F460306

General Info

Members Datasets Scaffolds Average Seq Length
532 241 1064 262

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0523429|Ga0451577_0523429_91_1011
Length 293
Sequence MKNQLAQLAQYLNLSSGMDEKKKSGGGPTLIDGGKPKTEKPVDRRRPIRVLLLDDREENLLLRSTILRQHGYDVVSSASIEEAQKHLENIDIAVLDYHLGAGKFGTEVAESLRGERPQVPIIILSATLERKFGGIADMHLLKGYSTMDDLLAALRNFEAKRRGKPVVVDARDFYYSRISMAMGDDVVLEILDRDGNWQYVNDYFAALFERKRPYFVGKNMFESFPELGEEWKEIVRTVADTRETYIDRSFRGLPNLPTKNPRWVWNVLAFPLKLHDDRNGVALSARVIEKKSF

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.32
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 5.83
Rhizosphere 90.79
Stem 0
Stem Tuber 0
Unclassified 21.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0523429 3300042876 Bacteria 1077
2 LJNas_1001321 3300000546 Bacteria 3628
3 rootH1_10332512 3300003323 Bacteria 1620
4 rootH1_10365739 3300003323 Bacteria 1605
5 Ga0058863_10011887 3300004799 Bacteria 2074
6 Ga0058861_10043048 3300004800 Bacteria 1676
7 Ga0058862_10220838 3300004803 Bacteria 2526
8 Ga0070658_10000004 3300005327 Bacteria 402230
9 Ga0070658_10009641 3300005327 Bacteria 7751
10 Ga0070658_10024444 3300005327 Bacteria 4846
11 Ga0070658_10027091 3300005327 Bacteria 4601
12 Ga0070658_10031393 3300005327 Bacteria 4266
13 Ga0070658_10182979 3300005327 Bacteria 1764
14 Ga0070658_10258483 3300005327 Bacteria 1478
15 Ga0070683_100026850 3300005329 Bacteria 5189
16 Ga0070683_100031861 3300005329 Bacteria 4797
17 Ga0070683_100109110 3300005329 Bacteria 2610
18 Ga0070666_10194344 3300005335 Bacteria 1426
19 Ga0070680_100031806 3300005336 Unclassified 4243
20 Ga0070680_100033409 3300005336 Bacteria 4146
21 Ga0070680_100069983 3300005336 Unclassified 2882
22 Ga0070682_100007377 3300005337 Bacteria 6205
23 Ga0068868_100019387 3300005338 Bacteria 5097
24 Ga0070660_100012775 3300005339 Bacteria 6003
25 Ga0070660_100014364 3300005339 Bacteria 5702
26 Ga0070660_100049021 3300005339 Bacteria 3245
27 Ga0070660_100123829 3300005339 Bacteria 2065
28 Ga0070660_100138221 3300005339 Bacteria 1953
29 Ga0070660_100299420 3300005339 Unclassified 1318
30 Ga0070691_10072105 3300005341 Bacteria 1677
31 Ga0070661_100042798 3300005344 Unclassified 3307
32 Ga0070661_100054268 3300005344 Unclassified 2935
33 Ga0070692_10086510 3300005345 Bacteria 1697
34 Ga0070692_10336904 3300005345 Bacteria 933
35 Ga0070671_100006455 3300005355 Bacteria 9374
36 Ga0070673_100291137 3300005364 Unclassified 1435
37 Ga0070659_100000601 3300005366 Bacteria 26412
38 Ga0070709_10019087 3300005434 Bacteria 3956
39 Ga0070714_100058263 3300005435 Bacteria 3309
40 Ga0070714_100065367 3300005435 Bacteria 3132
41 Ga0070714_100194322 3300005435 Bacteria 1853
42 Ga0070713_100010252 3300005436 Bacteria 6765
43 Ga0070713_100087268 3300005436 Unclassified 2676
44 Ga0070713_100205797 3300005436 Bacteria 1779
45 Ga0070713_100487848 3300005436 Bacteria 1161
46 Ga0070710_10425401 3300005437 Unclassified 895
47 Ga0070711_100026570 3300005439 Bacteria 3794
48 Ga0070711_100308081 3300005439 Bacteria 1261
49 Ga0070678_100260326 3300005456 Bacteria 1459
50 Ga0070681_10009446 3300005458 Bacteria 9598
51 Ga0070681_10040779 3300005458 Unclassified 4651
52 Ga0070681_10043372 3300005458 Bacteria 4507
53 Ga0070681_10073266 3300005458 Bacteria 3386
54 Ga0070681_10147684 3300005458 Bacteria 2279
55 Ga0070681_10158617 3300005458 Bacteria 2186
56 Ga0070681_10203179 3300005458 Bacteria 1899
57 Ga0070681_10379564 3300005458 Bacteria 1324
58 Ga0070681_10674690 3300005458 Bacteria 949
59 Ga0070679_100002283 3300005530 Bacteria 17337
60 Ga0070679_100037253 3300005530 Unclassified 4830
61 Ga0070679_100058910 3300005530 Unclassified 3827
62 Ga0070679_100103720 3300005530 Bacteria 2830
63 Ga0070679_100209546 3300005530 Bacteria 1913
64 Ga0070684_100014368 3300005535 Bacteria 6411
65 Ga0070684_100072207 3300005535 Unclassified 3038
66 Ga0070684_100160153 3300005535 Bacteria 2041
67 Ga0070697_100014663 3300005536 Bacteria 6153
68 Ga0070697_100114667 3300005536 Bacteria 2249
69 Ga0068853_100000100 3300005539 Bacteria 58118
70 Ga0068853_100030975 3300005539 Bacteria 4522
71 Ga0068853_100037552 3300005539 Bacteria 4121
72 Ga0068853_100048137 3300005539 Unclassified 3661
73 Ga0068853_100159694 3300005539 Unclassified 2033
74 Ga0068853_100262814 3300005539 Unclassified 1587
75 Ga0068853_100421609 3300005539 Unclassified 1251
76 Ga0070695_100018465 3300005545 Unclassified 4236
77 Ga0070696_100048934 3300005546 Unclassified 2935
78 Ga0070693_100006969 3300005547 Bacteria 5500
79 Ga0070665_100021347 3300005548 Bacteria 6513
80 Ga0070665_100033876 3300005548 Bacteria 5138
81 Ga0070665_100054614 3300005548 Bacteria 4006
82 Ga0068855_100007892 3300005563 Bacteria 12855
83 Ga0068855_100037522 3300005563 Bacteria 5761
84 Ga0068855_100047543 3300005563 Bacteria 5068
85 Ga0068855_100062699 3300005563 Bacteria 4339
86 Ga0068855_100079747 3300005563 Bacteria 3796
87 Ga0068855_100087189 3300005563 Bacteria 3608
88 Ga0068855_100090590 3300005563 Bacteria 3529
89 Ga0068855_100262295 3300005563 Bacteria 1924
90 Ga0068855_100310312 3300005563 Bacteria 1745
91 Ga0070664_100067129 3300005564 Unclassified 3065
92 Ga0070664_100087569 3300005564 Bacteria 2693
93 Ga0068857_100055905 3300005577 Bacteria 3502
94 Ga0068854_100000074 3300005578 Bacteria 72015
95 Ga0068854_100048369 3300005578 Unclassified 3034
96 Ga0068854_100106515 3300005578 Unclassified 2109
97 Ga0068854_100232696 3300005578 Bacteria 1463
98 Ga0068854_100287006 3300005578 Unclassified 1327
99 Ga0068856_100024943 3300005614 Bacteria 5827
100 Ga0068856_100035422 3300005614 Bacteria 4892
101 Ga0068856_100209104 3300005614 Unclassified 1966
102 Ga0068856_100608136 3300005614 Bacteria 1114
103 Ga0068852_100004648 3300005616 Bacteria 9731
104 Ga0068852_100013376 3300005616 Bacteria 6281
105 Ga0068852_100148906 3300005616 Unclassified 2174
106 Ga0068852_100560529 3300005616 Bacteria 1144
107 Ga0068864_100016174 3300005618 Bacteria 6209
108 Ga0068864_100240106 3300005618 Unclassified 1679
109 Ga0068851_10051566 3300005834 Unclassified 2091
110 Ga0068863_100015404 3300005841 Bacteria 7351
111 Ga0068858_100315072 3300005842 Bacteria 1494
112 Ga0081540_1006852 3300005983 Bacteria 8224
113 Ga0070717_10114921 3300006028 Bacteria 2300
114 Ga0070716_100059017 3300006173 Unclassified 2210
115 Ga0070716_100221623 3300006173 Bacteria 1271
116 Ga0070712_100431882 3300006175 Unclassified 1093
117 Ga0075434_100111154 3300006871 Unclassified 2751
118 Ga0075436_100006391 3300006914 Bacteria 8076
119 Ga0075436_100015574 3300006914 Bacteria 5205
120 Ga0075436_100043592 3300006914 Bacteria 3093
121 Ga0105240_10001235 3300009093 Bacteria 44371
122 Ga0105240_10003079 3300009093 Bacteria 26206
123 Ga0105240_10014142 3300009093 Bacteria 10903
124 Ga0105240_10131799 3300009093 Unclassified 2998
125 Ga0105240_10152462 3300009093 Unclassified 2751
126 Ga0105240_10240786 3300009093 Unclassified 2097
127 Ga0105240_10864438 3300009093 Bacteria 975
128 Ga0105245_10029968 3300009098 Bacteria 4811
129 Ga0105245_10181404 3300009098 Bacteria 2012
130 Ga0114129_10106555 3300009147 Unclassified 3872
131 Ga0105241_10261665 3300009174 Bacteria 1470
132 Ga0105241_10563643 3300009174 Bacteria 1024
133 Ga0105248_10014521 3300009177 Bacteria 8670
134 Ga0105248_10110100 3300009177 Bacteria 3105
135 Ga0105248_10627790 3300009177 Unclassified 1212
136 Ga0105248_10876540 3300009177 Unclassified 1013
137 Ga0105237_10012226 3300009545 Bacteria 9048
138 Ga0105237_10194413 3300009545 Unclassified 2028
139 Ga0105237_10273624 3300009545 Unclassified 1691
140 Ga0105237_10774566 3300009545 Bacteria 966
141 Ga0105238_10003571 3300009551 Bacteria 15505
142 Ga0105238_10008859 3300009551 Bacteria 10066
143 Ga0105238_10012260 3300009551 Bacteria 8645
144 Ga0105238_10024665 3300009551 Bacteria 6130
145 Ga0105238_10031252 3300009551 Bacteria 5420
146 Ga0105238_10134679 3300009551 Unclassified 2448
147 Ga0105238_10409069 3300009551 Bacteria 1350
148 Ga0105249_10027220 3300009553 Bacteria 5158
149 Ga0105239_10091987 3300010375 Unclassified 3347
150 Ga0105239_10377975 3300010375 Bacteria 1601
151 Ga0157373_10029579 3300013100 Bacteria 3945
152 Ga0157373_10142761 3300013100 Bacteria 1684
153 Ga0157373_10158566 3300013100 Bacteria 1592
154 Ga0157371_10142235 3300013102 Bacteria 1709
155 Ga0157370_10025296 3300013104 Bacteria 5876
156 Ga0157370_10040457 3300013104 Bacteria 4501
157 Ga0157370_10053172 3300013104 Bacteria 3863
158 Ga0157370_10072305 3300013104 Unclassified 3254
159 Ga0157370_10078802 3300013104 Unclassified 3102
160 Ga0157370_10112312 3300013104 Bacteria 2547
161 Ga0157370_10123159 3300013104 Bacteria 2421
162 Ga0157370_10192381 3300013104 Bacteria 1894
163 Ga0157370_10445656 3300013104 Bacteria 1190
164 Ga0157369_10000442 3300013105 Bacteria 55048
165 Ga0157369_10010057 3300013105 Bacteria 10801
166 Ga0157369_10037540 3300013105 Bacteria 5304
167 Ga0157369_10077474 3300013105 Unclassified 3563
168 Ga0157369_10185635 3300013105 Bacteria 2187
169 Ga0157369_10257396 3300013105 Unclassified 1821
170 Ga0157369_10347084 3300013105 Unclassified 1542
171 Ga0157374_10078895 3300013296 Bacteria 3119
172 Ga0157374_10105455 3300013296 Unclassified 2707
173 Ga0157374_10121862 3300013296 Bacteria 2517
174 Ga0157374_10148518 3300013296 Unclassified 2278
175 Ga0157374_10213067 3300013296 Unclassified 1894
176 Ga0163162_10195832 3300013306 Bacteria 2149
177 Ga0163162_10359752 3300013306 Bacteria 1588
178 Ga0157372_10011458 3300013307 Bacteria 9428
179 Ga0157372_10012096 3300013307 Bacteria 9192
180 Ga0157372_10027551 3300013307 Bacteria 6191
181 Ga0157372_10046707 3300013307 Bacteria 4807
182 Ga0157372_10066432 3300013307 Bacteria 4052
183 Ga0157372_10091926 3300013307 Unclassified 3451
184 Ga0163163_10014577 3300014325 Bacteria 7231
185 Ga0163163_10032768 3300014325 Bacteria 5021
186 Ga0163163_10111459 3300014325 Bacteria 2765
187 Ga0163163_10125578 3300014325 Bacteria 2603
188 Ga0163163_10130084 3300014325 Unclassified 2557
189 Ga0157376_10015169 3300014969 Bacteria 5812
190 Ga0157376_10019146 3300014969 Bacteria 5268
191 Ga0157376_10071351 3300014969 Bacteria 2951
192 Ga0157376_10107877 3300014969 Bacteria 2445
193 Ga0197907_10699666 3300020069 Bacteria 1737
194 Ga0206351_10543794 3300020077 Bacteria 1530
195 Ga0206350_10305681 3300020080 Bacteria 1529
196 Ga0213873_10026075 3300021358 Bacteria 1417
197 Ga0213872_10001885 3300021361 Bacteria 12929
198 Ga0213872_10036642 3300021361 Bacteria 2241
199 Ga0213874_10006679 3300021377 Bacteria 2738
200 Ga0224712_10038652 3300022467 Bacteria 1784
201 Ga0209233_1003364 3300025261 Bacteria 5652
202 Ga0207656_10035881 3300025321 Unclassified 2079
203 Ga0207692_10246187 3300025898 Unclassified 1069
204 Ga0207680_10125310 3300025903 Bacteria 1685
205 Ga0207647_10011377 3300025904 Bacteria 6241
206 Ga0207647_10024120 3300025904 Bacteria 4012
207 Ga0207699_10089170 3300025906 Unclassified 1932
208 Ga0207699_10448075 3300025906 Bacteria 925
209 Ga0207705_10000024 3300025909 Bacteria 259977
210 Ga0207705_10004909 3300025909 Bacteria 10037
211 Ga0207705_10008017 3300025909 Bacteria 7744
212 Ga0207705_10032417 3300025909 Bacteria 3734
213 Ga0207705_10091553 3300025909 Bacteria 2227
214 Ga0207705_10227930 3300025909 Bacteria 1416
215 Ga0207705_10321203 3300025909 Bacteria 1190
216 Ga0207705_10372386 3300025909 Bacteria 1102
217 Ga0207707_10001569 3300025912 Bacteria 21033
218 Ga0207707_10031219 3300025912 Bacteria 4661
219 Ga0207707_10037731 3300025912 Unclassified 4222
220 Ga0207707_10139693 3300025912 Bacteria 2118
221 Ga0207707_10145211 3300025912 Unclassified 2074
222 Ga0207707_10165395 3300025912 Bacteria 1933
223 Ga0207707_10196614 3300025912 Bacteria 1759
224 Ga0207707_10258594 3300025912 Bacteria 1511
225 Ga0207707_10391626 3300025912 Bacteria 1194
226 Ga0207707_10404718 3300025912 Bacteria 1171
227 Ga0207707_10504461 3300025912 Unclassified 1032
228 Ga0207695_10000804 3300025913 Bacteria 58597
229 Ga0207695_10025139 3300025913 Bacteria 6678
230 Ga0207695_10043943 3300025913 Bacteria 4757
231 Ga0207695_10169861 3300025913 Bacteria 2107
232 Ga0207695_10210599 3300025913 Bacteria 1854
233 Ga0207695_10281775 3300025913 Bacteria 1556
234 Ga0207671_10102488 3300025914 Unclassified 2169
235 Ga0207671_10151431 3300025914 Bacteria 1792
236 Ga0207693_10072137 3300025915 Unclassified 2704
237 Ga0207663_10035771 3300025916 Unclassified 2982
238 Ga0207663_10363003 3300025916 Bacteria 1099
239 Ga0207660_10019212 3300025917 Bacteria 4564
240 Ga0207660_10100334 3300025917 Bacteria 2161
241 Ga0207660_10121114 3300025917 Bacteria 1982
242 Ga0207657_10001844 3300025919 Bacteria 22887
243 Ga0207657_10014767 3300025919 Bacteria 7604
244 Ga0207657_10050629 3300025919 Bacteria 3615
245 Ga0207657_10119658 3300025919 Unclassified 2167
246 Ga0207649_10004392 3300025920 Bacteria 7655
247 Ga0207652_10007088 3300025921 Bacteria 9031
248 Ga0207652_10009357 3300025921 Bacteria 7879
249 Ga0207652_10022473 3300025921 Bacteria 5218
250 Ga0207652_10040614 3300025921 Unclassified 3951
251 Ga0207652_10080949 3300025921 Bacteria 2840
252 Ga0207652_10199627 3300025921 Bacteria 1800
253 Ga0207652_10301491 3300025921 Unclassified 1446
254 Ga0207652_10637729 3300025921 Unclassified 953
255 Ga0207694_10007068 3300025924 Bacteria 8523
256 Ga0207694_10011356 3300025924 Bacteria 6723
257 Ga0207694_10051295 3300025924 Unclassified 3198
258 Ga0207694_10237382 3300025924 Bacteria 1489
259 Ga0207650_10318291 3300025925 Unclassified 1274
260 Ga0207687_10147516 3300025927 Bacteria 1791
261 Ga0207687_10556714 3300025927 Bacteria 963
262 Ga0207700_10029536 3300025928 Bacteria 3870
263 Ga0207700_10081445 3300025928 Bacteria 2528
264 Ga0207700_10111035 3300025928 Bacteria 2206
265 Ga0207664_10017642 3300025929 Bacteria 5238
266 Ga0207664_10062609 3300025929 Bacteria 2971
267 Ga0207664_10194843 3300025929 Unclassified 1746
268 Ga0207664_10254327 3300025929 Bacteria 1534
269 Ga0207644_10036539 3300025931 Bacteria 3449
270 Ga0207690_10000389 3300025932 Bacteria 29022
271 Ga0207690_10132768 3300025932 Unclassified 1824
272 Ga0207690_10165343 3300025932 Bacteria 1653
273 Ga0207665_10028881 3300025939 Bacteria 3667
274 Ga0207665_10178333 3300025939 Unclassified 1538
275 Ga0207665_10250815 3300025939 Bacteria 1308
276 Ga0207711_10122225 3300025941 Bacteria 2326
277 Ga0207711_10318901 3300025941 Bacteria 1436
278 Ga0207661_10010698 3300025944 Bacteria 6612
279 Ga0207661_10012161 3300025944 Bacteria 6249
280 Ga0207679_10074055 3300025945 Bacteria 2579
281 Ga0207679_10114327 3300025945 Bacteria 2137
282 Ga0207679_10246486 3300025945 Bacteria 1516
283 Ga0207667_10000538 3300025949 Bacteria 50064
284 Ga0207667_10001884 3300025949 Bacteria 26389
285 Ga0207667_10025095 3300025949 Bacteria 6534
286 Ga0207667_10044675 3300025949 Bacteria 4694
287 Ga0207667_10046020 3300025949 Unclassified 4620
288 Ga0207667_10111220 3300025949 Bacteria 2825
289 Ga0207667_10262409 3300025949 Bacteria 1766
290 Ga0207651_10440503 3300025960 Unclassified 1116
291 Ga0207712_10060293 3300025961 Bacteria 2689
292 Ga0207668_10033030 3300025972 Bacteria 3426
293 Ga0207640_10000010 3300025981 Bacteria 275745
294 Ga0207640_10043549 3300025981 Unclassified 2870
295 Ga0207640_10356682 3300025981 Bacteria 1177
296 Ga0207658_10574196 3300025986 Bacteria 1011
297 Ga0207677_10064948 3300026023 Unclassified 2544
298 Ga0207703_10206680 3300026035 Bacteria 1748
299 Ga0207639_10000023 3300026041 Bacteria 215340
300 Ga0207639_10007682 3300026041 Bacteria 7361
301 Ga0207639_10016113 3300026041 Bacteria 5281
302 Ga0207639_10021322 3300026041 Unclassified 4652
303 Ga0207639_10065535 3300026041 Unclassified 2820
304 Ga0207639_10231889 3300026041 Unclassified 1600
305 Ga0207678_10002077 3300026067 Bacteria 18170
306 Ga0207678_10003233 3300026067 Bacteria 14718
307 Ga0207678_10008839 3300026067 Bacteria 8868
308 Ga0207678_10122710 3300026067 Bacteria 2217
309 Ga0207641_10094207 3300026088 Bacteria 2626
310 Ga0207676_10066636 3300026095 Bacteria 2873
311 Ga0207674_10001311 3300026116 Bacteria 32478
312 Ga0207674_10070239 3300026116 Bacteria 3521
313 Ga0207674_10137252 3300026116 Unclassified 2406
314 Ga0207698_10008297 3300026142 Bacteria 6560
315 Ga0207698_10011913 3300026142 Bacteria 5663
316 Ga0207698_10126760 3300026142 Bacteria 2173
317 Ga0207698_10508631 3300026142 Unclassified 1173
318 Ga0207698_10788343 3300026142 Unclassified 952
319 Ga0268266_10001615 3300028379 Bacteria 26291
320 Ga0268266_10001974 3300028379 Bacteria 22989
321 Ga0268266_10063331 3300028379 Bacteria 3192
322 Ga0268266_10167249 3300028379 Bacteria 1993
323 Ga0265338_10038803 3300028800 Bacteria 4505
324 Ga0265332_10018877 3300031238 Bacteria 3045
325 Ga0265328_10056903 3300031239 Unclassified 1435
326 Ga0265325_10001599 3300031241 Bacteria 15804
327 Ga0265325_10057004 3300031241 Bacteria 1993
328 Ga0265340_10000590 3300031247 Bacteria 20174
329 Ga0265340_10015596 3300031247 Bacteria 3946
330 Ga0265331_10020545 3300031250 Bacteria 3388
331 Ga0265331_10080910 3300031250 Bacteria 1509
332 Ga0265327_10048045 3300031251 Bacteria 2247
333 Ga0265316_10008885 3300031344 Bacteria 9277
334 Ga0265316_10062596 3300031344 Unclassified 2887
335 Ga0307408_100020476 3300031548 Bacteria 4467
336 Ga0307413_10066196 3300031824 Bacteria 2254
337 Ga0307406_10279894 3300031901 Unclassified 1272
338 Ga0307407_10052077 3300031903 Bacteria 2349
339 Ga0307409_100006808 3300031995 Bacteria 6762
340 Ga0307416_100149218 3300032002 Unclassified 2141
341 Ga0307415_100084395 3300032126 Bacteria 2279
342 Ga0307510_10057512 3300033180 Bacteria 4035
343 Ga0307510_10113543 3300033180 Bacteria 2442
344 Ga0373926_0012764 3300035083 Unclassified 2843
345 Ga0373944_0034888 3300035089 Bacteria 1531
346 Ga0373936_0004381 3300035113 Bacteria 5338
347 Ga0373945_0001513 3300035116 Bacteria 7100
348 Ga0373943_0013220 3300035170 Unclassified 3725
349 Ga0373924_0000059 3300035410 Bacteria 28501
350 Ga0373935_0003805 3300035692 Bacteria 8813
351 Ga0373935_0026176 3300035692 Unclassified 3598
352 Ga0373935_0077297 3300035692 Bacteria 2157
353 Ga0373927_0006966 3300035695 Bacteria 7673
354 Ga0373927_0029166 3300035695 Bacteria 3596
355 Ga0373933_0156249 3300035724 Unclassified 1447
356 Ga0373947_0008862 3300035725 Bacteria 5788
357 Ga0373947_0011661 3300035725 Bacteria 5042
358 Ga0373937_0000408 3300036401 Bacteria 40094
359 Ga0373937_0222236 3300036401 Bacteria 1778
360 Ga0373925_0018521 3300037068 Bacteria 5061
361 Ga0373925_0020358 3300037068 Bacteria 4829
362 Ga0395900_0251721 3300037418 Unclassified 1768
363 Ga0395900_0801027 3300037418 Bacteria 870
364 Ga0395898_0117243 3300037466 Bacteria 2551
365 Ga0395898_0199032 3300037466 Bacteria 1913
366 Ga0395898_0263398 3300037466 Bacteria 1644
367 Ga0395905_0018442 3300037471 Bacteria 6624
368 Ga0395905_0032992 3300037471 Unclassified 4868
369 Ga0395905_0035263 3300037471 Bacteria 4698
370 Ga0395905_0101529 3300037471 Bacteria 2700
371 Ga0395901_0298047 3300038443 Bacteria 1672
372 Ga0436360_0105677 3300039438 Unclassified 1243
373 Ga0436360_0366267 3300039438 Unclassified 2743
374 Ga0436360_0505146 3300039438 Bacteria 2277
375 Ga0436361_0330933 3300039447 Bacteria 3726
376 Ga0436361_0861091 3300039447 Bacteria 5968
377 Ga0436361_0889427 3300039447 Unclassified 2710
378 Ga0436363_0707383 3300039450 Bacteria 7601
379 Ga0436363_1127254 3300039450 Bacteria 1292
380 Ga0436363_1443836 3300039450 Bacteria 8455
381 Ga0436362_0930676 3300039453 Bacteria 2512
382 Ga0466963_0044187 3300044694 Unclassified 2932
383 Ga0466957_0000260 3300044842 Bacteria 25409
384 Ga0466959_0014979 3300045049 Bacteria 5651
385 Ga0466958_0052042 3300045836 Bacteria 2481
386 Ga0466958_0157813 3300045836 Unclassified 1432
387 Ga0466967_0223123 3300045976 Bacteria 1792
388 Ga0466967_0365171 3300045976 Bacteria 1399
389 Ga0466967_0609316 3300045976 Bacteria 1078
390 Ga0466967_0677640 3300045976 Unclassified 1020
391 Ga0466967_0695544 3300045976 Bacteria 1007
392 Ga0466967_0881872 3300045976 Bacteria 889
393 Ga0495629_0180025 3300046459 Bacteria 1465
394 Ga0495638_0147454 3300046460 Bacteria 1367
395 Ga0495651_0009116 3300046462 Bacteria 7617
396 Ga0495651_0049678 3300046462 Bacteria 3238
397 Ga0495651_0196009 3300046462 Bacteria 1417
398 Ga0495651_0275500 3300046462 Bacteria 1139
399 Ga0495653_0024553 3300046463 Bacteria 4856
400 Ga0495650_0000029 3300046471 Bacteria 453466
401 Ga0495650_0008610 3300046471 Bacteria 5921
402 Ga0495650_0102368 3300046471 Unclassified 1074
403 Ga0495580_0031276 3300046472 Unclassified 3847
404 Ga0495580_0044017 3300046472 Bacteria 3176
405 Ga0495580_0115857 3300046472 Unclassified 1861
406 Ga0495580_0327922 3300046472 Unclassified 1040
407 Ga0495582_0076700 3300046473 Bacteria 1853
408 Ga0495582_0347273 3300046473 Bacteria 854
409 Ga0495639_0016207 3300046475 Bacteria 3234
410 Ga0495662_0002704 3300046476 Bacteria 8963
411 Ga0495664_0020741 3300046477 Bacteria 3793
412 Ga0495585_0043436 3300046492 Bacteria 2514
413 Ga0495594_0002013 3300046499 Bacteria 10582
414 Ga0495594_0035442 3300046499 Bacteria 2718
415 Ga0495594_0091363 3300046499 Unclassified 1706
416 Ga0495583_0067044 3300046506 Bacteria 1586
417 Ga0495628_0064660 3300046516 Bacteria 2863
418 Ga0495644_0000316 3300046523 Bacteria 22262
419 Ga0495648_0175588 3300046524 Bacteria 1094
420 Ga0495652_0049688 3300046529 Bacteria 3589
421 Ga0495665_0019314 3300046531 Bacteria 3664
422 Ga0495586_0222484 3300046535 Unclassified 1073
423 Ga0495587_0041236 3300046536 Bacteria 2755
424 Ga0495609_0161679 3300046538 Bacteria 949
425 Ga0495645_0084570 3300046543 Bacteria 2272
426 Ga0495622_0032861 3300046557 Bacteria 2422
427 Ga0495633_0039548 3300046558 Bacteria 2251
428 Ga0495667_0093843 3300046559 Bacteria 1943
429 Ga0495667_0195659 3300046559 Bacteria 1295
430 Ga0495634_0008386 3300046642 Bacteria 7700
431 Ga0495611_0096048 3300046648 Bacteria 1372
432 Ga0495625_0001024 3300046660 Bacteria 36797
433 Ga0495625_0081381 3300046660 Bacteria 2254
434 Ga0495625_0081636 3300046660 Bacteria 2250
435 Ga0495635_0214844 3300046663 Bacteria 1302
436 Ga0495659_0029110 3300046664 Bacteria 1916
437 Ga0495661_0049964 3300046665 Bacteria 2534
438 Ga0495599_0066149 3300046678 Bacteria 2258
439 Ga0495623_0224509 3300046679 Bacteria 1068
440 Ga0495646_0048054 3300046680 Bacteria 2595
441 Ga0495669_0005797 3300046684 Bacteria 5151
442 Ga0495669_0008085 3300046684 Bacteria 4415
443 Ga0495669_0018724 3300046684 Bacteria 2980
444 Ga0495669_0029510 3300046684 Bacteria 2405
445 Ga0495669_0130409 3300046684 Bacteria 1183
446 Ga0495613_0058072 3300046689 Bacteria 2840
447 Ga0495624_0106983 3300046690 Bacteria 1721
448 Ga0495600_0001535 3300046809 Bacteria 12828
449 Ga0495600_0319121 3300046809 Bacteria 977
450 Ga0495581_0003151 3300047315 Bacteria 9438
451 Ga0495581_0081019 3300047315 Unclassified 1879
452 Ga0495604_0035821 3300047317 Bacteria 3917
453 Ga0495604_0044413 3300047317 Bacteria 3472
454 Ga0495604_0181146 3300047317 Unclassified 1474
455 Ga0495674_0233755 3300047319 Bacteria 1516
456 Ga0495672_0009742 3300047320 Bacteria 6925
457 Ga0495680_0044789 3300047322 Bacteria 3497
458 Ga0495675_0011199 3300047444 Bacteria 5625
459 Ga0495675_0082427 3300047444 Bacteria 2025
460 Ga0495675_0296196 3300047444 Bacteria 962
461 Ga0495684_0055408 3300047471 Bacteria 3024
462 Ga0495684_0087056 3300047471 Bacteria 2368
463 Ga0495686_0004468 3300047472 Bacteria 11510
464 Ga0495686_0024612 3300047472 Bacteria 3953
465 Ga0495593_0036788 3300047673 Bacteria 2653
466 Ga0496100_0054934 3300048903 Unclassified 2600
467 Ga0496102_0061394 3300048905 Unclassified 3440
468 Ga0496102_0266559 3300048905 Bacteria 1615
469 Ga0496102_0512211 3300048905 Bacteria 1122
470 Ga0496103_0010051 3300048906 Bacteria 5595
471 Ga0496104_0000648 3300048907 Bacteria 29835
472 Ga0496104_0020982 3300048907 Bacteria 5994
473 Ga0496104_0190632 3300048907 Unclassified 1961
474 Ga0496104_0206936 3300048907 Bacteria 1874
475 Ga0496104_0785562 3300048907 Bacteria 858
476 Ga0496105_0000590 3300048908 Bacteria 24188
477 Ga0496105_0077621 3300048908 Bacteria 2743
478 Ga0496105_0227609 3300048908 Bacteria 1516
479 Ga0496107_0595721 3300048910 Unclassified 817
480 Ga0496108_0026130 3300048911 Bacteria 4816
481 Ga0496109_0094912 3300048912 Unclassified 2761
482 Ga0496109_0166095 3300048912 Bacteria 2069
483 Ga0496110_0026711 3300048913 Unclassified 4944
484 Ga0496110_0096398 3300048913 Unclassified 2651
485 Ga0496111_0000490 3300048914 Bacteria 20373
486 Ga0496111_0266855 3300048914 Bacteria 1270
487 Ga0496111_0503889 3300048914 Unclassified 891
488 Ga0496112_0023092 3300048915 Bacteria 5937
489 Ga0496112_0088443 3300048915 Bacteria 3065
490 Ga0496112_0091943 3300048915 Bacteria 3003
491 Ga0496112_0189446 3300048915 Bacteria 2019
492 Ga0496112_0306756 3300048915 Bacteria 1532
493 Ga0496113_0004714 3300048916 Bacteria 8417
494 Ga0496113_0115375 3300048916 Bacteria 2095
495 Ga0496113_0144427 3300048916 Unclassified 1873
496 Ga0496115_0166808 3300048918 Bacteria 1821
497 Ga0496126_0000093 3300048929 Bacteria 208741
498 Ga0496126_0000191 3300048929 Bacteria 137108
499 Ga0496126_0001093 3300048929 Bacteria 45526
500 Ga0496126_0002173 3300048929 Bacteria 27234
501 Ga0496126_0003783 3300048929 Bacteria 18780
502 Ga0496126_0640760 3300048929 Unclassified 833
503 Ga0495682_0020941 3300049460 Bacteria 2452
504 Ga0501031_0026645 3300049568 Bacteria 3768
505 Ga0501032_0002834 3300049569 Bacteria 13488
506 Ga0501032_0262515 3300049569 Bacteria 1120
507 Ga0501034_0004264 3300049571 Bacteria 15952
508 Ga0501037_0001771 3300049573 Bacteria 15679
509 Ga0501037_0266183 3300049573 Bacteria 1197
510 Ga0501038_0000845 3300049574 Bacteria 27143
511 Ga0501038_0245752 3300049574 Bacteria 1419
512 Ga0501039_0267728 3300049575 Bacteria 1343
513 Ga0501043_0002287 3300049579 Bacteria 16248
514 Ga0501046_0004323 3300049580 Bacteria 12931
515 Ga0501047_0001407 3300049581 Bacteria 23589
516 Ga0501047_0208206 3300049581 Bacteria 1815
517 Ga0501073_0009655 3300049589 Bacteria 7115
518 Ga0501073_0035998 3300049589 Bacteria 3518
519 Ga0501080_0009311 3300049742 Bacteria 8955
520 Ga0501035_0005515 3300049822 Bacteria 11956
521 Ga0501035_0182020 3300049822 Bacteria 1810
522 Ga0501044_0002709 3300049823 Bacteria 20135
523 nmdc:mga05p37_201588_c1 3300050507 Bacteria 2409
524 nmdc:mga0n895_111564_c1 3300050512 Unclassified 2751
525 nmdc:mga08x19_14605_c1 3300050514 Bacteria 4765
526 nmdc:mga08x19_374380_c1 3300050514 Bacteria 997
527 nmdc:mga08x19_38896_c1 3300050514 Bacteria 3022
528 Ga0500643_031044 3300053087 Bacteria 1632
529 Ga0500651_0000008 3300053093 Bacteria 287738
530 Ga0500595_000187 3300053119 Bacteria 42083
531 Ga0501084_0030844 3300054114 Bacteria 4482
532 2884216953 2884215851 Bacteria 4554841
533 Ga0451577_0523429
534 LJNas_1001321
535 rootH1_10332512
536 rootH1_10365739
537 Ga0058863_10011887
538 Ga0058861_10043048
539 Ga0058862_10220838
540 Ga0070658_10000004
541 Ga0070658_10009641
542 Ga0070658_10024444
543 Ga0070658_10027091
544 Ga0070658_10031393
545 Ga0070658_10182979
546 Ga0070658_10258483
547 Ga0070683_100026850
548 Ga0070683_100031861
549 Ga0070683_100109110
550 Ga0070666_10194344
551 Ga0070680_100031806
552 Ga0070680_100033409
553 Ga0070680_100069983
554 Ga0070682_100007377
555 Ga0068868_100019387
556 Ga0070660_100012775
557 Ga0070660_100014364
558 Ga0070660_100049021
559 Ga0070660_100123829
560 Ga0070660_100138221
561 Ga0070660_100299420
562 Ga0070691_10072105
563 Ga0070661_100042798
564 Ga0070661_100054268
565 Ga0070692_10086510
566 Ga0070692_10336904
567 Ga0070671_100006455
568 Ga0070673_100291137
569 Ga0070659_100000601
570 Ga0070709_10019087
571 Ga0070714_100058263
572 Ga0070714_100065367
573 Ga0070714_100194322
574 Ga0070713_100010252
575 Ga0070713_100087268
576 Ga0070713_100205797
577 Ga0070713_100487848
578 Ga0070710_10425401
579 Ga0070711_100026570
580 Ga0070711_100308081
581 Ga0070678_100260326
582 Ga0070681_10009446
583 Ga0070681_10040779
584 Ga0070681_10043372
585 Ga0070681_10073266
586 Ga0070681_10147684
587 Ga0070681_10158617
588 Ga0070681_10203179
589 Ga0070681_10379564
590 Ga0070681_10674690
591 Ga0070679_100002283
592 Ga0070679_100037253
593 Ga0070679_100058910
594 Ga0070679_100103720
595 Ga0070679_100209546
596 Ga0070684_100014368
597 Ga0070684_100072207
598 Ga0070684_100160153
599 Ga0070697_100014663
600 Ga0070697_100114667
601 Ga0068853_100000100
602 Ga0068853_100030975
603 Ga0068853_100037552
604 Ga0068853_100048137
605 Ga0068853_100159694
606 Ga0068853_100262814
607 Ga0068853_100421609
608 Ga0070695_100018465
609 Ga0070696_100048934
610 Ga0070693_100006969
611 Ga0070665_100021347
612 Ga0070665_100033876
613 Ga0070665_100054614
614 Ga0068855_100007892
615 Ga0068855_100037522
616 Ga0068855_100047543
617 Ga0068855_100062699
618 Ga0068855_100079747
619 Ga0068855_100087189
620 Ga0068855_100090590
621 Ga0068855_100262295
622 Ga0068855_100310312
623 Ga0070664_100067129
624 Ga0070664_100087569
625 Ga0068857_100055905
626 Ga0068854_100000074
627 Ga0068854_100048369
628 Ga0068854_100106515
629 Ga0068854_100232696
630 Ga0068854_100287006
631 Ga0068856_100024943
632 Ga0068856_100035422
633 Ga0068856_100209104
634 Ga0068856_100608136
635 Ga0068852_100004648
636 Ga0068852_100013376
637 Ga0068852_100148906
638 Ga0068852_100560529
639 Ga0068864_100016174
640 Ga0068864_100240106
641 Ga0068851_10051566
642 Ga0068863_100015404
643 Ga0068858_100315072
644 Ga0081540_1006852
645 Ga0070717_10114921
646 Ga0070716_100059017
647 Ga0070716_100221623
648 Ga0070712_100431882
649 Ga0075434_100111154
650 Ga0075436_100006391
651 Ga0075436_100015574
652 Ga0075436_100043592
653 Ga0105240_10001235
654 Ga0105240_10003079
655 Ga0105240_10014142
656 Ga0105240_10131799
657 Ga0105240_10152462
658 Ga0105240_10240786
659 Ga0105240_10864438
660 Ga0105245_10029968
661 Ga0105245_10181404
662 Ga0114129_10106555
663 Ga0105241_10261665
664 Ga0105241_10563643
665 Ga0105248_10014521
666 Ga0105248_10110100
667 Ga0105248_10627790
668 Ga0105248_10876540
669 Ga0105237_10012226
670 Ga0105237_10194413
671 Ga0105237_10273624
672 Ga0105237_10774566
673 Ga0105238_10003571
674 Ga0105238_10008859
675 Ga0105238_10012260
676 Ga0105238_10024665
677 Ga0105238_10031252
678 Ga0105238_10134679
679 Ga0105238_10409069
680 Ga0105249_10027220
681 Ga0105239_10091987
682 Ga0105239_10377975
683 Ga0157373_10029579
684 Ga0157373_10142761
685 Ga0157373_10158566
686 Ga0157371_10142235
687 Ga0157370_10025296
688 Ga0157370_10040457
689 Ga0157370_10053172
690 Ga0157370_10072305
691 Ga0157370_10078802
692 Ga0157370_10112312
693 Ga0157370_10123159
694 Ga0157370_10192381
695 Ga0157370_10445656
696 Ga0157369_10000442
697 Ga0157369_10010057
698 Ga0157369_10037540
699 Ga0157369_10077474
700 Ga0157369_10185635
701 Ga0157369_10257396
702 Ga0157369_10347084
703 Ga0157374_10078895
704 Ga0157374_10105455
705 Ga0157374_10121862
706 Ga0157374_10148518
707 Ga0157374_10213067
708 Ga0163162_10195832
709 Ga0163162_10359752
710 Ga0157372_10011458
711 Ga0157372_10012096
712 Ga0157372_10027551
713 Ga0157372_10046707
714 Ga0157372_10066432
715 Ga0157372_10091926
716 Ga0163163_10014577
717 Ga0163163_10032768
718 Ga0163163_10111459
719 Ga0163163_10125578
720 Ga0163163_10130084
721 Ga0157376_10015169
722 Ga0157376_10019146
723 Ga0157376_10071351
724 Ga0157376_10107877
725 Ga0197907_10699666
726 Ga0206351_10543794
727 Ga0206350_10305681
728 Ga0213873_10026075
729 Ga0213872_10001885
730 Ga0213872_10036642
731 Ga0213874_10006679
732 Ga0224712_10038652
733 Ga0209233_1003364
734 Ga0207656_10035881
735 Ga0207692_10246187
736 Ga0207680_10125310
737 Ga0207647_10011377
738 Ga0207647_10024120
739 Ga0207699_10089170
740 Ga0207699_10448075
741 Ga0207705_10000024
742 Ga0207705_10004909
743 Ga0207705_10008017
744 Ga0207705_10032417
745 Ga0207705_10091553
746 Ga0207705_10227930
747 Ga0207705_10321203
748 Ga0207705_10372386
749 Ga0207707_10001569
750 Ga0207707_10031219
751 Ga0207707_10037731
752 Ga0207707_10139693
753 Ga0207707_10145211
754 Ga0207707_10165395
755 Ga0207707_10196614
756 Ga0207707_10258594
757 Ga0207707_10391626
758 Ga0207707_10404718
759 Ga0207707_10504461
760 Ga0207695_10000804
761 Ga0207695_10025139
762 Ga0207695_10043943
763 Ga0207695_10169861
764 Ga0207695_10210599
765 Ga0207695_10281775
766 Ga0207671_10102488
767 Ga0207671_10151431
768 Ga0207693_10072137
769 Ga0207663_10035771
770 Ga0207663_10363003
771 Ga0207660_10019212
772 Ga0207660_10100334
773 Ga0207660_10121114
774 Ga0207657_10001844
775 Ga0207657_10014767
776 Ga0207657_10050629
777 Ga0207657_10119658
778 Ga0207649_10004392
779 Ga0207652_10007088
780 Ga0207652_10009357
781 Ga0207652_10022473
782 Ga0207652_10040614
783 Ga0207652_10080949
784 Ga0207652_10199627
785 Ga0207652_10301491
786 Ga0207652_10637729
787 Ga0207694_10007068
788 Ga0207694_10011356
789 Ga0207694_10051295
790 Ga0207694_10237382
791 Ga0207650_10318291
792 Ga0207687_10147516
793 Ga0207687_10556714
794 Ga0207700_10029536
795 Ga0207700_10081445
796 Ga0207700_10111035
797 Ga0207664_10017642
798 Ga0207664_10062609
799 Ga0207664_10194843
800 Ga0207664_10254327
801 Ga0207644_10036539
802 Ga0207690_10000389
803 Ga0207690_10132768
804 Ga0207690_10165343
805 Ga0207665_10028881
806 Ga0207665_10178333
807 Ga0207665_10250815
808 Ga0207711_10122225
809 Ga0207711_10318901
810 Ga0207661_10010698
811 Ga0207661_10012161
812 Ga0207679_10074055
813 Ga0207679_10114327
814 Ga0207679_10246486
815 Ga0207667_10000538
816 Ga0207667_10001884
817 Ga0207667_10025095
818 Ga0207667_10044675
819 Ga0207667_10046020
820 Ga0207667_10111220
821 Ga0207667_10262409
822 Ga0207651_10440503
823 Ga0207712_10060293
824 Ga0207668_10033030
825 Ga0207640_10000010
826 Ga0207640_10043549
827 Ga0207640_10356682
828 Ga0207658_10574196
829 Ga0207677_10064948
830 Ga0207703_10206680
831 Ga0207639_10000023
832 Ga0207639_10007682
833 Ga0207639_10016113
834 Ga0207639_10021322
835 Ga0207639_10065535
836 Ga0207639_10231889
837 Ga0207678_10002077
838 Ga0207678_10003233
839 Ga0207678_10008839
840 Ga0207678_10122710
841 Ga0207641_10094207
842 Ga0207676_10066636
843 Ga0207674_10001311
844 Ga0207674_10070239
845 Ga0207674_10137252
846 Ga0207698_10008297
847 Ga0207698_10011913
848 Ga0207698_10126760
849 Ga0207698_10508631
850 Ga0207698_10788343
851 Ga0268266_10001615
852 Ga0268266_10001974
853 Ga0268266_10063331
854 Ga0268266_10167249
855 Ga0265338_10038803
856 Ga0265332_10018877
857 Ga0265328_10056903
858 Ga0265325_10001599
859 Ga0265325_10057004
860 Ga0265340_10000590
861 Ga0265340_10015596
862 Ga0265331_10020545
863 Ga0265331_10080910
864 Ga0265327_10048045
865 Ga0265316_10008885
866 Ga0265316_10062596
867 Ga0307408_100020476
868 Ga0307413_10066196
869 Ga0307406_10279894
870 Ga0307407_10052077
871 Ga0307409_100006808
872 Ga0307416_100149218
873 Ga0307415_100084395
874 Ga0307510_10057512
875 Ga0307510_10113543
876 Ga0373926_0012764
877 Ga0373944_0034888
878 Ga0373936_0004381
879 Ga0373945_0001513
880 Ga0373943_0013220
881 Ga0373924_0000059
882 Ga0373935_0003805
883 Ga0373935_0026176
884 Ga0373935_0077297
885 Ga0373927_0006966
886 Ga0373927_0029166
887 Ga0373933_0156249
888 Ga0373947_0008862
889 Ga0373947_0011661
890 Ga0373937_0000408
891 Ga0373937_0222236
892 Ga0373925_0018521
893 Ga0373925_0020358
894 Ga0395900_0251721
895 Ga0395900_0801027
896 Ga0395898_0117243
897 Ga0395898_0199032
898 Ga0395898_0263398
899 Ga0395905_0018442
900 Ga0395905_0032992
901 Ga0395905_0035263
902 Ga0395905_0101529
903 Ga0395901_0298047
904 Ga0436360_0105677
905 Ga0436360_0366267
906 Ga0436360_0505146
907 Ga0436361_0330933
908 Ga0436361_0861091
909 Ga0436361_0889427
910 Ga0436363_0707383
911 Ga0436363_1127254
912 Ga0436363_1443836
913 Ga0436362_0930676
914 Ga0466963_0044187
915 Ga0466957_0000260
916 Ga0466959_0014979
917 Ga0466958_0052042
918 Ga0466958_0157813
919 Ga0466967_0223123
920 Ga0466967_0365171
921 Ga0466967_0609316
922 Ga0466967_0677640
923 Ga0466967_0695544
924 Ga0466967_0881872
925 Ga0495629_0180025
926 Ga0495638_0147454
927 Ga0495651_0009116
928 Ga0495651_0049678
929 Ga0495651_0196009
930 Ga0495651_0275500
931 Ga0495653_0024553
932 Ga0495650_0000029
933 Ga0495650_0008610
934 Ga0495650_0102368
935 Ga0495580_0031276
936 Ga0495580_0044017
937 Ga0495580_0115857
938 Ga0495580_0327922
939 Ga0495582_0076700
940 Ga0495582_0347273
941 Ga0495639_0016207
942 Ga0495662_0002704
943 Ga0495664_0020741
944 Ga0495585_0043436
945 Ga0495594_0002013
946 Ga0495594_0035442
947 Ga0495594_0091363
948 Ga0495583_0067044
949 Ga0495628_0064660
950 Ga0495644_0000316
951 Ga0495648_0175588
952 Ga0495652_0049688
953 Ga0495665_0019314
954 Ga0495586_0222484
955 Ga0495587_0041236
956 Ga0495609_0161679
957 Ga0495645_0084570
958 Ga0495622_0032861
959 Ga0495633_0039548
960 Ga0495667_0093843
961 Ga0495667_0195659
962 Ga0495634_0008386
963 Ga0495611_0096048
964 Ga0495625_0001024
965 Ga0495625_0081381
966 Ga0495625_0081636
967 Ga0495635_0214844
968 Ga0495659_0029110
969 Ga0495661_0049964
970 Ga0495599_0066149
971 Ga0495623_0224509
972 Ga0495646_0048054
973 Ga0495669_0005797
974 Ga0495669_0008085
975 Ga0495669_0018724
976 Ga0495669_0029510
977 Ga0495669_0130409
978 Ga0495613_0058072
979 Ga0495624_0106983
980 Ga0495600_0001535
981 Ga0495600_0319121
982 Ga0495581_0003151
983 Ga0495581_0081019
984 Ga0495604_0035821
985 Ga0495604_0044413
986 Ga0495604_0181146
987 Ga0495674_0233755
988 Ga0495672_0009742
989 Ga0495680_0044789
990 Ga0495675_0011199
991 Ga0495675_0082427
992 Ga0495675_0296196
993 Ga0495684_0055408
994 Ga0495684_0087056
995 Ga0495686_0004468
996 Ga0495686_0024612
997 Ga0495593_0036788
998 Ga0496100_0054934
999 Ga0496102_0061394
1000 Ga0496102_0266559
1001 Ga0496102_0512211
1002 Ga0496103_0010051
1003 Ga0496104_0000648
1004 Ga0496104_0020982
1005 Ga0496104_0190632
1006 Ga0496104_0206936
1007 Ga0496104_0785562
1008 Ga0496105_0000590
1009 Ga0496105_0077621
1010 Ga0496105_0227609
1011 Ga0496107_0595721
1012 Ga0496108_0026130
1013 Ga0496109_0094912
1014 Ga0496109_0166095
1015 Ga0496110_0026711
1016 Ga0496110_0096398
1017 Ga0496111_0000490
1018 Ga0496111_0266855
1019 Ga0496111_0503889
1020 Ga0496112_0023092
1021 Ga0496112_0088443
1022 Ga0496112_0091943
1023 Ga0496112_0189446
1024 Ga0496112_0306756
1025 Ga0496113_0004714
1026 Ga0496113_0115375
1027 Ga0496113_0144427
1028 Ga0496115_0166808
1029 Ga0496126_0000093
1030 Ga0496126_0000191
1031 Ga0496126_0001093
1032 Ga0496126_0002173
1033 Ga0496126_0003783
1034 Ga0496126_0640760
1035 Ga0495682_0020941
1036 Ga0501031_0026645
1037 Ga0501032_0002834
1038 Ga0501032_0262515
1039 Ga0501034_0004264
1040 Ga0501037_0001771
1041 Ga0501037_0266183
1042 Ga0501038_0000845
1043 Ga0501038_0245752
1044 Ga0501039_0267728
1045 Ga0501043_0002287
1046 Ga0501046_0004323
1047 Ga0501047_0001407
1048 Ga0501047_0208206
1049 Ga0501073_0009655
1050 Ga0501073_0035998
1051 Ga0501080_0009311
1052 Ga0501035_0005515
1053 Ga0501035_0182020
1054 Ga0501044_0002709
1055 nmdc:mga05p37_201588_c1
1056 nmdc:mga0n895_111564_c1
1057 nmdc:mga08x19_14605_c1
1058 nmdc:mga08x19_374380_c1
1059 nmdc:mga08x19_38896_c1
1060 Ga0500643_031044
1061 Ga0500651_0000008
1062 Ga0500595_000187
1063 Ga0501084_0030844
1064 2884216953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

50

155

0.92

PF08448

PAS_4

PAS fold

184

291

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rdm-assembly1.cif.gz_A crystal structure of response regulator receiver protein from sinorhizobium medicae wsm419 0.8935 20 131
3q15-assembly2.cif.gz_D-3 crystal structure of raph complexed with spo0f 0.8836 23 131
3hv2-assembly1.cif.gz_B crystal structure of signal receiver domain of hd domain-containing protein from pseudomonas fluorescens pf-5 0.881 20 137
2iyn-assembly3.cif.gz_C the co-factor-induced pre-active conformation in phob 0.8728 23 131
1mb0-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ 0.868 22 131
ID Description Score Start End Superfamily
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9194 20 100 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9149 21 100 3.40.50.2300
af_P0A9Q1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9079 24 99 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9046 22 100 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9023 22 100 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3A4N723-F1-model_v4 Response regulator 0.9151 21 131 GO:0000160
AF-F5LB24-F1-model_v4 Response regulator receiver protein 0.904 20 103 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A6I3KMD0-F1-model_v4 Response regulator 0.8904 14 131 GO:0000160
AF-A0A7S7J1D8-F1-model_v4 Stage 0 sporulation protein A homolog 0.8888 18 103 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A350LT45-F1-model_v4 DNA-binding response regulator 0.8864 17 103 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map