 | |||
| 541 | Ga0070658_10009641 | |||
| 542 | Ga0070658_10024444 | |||
| 543 | Ga0070658_10027091 | |||
| 544 | Ga0070658_10031393 | |||
| 545 | Ga0070658_10182979 | |||
| 546 | Ga0070658_10258483 | |||
| 547 | Ga0070683_100026850 | |||
| 548 | Ga0070683_100031861 | |||
| 549 | Ga0070683_100109110 | |||
| 550 | Ga0070666_10194344 | |||
| 551 | Ga0070680_100031806 | |||
| 552 | Ga0070680_100033409 | |||
| 553 | Ga0070680_100069983 | |||
| 554 | Ga0070682_100007377 | |||
| 555 | Ga0068868_100019387 | |||
| 556 | Ga0070660_100012775 | |||
| 557 | Ga0070660_100014364 | |||
| 558 | Ga0070660_100049021 | |||
| 559 | Ga0070660_100123829 | |||
| 560 | Ga0070660_100138221 | |||
| 561 | Ga0070660_100299420 | |||
| 562 | Ga0070691_10072105 | |||
| 563 | Ga0070661_100042798 | |||
| 564 | Ga0070661_100054268 | |||
| 565 | Ga0070692_10086510 | |||
| 566 | Ga0070692_10336904 | |||
| 567 | Ga0070671_100006455 | |||
| 568 | Ga0070673_100291137 | |||
| 569 | Ga0070659_100000601 | |||
| 570 | Ga0070709_10019087 | |||
| 571 | Ga0070714_100058263 | |||
| 572 | Ga0070714_100065367 | |||
| 573 | Ga0070714_100194322 | |||
| 574 | Ga0070713_100010252 | |||
| 575 | Ga0070713_100087268 | |||
| 576 | Ga0070713_100205797 | |||
| 577 | Ga0070713_100487848 | |||
| 578 | Ga0070710_10425401 | |||
| 579 | Ga0070711_100026570 | |||
| 580 | Ga0070711_100308081 | |||
| 581 | Ga0070678_100260326 | |||
| 582 | Ga0070681_10009446 | |||
| 583 | Ga0070681_10040779 | |||
| 584 | Ga0070681_10043372 | |||
| 585 | Ga0070681_10073266 | |||
| 586 | Ga0070681_10147684 | |||
| 587 | Ga0070681_10158617 | |||
| 588 | Ga0070681_10203179 | |||
| 589 | Ga0070681_10379564 | |||
| 590 | Ga0070681_10674690 | |||
| 591 | Ga0070679_100002283 | |||
| 592 | Ga0070679_100037253 | |||
| 593 | Ga0070679_100058910 | |||
| 594 | Ga0070679_100103720 | |||
| 595 | Ga0070679_100209546 | |||
| 596 | Ga0070684_100014368 | |||
| 597 | Ga0070684_100072207 | |||
| 598 | Ga0070684_100160153 | |||
| 599 | Ga0070697_100014663 | |||
| 600 | Ga0070697_100114667 | |||
| 601 | Ga0068853_100000100 | |||
| 602 | Ga0068853_100030975 | |||
| 603 | Ga0068853_100037552 | |||
| 604 | Ga0068853_100048137 | |||
| 605 | Ga0068853_100159694 | |||
| 606 | Ga0068853_100262814 | |||
| 607 | Ga0068853_100421609 | |||
| 608 | Ga0070695_100018465 | |||
| 609 | Ga0070696_100048934 | |||
| 610 | Ga0070693_100006969 | |||
| 611 | Ga0070665_100021347 | |||
| 612 | Ga0070665_100033876 | |||
| 613 | Ga0070665_100054614 | |||
| 614 | Ga0068855_100007892 | |||
| 615 | Ga0068855_100037522 | |||
| 616 | Ga0068855_100047543 | |||
| 617 | Ga0068855_100062699 | |||
| 618 | Ga0068855_100079747 | |||
| 619 | Ga0068855_100087189 | |||
| 620 | Ga0068855_100090590 | |||
| 621 | Ga0068855_100262295 | |||
| 622 | Ga0068855_100310312 | |||
| 623 | Ga0070664_100067129 | |||
| 624 | Ga0070664_100087569 | |||
| 625 | Ga0068857_100055905 | |||
| 626 | Ga0068854_100000074 | |||
| 627 | Ga0068854_100048369 | |||
| 628 | Ga0068854_100106515 | |||
| 629 | Ga0068854_100232696 | |||
| 630 | Ga0068854_100287006 | |||
| 631 | Ga0068856_100024943 | |||
| 632 | Ga0068856_100035422 | |||
| 633 | Ga0068856_100209104 | |||
| 634 | Ga0068856_100608136 | |||
| 635 | Ga0068852_100004648 | |||
| 636 | Ga0068852_100013376 | |||
| 637 | Ga0068852_100148906 | |||
| 638 | Ga0068852_100560529 | |||
| 639 | Ga0068864_100016174 | |||
| 640 | Ga0068864_100240106 | |||
| 641 | Ga0068851_10051566 | |||
| 642 | Ga0068863_100015404 | |||
| 643 | Ga0068858_100315072 | |||
| 644 | Ga0081540_1006852 | |||
| 645 | Ga0070717_10114921 | |||
| 646 | Ga0070716_100059017 | |||
| 647 | Ga0070716_100221623 | |||
| 648 | Ga0070712_100431882 | |||
| 649 | Ga0075434_100111154 | |||
| 650 | Ga0075436_100006391 | |||
| 651 | Ga0075436_100015574 | |||
| 652 | Ga0075436_100043592 | |||
| 653 | Ga0105240_10001235 | |||
| 654 | Ga0105240_10003079 | |||
| 655 | Ga0105240_10014142 | |||
| 656 | Ga0105240_10131799 | |||
| 657 | Ga0105240_10152462 | |||
| 658 | Ga0105240_10240786 | |||
| 659 | Ga0105240_10864438 | |||
| 660 | Ga0105245_10029968 | |||
| 661 | Ga0105245_10181404 | |||
| 662 | Ga0114129_10106555 | |||
| 663 | Ga0105241_10261665 | |||
| 664 | Ga0105241_10563643 | |||
| 665 | Ga0105248_10014521 | |||
| 666 | Ga0105248_10110100 | |||
| 667 | Ga0105248_10627790 | |||
| 668 | Ga0105248_10876540 | |||
| 669 | Ga0105237_10012226 | |||
| 670 | Ga0105237_10194413 | |||
| 671 | Ga0105237_10273624 | |||
| 672 | Ga0105237_10774566 | |||
| 673 | Ga0105238_10003571 | |||
| 674 | Ga0105238_10008859 | |||
| 675 | Ga0105238_10012260 | |||
| 676 | Ga0105238_10024665 | |||
| 677 | Ga0105238_10031252 | |||
| 678 | Ga0105238_10134679 | |||
| 679 | Ga0105238_10409069 | |||
| 680 | Ga0105249_10027220 | |||
| 681 | Ga0105239_10091987 | |||
| 682 | Ga0105239_10377975 | |||
| 683 | Ga0157373_10029579 | |||
| 684 | Ga0157373_10142761 | |||
| 685 | Ga0157373_10158566 | |||
| 686 | Ga0157371_10142235 | |||
| 687 | Ga0157370_10025296 | |||
| 688 | Ga0157370_10040457 | |||
| 689 | Ga0157370_10053172 | |||
| 690 | Ga0157370_10072305 | |||
| 691 | Ga0157370_10078802 | |||
| 692 | Ga0157370_10112312 | |||
| 693 | Ga0157370_10123159 | |||
| 694 | Ga0157370_10192381 | |||
| 695 | Ga0157370_10445656 | |||
| 696 | Ga0157369_10000442 | |||
| 697 | Ga0157369_10010057 | |||
| 698 | Ga0157369_10037540 | |||
| 699 | Ga0157369_10077474 | |||
| 700 | Ga0157369_10185635 | |||
| 701 | Ga0157369_10257396 | |||
| 702 | Ga0157369_10347084 | |||
| 703 | Ga0157374_10078895 | |||
| 704 | Ga0157374_10105455 | |||
| 705 | Ga0157374_10121862 | |||
| 706 | Ga0157374_10148518 | |||
| 707 | Ga0157374_10213067 | |||
| 708 | Ga0163162_10195832 | |||
| 709 | Ga0163162_10359752 | |||
| 710 | Ga0157372_10011458 | |||
| 711 | Ga0157372_10012096 | |||
| 712 | Ga0157372_10027551 | |||
| 713 | Ga0157372_10046707 | |||
| 714 | Ga0157372_10066432 | |||
| 715 | Ga0157372_10091926 | |||
| 716 | Ga0163163_10014577 | |||
| 717 | Ga0163163_10032768 | |||
| 718 | Ga0163163_10111459 | |||
| 719 | Ga0163163_10125578 | |||
| 720 | Ga0163163_10130084 | |||
| 721 | Ga0157376_10015169 | |||
| 722 | Ga0157376_10019146 | |||
| 723 | Ga0157376_10071351 | |||
| 724 | Ga0157376_10107877 | |||
| 725 | Ga0197907_10699666 | |||
| 726 | Ga0206351_10543794 | |||
| 727 | Ga0206350_10305681 | |||
| 728 | Ga0213873_10026075 | |||
| 729 | Ga0213872_10001885 | |||
| 730 | Ga0213872_10036642 | |||
| 731 | Ga0213874_10006679 | |||
| 732 | Ga0224712_10038652 | |||
| 733 | Ga0209233_1003364 | |||
| 734 | Ga0207656_10035881 | |||
| 735 | Ga0207692_10246187 | |||
| 736 | Ga0207680_10125310 | |||
| 737 | Ga0207647_10011377 | |||
| 738 | Ga0207647_10024120 | |||
| 739 | Ga0207699_10089170 | |||
| 740 | Ga0207699_10448075 | |||
| 741 | Ga0207705_10000024 | |||
| 742 | Ga0207705_10004909 | |||
| 743 | Ga0207705_10008017 | |||
| 744 | Ga0207705_10032417 | |||
| 745 | Ga0207705_10091553 | |||
| 746 | Ga0207705_10227930 | |||
| 747 | Ga0207705_10321203 | |||
| 748 | Ga0207705_10372386 | |||
| 749 | Ga0207707_10001569 | |||
| 750 | Ga0207707_10031219 | |||
| 751 | Ga0207707_10037731 | |||
| 752 | Ga0207707_10139693 | |||
| 753 | Ga0207707_10145211 | |||
| 754 | Ga0207707_10165395 | |||
| 755 | Ga0207707_10196614 | |||
| 756 | Ga0207707_10258594 | |||
| 757 | Ga0207707_10391626 | |||
| 758 | Ga0207707_10404718 | |||
| 759 | Ga0207707_10504461 | |||
| 760 | Ga0207695_10000804 | |||
| 761 | Ga0207695_10025139 | |||
| 762 | Ga0207695_10043943 | |||
| 763 | Ga0207695_10169861 | |||
| 764 | Ga0207695_10210599 | |||
| 765 | Ga0207695_10281775 | |||
| 766 | Ga0207671_10102488 | |||
| 767 | Ga0207671_10151431 | |||
| 768 | Ga0207693_10072137 | |||
| 769 | Ga0207663_10035771 | |||
| 770 | Ga0207663_10363003 | |||
| 771 | Ga0207660_10019212 | |||
| 772 | Ga0207660_10100334 | |||
| 773 | Ga0207660_10121114 | |||
| 774 | Ga0207657_10001844 | |||
| 775 | Ga0207657_10014767 | |||
| 776 | Ga0207657_10050629 | |||
| 777 | Ga0207657_10119658 | |||
| 778 | Ga0207649_10004392 | |||
| 779 | Ga0207652_10007088 | |||
| 780 | Ga0207652_10009357 | |||
| 781 | Ga0207652_10022473 | |||
| 782 | Ga0207652_10040614 | |||
| 783 | Ga0207652_10080949 | |||
| 784 | Ga0207652_10199627 | |||
| 785 | Ga0207652_10301491 | |||
| 786 | Ga0207652_10637729 | |||
| 787 | Ga0207694_10007068 | |||
| 788 | Ga0207694_10011356 | |||
| 789 | Ga0207694_10051295 | |||
| 790 | Ga0207694_10237382 | |||
| 791 | Ga0207650_10318291 | |||
| 792 | Ga0207687_10147516 | |||
| 793 | Ga0207687_10556714 | |||
| 794 | Ga0207700_10029536 | |||
| 795 | Ga0207700_10081445 | |||
| 796 | Ga0207700_10111035 | |||
| 797 | Ga0207664_10017642 | |||
| 798 | Ga0207664_10062609 | |||
| 799 | Ga0207664_10194843 | |||
| 800 | Ga0207664_10254327 | |||
| 801 | Ga0207644_10036539 | |||
| 802 | Ga0207690_10000389 | |||
| 803 | Ga0207690_10132768 | |||
| 804 | Ga0207690_10165343 | |||
| 805 | Ga0207665_10028881 | |||
| 806 | Ga0207665_10178333 | |||
| 807 | Ga0207665_10250815 | |||
| 808 | Ga0207711_10122225 | |||
| 809 | Ga0207711_10318901 | |||
| 810 | Ga0207661_10010698 | |||
| 811 | Ga0207661_10012161 | |||
| 812 | Ga0207679_10074055 | |||
| 813 | Ga0207679_10114327 | |||
| 814 | Ga0207679_10246486 | |||
| 815 | Ga0207667_10000538 | |||
| 816 | Ga0207667_10001884 | |||
| 817 | Ga0207667_10025095 | |||
| 818 | Ga0207667_10044675 | |||
| 819 | Ga0207667_10046020 | |||
| 820 | Ga0207667_10111220 | |||
| 821 | Ga0207667_10262409 | |||
| 822 | Ga0207651_10440503 | |||
| 823 | Ga0207712_10060293 | |||
| 824 | Ga0207668_10033030 | |||
| 825 | Ga0207640_10000010 | |||
| 826 | Ga0207640_10043549 | |||
| 827 | Ga0207640_10356682 | |||
| 828 | Ga0207658_10574196 | |||
| 829 | Ga0207677_10064948 | |||
| 830 | Ga0207703_10206680 | |||
| 831 | Ga0207639_10000023 | |||
| 832 | Ga0207639_10007682 | |||
| 833 | Ga0207639_10016113 | |||
| 834 | Ga0207639_10021322 | |||
| 835 | Ga0207639_10065535 | |||
| 836 | Ga0207639_10231889 | |||
| 837 | Ga0207678_10002077 | |||
| 838 | Ga0207678_10003233 | |||
| 839 | Ga0207678_10008839 | |||
| 840 | Ga0207678_10122710 | |||
| 841 | Ga0207641_10094207 | |||
| 842 | Ga0207676_10066636 | |||
| 843 | Ga0207674_10001311 | |||
| 844 | Ga0207674_10070239 | |||
| 845 | Ga0207674_10137252 | |||
| 846 | Ga0207698_10008297 | |||
| 847 | Ga0207698_10011913 | |||
| 848 | Ga0207698_10126760 | |||
| 849 | Ga0207698_10508631 | |||
| 850 | Ga0207698_10788343 | |||
| 851 | Ga0268266_10001615 | |||
| 852 | Ga0268266_10001974 | |||
| 853 | Ga0268266_10063331 | |||
| 854 | Ga0268266_10167249 | |||
| 855 | Ga0265338_10038803 | |||
| 856 | Ga0265332_10018877 | |||
| 857 | Ga0265328_10056903 | |||
| 858 | Ga0265325_10001599 | |||
| 859 | Ga0265325_10057004 | |||
| 860 | Ga0265340_10000590 | |||
| 861 | Ga0265340_10015596 | |||
| 862 | Ga0265331_10020545 | |||
| 863 | Ga0265331_10080910 | |||
| 864 | Ga0265327_10048045 | |||
| 865 | Ga0265316_10008885 | |||
| 866 | Ga0265316_10062596 | |||
| 867 | Ga0307408_100020476 | |||
| 868 | Ga0307413_10066196 | |||
| 869 | Ga0307406_10279894 | |||
| 870 | Ga0307407_10052077 | |||
| 871 | Ga0307409_100006808 | |||
| 872 | Ga0307416_100149218 | |||
| 873 | Ga0307415_100084395 | |||
| 874 | Ga0307510_10057512 | |||
| 875 | Ga0307510_10113543 | |||
| 876 | Ga0373926_0012764 | |||
| 877 | Ga0373944_0034888 | |||
| 878 | Ga0373936_0004381 | |||
| 879 | Ga0373945_0001513 | |||
| 880 | Ga0373943_0013220 | |||
| 881 | Ga0373924_0000059 | |||
| 882 | Ga0373935_0003805 | |||
| 883 | Ga0373935_0026176 | |||
| 884 | Ga0373935_0077297 | |||
| 885 | Ga0373927_0006966 | |||
| 886 | Ga0373927_0029166 | |||
| 887 | Ga0373933_0156249 | |||
| 888 | Ga0373947_0008862 | |||
| 889 | Ga0373947_0011661 | |||
| 890 | Ga0373937_0000408 | |||
| 891 | Ga0373937_0222236 | |||
| 892 | Ga0373925_0018521 | |||
| 893 | Ga0373925_0020358 | |||
| 894 | Ga0395900_0251721 | |||
| 895 | Ga0395900_0801027 | |||
| 896 | Ga0395898_0117243 | |||
| 897 | Ga0395898_0199032 | |||
| 898 | Ga0395898_0263398 | |||
| 899 | Ga0395905_0018442 | |||
| 900 | Ga0395905_0032992 | |||
| 901 | Ga0395905_0035263 | |||
| 902 | Ga0395905_0101529 | |||
| 903 | Ga0395901_0298047 | |||
| 904 | Ga0436360_0105677 | |||
| 905 | Ga0436360_0366267 | |||
| 906 | Ga0436360_0505146 | |||
| 907 | Ga0436361_0330933 | |||
| 908 | Ga0436361_0861091 | |||
| 909 | Ga0436361_0889427 | |||
| 910 | Ga0436363_0707383 | |||
| 911 | Ga0436363_1127254 | |||
| 912 | Ga0436363_1443836 | |||
| 913 | Ga0436362_0930676 | |||
| 914 | Ga0466963_0044187 | |||
| 915 | Ga0466957_0000260 | |||
| 916 | Ga0466959_0014979 | |||
| 917 | Ga0466958_0052042 | |||
| 918 | Ga0466958_0157813 | |||
| 919 | Ga0466967_0223123 | |||
| 920 | Ga0466967_0365171 | |||
| 921 | Ga0466967_0609316 | |||
| 922 | Ga0466967_0677640 | |||
| 923 | Ga0466967_0695544 | |||
| 924 | Ga0466967_0881872 | |||
| 925 | Ga0495629_0180025 | |||
| 926 | Ga0495638_0147454 | |||
| 927 | Ga0495651_0009116 | |||
| 928 | Ga0495651_0049678 | |||
| 929 | Ga0495651_0196009 | |||
| 930 | Ga0495651_0275500 | |||
| 931 | Ga0495653_0024553 | |||
| 932 | Ga0495650_0000029 | |||
| 933 | Ga0495650_0008610 | |||
| 934 | Ga0495650_0102368 | |||
| 935 | Ga0495580_0031276 | |||
| 936 | Ga0495580_0044017 | |||
| 937 | Ga0495580_0115857 | |||
| 938 | Ga0495580_0327922 | |||
| 939 | Ga0495582_0076700 | |||
| 940 | Ga0495582_0347273 | |||
| 941 | Ga0495639_0016207 | |||
| 942 | Ga0495662_0002704 | |||
| 943 | Ga0495664_0020741 | |||
| 944 | Ga0495585_0043436 | |||
| 945 | Ga0495594_0002013 | |||
| 946 | Ga0495594_0035442 | |||
| 947 | Ga0495594_0091363 | |||
| 948 | Ga0495583_0067044 | |||
| 949 | Ga0495628_0064660 | |||
| 950 | Ga0495644_0000316 | |||
| 951 | Ga0495648_0175588 | |||
| 952 | Ga0495652_0049688 | |||
| 953 | Ga0495665_0019314 | |||
| 954 | Ga0495586_0222484 | |||
| 955 | Ga0495587_0041236 | |||
| 956 | Ga0495609_0161679 | |||
| 957 | Ga0495645_0084570 | |||
| 958 | Ga0495622_0032861 | |||
| 959 | Ga0495633_0039548 | |||
| 960 | Ga0495667_0093843 | |||
| 961 | Ga0495667_0195659 | |||
| 962 | Ga0495634_0008386 | |||
| 963 | Ga0495611_0096048 | |||
| 964 | Ga0495625_0001024 | |||
| 965 | Ga0495625_0081381 | |||
| 966 | Ga0495625_0081636 | |||
| 967 | Ga0495635_0214844 | |||
| 968 | Ga0495659_0029110 | |||
| 969 | Ga0495661_0049964 | |||
| 970 | Ga0495599_0066149 | |||
| 971 | Ga0495623_0224509 | |||
| 972 | Ga0495646_0048054 | |||
| 973 | Ga0495669_0005797 | |||
| 974 | Ga0495669_0008085 | |||
| 975 | Ga0495669_0018724 | |||
| 976 | Ga0495669_0029510 | |||
| 977 | Ga0495669_0130409 | |||
| 978 | Ga0495613_0058072 | |||
| 979 | Ga0495624_0106983 | |||
| 980 | Ga0495600_0001535 | |||
| 981 | Ga0495600_0319121 | |||
| 982 | Ga0495581_0003151 | |||
| 983 | Ga0495581_0081019 | |||
| 984 | Ga0495604_0035821 | |||
| 985 | Ga0495604_0044413 | |||
| 986 | Ga0495604_0181146 | |||
| 987 | Ga0495674_0233755 | |||
| 988 | Ga0495672_0009742 | |||
| 989 | Ga0495680_0044789 | |||
| 990 | Ga0495675_0011199 | |||
| 991 | Ga0495675_0082427 | |||
| 992 | Ga0495675_0296196 | |||
| 993 | Ga0495684_0055408 | |||
| 994 | Ga0495684_0087056 | |||
| 995 | Ga0495686_0004468 | |||
| 996 | Ga0495686_0024612 | |||
| 997 | Ga0495593_0036788 | |||
| 998 | Ga0496100_0054934 | |||
| 999 | Ga0496102_0061394 | |||
| 1000 | Ga0496102_0266559 | |||
| 1001 | Ga0496102_0512211 | |||
| 1002 | Ga0496103_0010051 | |||
| 1003 | Ga0496104_0000648 | |||
| 1004 | Ga0496104_0020982 | |||
| 1005 | Ga0496104_0190632 | |||
| 1006 | Ga0496104_0206936 | |||
| 1007 | Ga0496104_0785562 | |||
| 1008 | Ga0496105_0000590 | |||
| 1009 | Ga0496105_0077621 | |||
| 1010 | Ga0496105_0227609 | |||
| 1011 | Ga0496107_0595721 | |||
| 1012 | Ga0496108_0026130 | |||
| 1013 | Ga0496109_0094912 | |||
| 1014 | Ga0496109_0166095 | |||
| 1015 | Ga0496110_0026711 | |||
| 1016 | Ga0496110_0096398 | |||
| 1017 | Ga0496111_0000490 | |||
| 1018 | Ga0496111_0266855 | |||
| 1019 | Ga0496111_0503889 | |||
| 1020 | Ga0496112_0023092 | |||
| 1021 | Ga0496112_0088443 | |||
| 1022 | Ga0496112_0091943 | |||
| 1023 | Ga0496112_0189446 | |||
| 1024 | Ga0496112_0306756 | |||
| 1025 | Ga0496113_0004714 | |||
| 1026 | Ga0496113_0115375 | |||
| 1027 | Ga0496113_0144427 | |||
| 1028 | Ga0496115_0166808 | |||
| 1029 | Ga0496126_0000093 | |||
| 1030 | Ga0496126_0000191 | |||
| 1031 | Ga0496126_0001093 | |||
| 1032 | Ga0496126_0002173 | |||
| 1033 | Ga0496126_0003783 | |||
| 1034 | Ga0496126_0640760 | |||
| 1035 | Ga0495682_0020941 | |||
| 1036 | Ga0501031_0026645 | |||
| 1037 | Ga0501032_0002834 | |||
| 1038 | Ga0501032_0262515 | |||
| 1039 | Ga0501034_0004264 | |||
| 1040 | Ga0501037_0001771 | |||
| 1041 | Ga0501037_0266183 | |||
| 1042 | Ga0501038_0000845 | |||
| 1043 | Ga0501038_0245752 | |||
| 1044 | Ga0501039_0267728 | |||
| 1045 | Ga0501043_0002287 | |||
| 1046 | Ga0501046_0004323 | |||
| 1047 | Ga0501047_0001407 | |||
| 1048 | Ga0501047_0208206 | |||
| 1049 | Ga0501073_0009655 | |||
| 1050 | Ga0501073_0035998 | |||
| 1051 | Ga0501080_0009311 | |||
| 1052 | Ga0501035_0005515 | |||
| 1053 | Ga0501035_0182020 | |||
| 1054 | Ga0501044_0002709 | |||
| 1055 | nmdc:mga05p37_201588_c1 | |||
| 1056 | nmdc:mga0n895_111564_c1 | |||
| 1057 | nmdc:mga08x19_14605_c1 | |||
| 1058 | nmdc:mga08x19_374380_c1 | |||
| 1059 | nmdc:mga08x19_38896_c1 | |||
| 1060 | Ga0500643_031044 | |||
| 1061 | Ga0500651_0000008 | |||
| 1062 | Ga0500595_000187 | |||
| 1063 | Ga0501084_0030844 | |||
| 1064 | 2884216953 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2rdm-assembly1.cif.gz_A | crystal structure of response regulator receiver protein from sinorhizobium medicae wsm419 | 0.8935 | 20 | 131 |
| 3q15-assembly2.cif.gz_D-3 | crystal structure of raph complexed with spo0f | 0.8836 | 23 | 131 |
| 3hv2-assembly1.cif.gz_B | crystal structure of signal receiver domain of hd domain-containing protein from pseudomonas fluorescens pf-5 | 0.881 | 20 | 137 |
| 2iyn-assembly3.cif.gz_C | the co-factor-induced pre-active conformation in phob | 0.8728 | 23 | 131 |
| 1mb0-assembly1.cif.gz_A | crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ | 0.868 | 22 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGM1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9194 | 20 | 100 | 3.40.50.2300 |
| af_P0AFJ5_1_84_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9149 | 21 | 100 | 3.40.50.2300 |
| af_P0A9Q1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9079 | 24 | 99 | 3.40.50.2300 |
| af_P76340_1_79_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9046 | 22 | 100 | 3.40.50.2300 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9023 | 22 | 100 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A4N723-F1-model_v4 | Response regulator | 0.9151 | 21 | 131 |
GO:0000160
|
| AF-F5LB24-F1-model_v4 | Response regulator receiver protein | 0.904 | 20 | 103 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A6I3KMD0-F1-model_v4 | Response regulator | 0.8904 | 14 | 131 |
GO:0000160
|
| AF-A0A7S7J1D8-F1-model_v4 | Stage 0 sporulation protein A homolog | 0.8888 | 18 | 103 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A350LT45-F1-model_v4 | DNA-binding response regulator | 0.8864 | 17 | 103 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |