F460310

General Info

Members Datasets Scaffolds Average Seq Length
532 281 1064 223

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0206586|Ga0451576_0206586_1215_1970
Length 251
Sequence MALREKSRPAVRSARKTNEGSTPVSKGRLIRLLLVDDHEVVRLGLRALFNRTGTIRVVGEADTMESAIAQAVRLKPDVILMDVRLPDGDGIEACREIRSECPDIRVLFLTSYSDEAAVVSTVFAGAAGFLLKEIGGSALVQAIETVAKGQSIFDPSAVQRMIAQMHPQSADEKPSPEDALSPRDERILALVAEGKTNKQIAVELNLSDKTIKNLLSVIFQKLQISRRSQAAAIFVKRAAAHYYPVIPKKDE

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
181 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
182 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
183 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
184 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
185 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
186 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
187 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
188 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
189 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
190 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
200 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
201 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
202 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
203 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
204 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
205 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
206 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
207 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
208 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
229 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
230 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
231 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
232 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
233 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
234 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
235 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
236 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
237 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
238 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
239 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
240 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
241 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
242 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
243 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
244 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
245 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
246 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
247 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
248 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
249 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
250 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
251 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
257 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
258 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
259 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
260 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
261 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
262 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
263 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
264 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
265 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
266 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
267 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 0.56
Rhizosphere 98.68
Stem 0
Stem Tuber 0
Unclassified 5.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0206586 3300045051 Bacteria 2051
2 JGI24737J22298_10035592 3300001990 Bacteria 1540
3 JGI25162J39368_1001285 3300002737 Bacteria 14229
4 JGI25165J46597_1000649 3300003214 Bacteria 28510
5 JGI26145J50221_1000622 3300003371 Bacteria 2990
6 Ga0058862_12494334 3300004803 Bacteria 1039
7 Ga0065715_10343468 3300005293 Bacteria 963
8 Ga0065707_10082920 3300005295 Bacteria 11403
9 Ga0065707_10147163 3300005295 Bacteria 1699
10 Ga0065707_10155957 3300005295 Unclassified 1608
11 Ga0065707_10156844 3300005295 Bacteria 1600
12 Ga0070676_10000208 3300005328 Bacteria 24961
13 Ga0070676_10334801 3300005328 Bacteria 1036
14 Ga0070683_100013326 3300005329 Bacteria 7167
15 Ga0070690_100000336 3300005330 Bacteria 24075
16 Ga0070690_100053293 3300005330 Bacteria 2588
17 Ga0070690_100255661 3300005330 Bacteria 1241
18 Ga0070670_100035231 3300005331 Bacteria 4309
19 Ga0070677_10033528 3300005333 Bacteria 1978
20 Ga0070677_10125513 3300005333 Bacteria 1165
21 Ga0068869_100044072 3300005334 Bacteria 3208
22 Ga0070666_10093743 3300005335 Bacteria 2065
23 Ga0070680_100014057 3300005336 Bacteria 6249
24 Ga0070680_100015879 3300005336 Bacteria 5912
25 Ga0070680_100245468 3300005336 Bacteria 1514
26 Ga0068868_100003923 3300005338 Bacteria 10391
27 Ga0070660_100155336 3300005339 Bacteria 1841
28 Ga0070689_100000066 3300005340 Bacteria 62639
29 Ga0070689_100013687 3300005340 Bacteria 5876
30 Ga0070689_100027407 3300005340 Bacteria 4295
31 Ga0070689_100166053 3300005340 Bacteria 1787
32 Ga0070689_100499628 3300005340 Bacteria 1042
33 Ga0070689_100922121 3300005340 Bacteria 774
34 Ga0070691_10000458 3300005341 Bacteria 15123
35 Ga0070691_10098550 3300005341 Bacteria 1449
36 Ga0070687_100007886 3300005343 Bacteria 4477
37 Ga0070687_100014961 3300005343 Bacteria 3498
38 Ga0070661_100059011 3300005344 Bacteria 2813
39 Ga0070661_100162922 3300005344 Bacteria 1690
40 Ga0070692_10007059 3300005345 Bacteria 4928
41 Ga0070692_10052047 3300005345 Bacteria 2132
42 Ga0070692_10065240 3300005345 Unclassified 1927
43 Ga0070692_10351715 3300005345 Bacteria 916
44 Ga0070669_100001454 3300005353 Bacteria 17172
45 Ga0070675_100022925 3300005354 Bacteria 4989
46 Ga0070675_100121241 3300005354 Bacteria 2222
47 Ga0070674_100002716 3300005356 Bacteria 9792
48 Ga0070674_100622115 3300005356 Bacteria 915
49 Ga0070673_100003965 3300005364 Bacteria 9304
50 Ga0070673_100166502 3300005364 Bacteria 1879
51 Ga0070688_100000114 3300005365 Bacteria 41990
52 Ga0070688_100003042 3300005365 Bacteria 8559
53 Ga0070659_100045053 3300005366 Bacteria 3455
54 Ga0070667_100044367 3300005367 Bacteria 3733
55 Ga0070703_10098849 3300005406 Unclassified 1025
56 Ga0070713_100039551 3300005436 Bacteria 3828
57 Ga0070713_100082959 3300005436 Bacteria 2739
58 Ga0070701_10000020 3300005438 Bacteria 41399
59 Ga0070701_10083380 3300005438 Bacteria 1736
60 Ga0070705_100173865 3300005440 Bacteria 1452
61 Ga0070700_100000818 3300005441 Bacteria 15281
62 Ga0070700_100006314 3300005441 Bacteria 6328
63 Ga0070700_100019665 3300005441 Bacteria 3901
64 Ga0070700_100137940 3300005441 Bacteria 1654
65 Ga0070700_100174157 3300005441 Unclassified 1492
66 Ga0070700_100387141 3300005441 Bacteria 1047
67 Ga0070694_100085689 3300005444 Bacteria 2201
68 Ga0070694_100131611 3300005444 Bacteria 1807
69 Ga0070678_100002436 3300005456 Bacteria 10191
70 Ga0070662_100027204 3300005457 Bacteria 3967
71 Ga0070681_10000949 3300005458 Bacteria 24425
72 Ga0070681_10065947 3300005458 Bacteria 3589
73 Ga0068867_100001096 3300005459 Bacteria 18486
74 Ga0068867_100004904 3300005459 Bacteria 9421
75 Ga0068867_100010555 3300005459 Bacteria 6516
76 Ga0068867_100184350 3300005459 Unclassified 1661
77 Ga0068867_100298694 3300005459 Bacteria 1327
78 Ga0070685_10000069 3300005466 Bacteria 60941
79 Ga0070706_100046137 3300005467 Bacteria 4023
80 Ga0070707_100000174 3300005468 Bacteria 62748
81 Ga0070707_100043125 3300005468 Bacteria 4318
82 Ga0070698_100055324 3300005471 Bacteria 4025
83 Ga0070699_100000203 3300005518 Bacteria 58650
84 Ga0070699_100007807 3300005518 Bacteria 9301
85 Ga0070699_100025037 3300005518 Bacteria 5146
86 Ga0070699_100054256 3300005518 Unclassified 3469
87 Ga0070699_100109040 3300005518 Bacteria 2429
88 Ga0070699_100615989 3300005518 Bacteria 990
89 Ga0070679_100073196 3300005530 Bacteria 3418
90 Ga0070679_100086185 3300005530 Bacteria 3128
91 Ga0070697_100000769 3300005536 Bacteria 23994
92 Ga0070697_100006083 3300005536 Bacteria 9334
93 Ga0070697_100009078 3300005536 Bacteria 7768
94 Ga0070697_100094160 3300005536 Bacteria 2481
95 Ga0070697_100384266 3300005536 Bacteria 1216
96 Ga0070672_100014728 3300005543 Bacteria 5548
97 Ga0070672_100018616 3300005543 Bacteria 5026
98 Ga0070672_100462267 3300005543 Unclassified 1094
99 Ga0070686_100000100 3300005544 Bacteria 59351
100 Ga0070686_100112019 3300005544 Bacteria 1861
101 Ga0070686_100152750 3300005544 Bacteria 1619
102 Ga0070695_100017152 3300005545 Bacteria 4391
103 Ga0070695_100161371 3300005545 Bacteria 1574
104 Ga0070696_100001020 3300005546 Bacteria 18098
105 Ga0070696_100003911 3300005546 Bacteria 9952
106 Ga0070696_100171976 3300005546 Unclassified 1602
107 Ga0070696_100248670 3300005546 Bacteria 1344
108 Ga0070696_100356335 3300005546 Bacteria 1134
109 Ga0070665_100011203 3300005548 Bacteria 9066
110 Ga0070704_100012684 3300005549 Bacteria 5214
111 Ga0070704_100059758 3300005549 Bacteria 2721
112 Ga0070704_100260063 3300005549 Bacteria 1429
113 Ga0070664_100000584 3300005564 Bacteria 27791
114 Ga0070664_100029223 3300005564 Bacteria 4594
115 Ga0068857_100020770 3300005577 Bacteria 5778
116 Ga0068857_100164213 3300005577 Bacteria 2016
117 Ga0068854_100360819 3300005578 Bacteria 1192
118 Ga0070702_100125430 3300005615 Bacteria 1613
119 Ga0070702_100176181 3300005615 Bacteria 1395
120 Ga0068859_100000797 3300005617 Bacteria 31969
121 Ga0068859_100314500 3300005617 Bacteria 1660
122 Ga0068866_10008391 3300005718 Bacteria 4353
123 Ga0068861_100003214 3300005719 Bacteria 10812
124 Ga0068861_100325067 3300005719 Bacteria 1341
125 Ga0068861_100418324 3300005719 Bacteria 1194
126 Ga0068851_10000190 3300005834 Bacteria 30256
127 Ga0068870_10642586 3300005840 Bacteria 726
128 Ga0068860_100033522 3300005843 Bacteria 4927
129 Ga0068860_100247168 3300005843 Unclassified 1736
130 Ga0068862_100005771 3300005844 Bacteria 10322
131 Ga0068862_100018207 3300005844 Bacteria 5848
132 Ga0068862_100711854 3300005844 Bacteria 973
133 Ga0081455_10000786 3300005937 Bacteria 40744
134 Ga0070717_10022747 3300006028 Bacteria 4958
135 Ga0070717_10057237 3300006028 Bacteria 3222
136 Ga0075432_10000036 3300006058 Bacteria 25056
137 Ga0075427_10008727 3300006194 Bacteria 1506
138 Ga0097621_100050861 3300006237 Bacteria 3371
139 Ga0097621_100185432 3300006237 Bacteria 1800
140 Ga0068871_100142571 3300006358 Bacteria 2038
141 Ga0075428_100047540 3300006844 Bacteria 4712
142 Ga0075428_100063247 3300006844 Bacteria 4051
143 Ga0075428_100791110 3300006844 Bacteria 1008
144 Ga0075428_100818097 3300006844 Bacteria 990
145 Ga0075428_101342255 3300006844 Unclassified 751
146 Ga0075430_100003725 3300006846 Bacteria 12810
147 Ga0075430_100006133 3300006846 Bacteria 10128
148 Ga0075430_100033289 3300006846 Bacteria 4374
149 Ga0075430_100113843 3300006846 Bacteria 2255
150 Ga0075430_100120701 3300006846 Bacteria 2185
151 Ga0075431_100001499 3300006847 Bacteria 21616
152 Ga0075431_100002174 3300006847 Bacteria 18731
153 Ga0075431_100124758 3300006847 Unclassified 2657
154 Ga0075431_100171987 3300006847 Bacteria 2225
155 Ga0075431_100452497 3300006847 Bacteria 1279
156 Ga0075431_100580619 3300006847 Bacteria 1106
157 Ga0075431_100752293 3300006847 Bacteria 950
158 Ga0075433_10034668 3300006852 Bacteria 4336
159 Ga0075433_10073129 3300006852 Unclassified 3015
160 Ga0075433_10413226 3300006852 Bacteria 1190
161 Ga0075434_100025831 3300006871 Bacteria 5749
162 Ga0075434_100551876 3300006871 Bacteria 1172
163 Ga0075429_100001236 3300006880 Bacteria 20721
164 Ga0075429_100018761 3300006880 Bacteria 5990
165 Ga0075429_100044800 3300006880 Bacteria 3848
166 Ga0075429_100150385 3300006880 Bacteria 2038
167 Ga0075429_100323505 3300006880 Bacteria 1349
168 Ga0075429_100886570 3300006880 Bacteria 781
169 Ga0068865_100005516 3300006881 Bacteria 7677
170 Ga0068865_100061183 3300006881 Bacteria 2638
171 Ga0075436_100025325 3300006914 Bacteria 4082
172 Ga0075436_100120137 3300006914 Bacteria 1838
173 Ga0097620_100000797 3300006931 Bacteria 31969
174 Ga0097620_100314511 3300006931 Bacteria 1660
175 Ga0075435_100015728 3300007076 Bacteria 5691
176 Ga0075435_100120978 3300007076 Bacteria 2184
177 Ga0105240_10317588 3300009093 Bacteria 1776
178 Ga0111539_10086759 3300009094 Bacteria 3677
179 Ga0111539_10221675 3300009094 Bacteria 2202
180 Ga0111539_11377951 3300009094 Bacteria 818
181 Ga0105245_10012432 3300009098 Bacteria 7408
182 Ga0114129_10016132 3300009147 Bacteria 10629
183 Ga0114129_10018292 3300009147 Bacteria 9981
184 Ga0114129_10036857 3300009147 Bacteria 6905
185 Ga0114129_10094153 3300009147 Bacteria 4149
186 Ga0114129_10471088 3300009147 Bacteria 1645
187 Ga0114129_10698086 3300009147 Bacteria 1304
188 Ga0114129_10992145 3300009147 Bacteria 1058
189 Ga0105243_10000238 3300009148 Bacteria 63019
190 Ga0105243_10003957 3300009148 Bacteria 11823
191 Ga0105243_10621152 3300009148 Bacteria 1043
192 Ga0105243_10746354 3300009148 Unclassified 959
193 Ga0105243_11091783 3300009148 Bacteria 806
194 Ga0105242_10001243 3300009176 Bacteria 20071
195 Ga0105242_10022908 3300009176 Bacteria 4919
196 Ga0105248_10000910 3300009177 Bacteria 32974
197 Ga0105248_10039972 3300009177 Bacteria 5257
198 Ga0105249_10011144 3300009553 Bacteria 7899
199 Ga0105249_10063640 3300009553 Bacteria 3389
200 Ga0105249_10172519 3300009553 Bacteria 2098
201 Ga0105246_10077959 3300011119 Bacteria 2352
202 Ga0157373_10218328 3300013100 Bacteria 1345
203 Ga0157374_10064849 3300013296 Bacteria 3429
204 Ga0157374_10334043 3300013296 Bacteria 1504
205 Ga0157374_10632712 3300013296 Bacteria 1081
206 Ga0157378_10009137 3300013297 Bacteria 8626
207 Ga0163162_10209229 3300013306 Bacteria 2080
208 Ga0163162_10593695 3300013306 Bacteria 1234
209 Ga0163162_10598085 3300013306 Bacteria 1229
210 Ga0157375_10082249 3300013308 Bacteria 3261
211 Ga0157375_10681122 3300013308 Bacteria 1183
212 Ga0157380_10011230 3300014326 Bacteria 6467
213 Ga0157380_10029960 3300014326 Bacteria 4164
214 Ga0157380_10653923 3300014326 Bacteria 1049
215 Ga0157380_10687698 3300014326 Bacteria 1026
216 Ga0157377_10018864 3300014745 Bacteria 3593
217 Ga0157377_10415448 3300014745 Bacteria 920
218 Ga0157376_10080700 3300014969 Bacteria 2791
219 Ga0209437_100301 3300025233 Bacteria 69230
220 Ga0209233_1000285 3300025261 Bacteria 69238
221 Ga0207682_10011353 3300025893 Bacteria 3478
222 Ga0207692_10100998 3300025898 Bacteria 1583
223 Ga0207642_10005018 3300025899 Bacteria 4296
224 Ga0207688_10016869 3300025901 Bacteria 3966
225 Ga0207680_10065528 3300025903 Bacteria 2230
226 Ga0207645_10000472 3300025907 Bacteria 33217
227 Ga0207643_10215690 3300025908 Bacteria 1173
228 Ga0207684_10039479 3300025910 Bacteria 4004
229 Ga0207684_10227179 3300025910 Bacteria 1611
230 Ga0207684_10367547 3300025910 Unclassified 1238
231 Ga0207707_10003210 3300025912 Bacteria 14520
232 Ga0207707_10223182 3300025912 Bacteria 1640
233 Ga0207660_10004716 3300025917 Bacteria 8877
234 Ga0207660_10016768 3300025917 Bacteria 4857
235 Ga0207660_10135434 3300025917 Bacteria 1879
236 Ga0207660_10230076 3300025917 Bacteria 1457
237 Ga0207662_10001208 3300025918 Bacteria 12343
238 Ga0207662_10001387 3300025918 Bacteria 11704
239 Ga0207662_10243616 3300025918 Bacteria 1178
240 Ga0207662_10438188 3300025918 Bacteria 892
241 Ga0207657_10026122 3300025919 Bacteria 5372
242 Ga0207649_10102270 3300025920 Bacteria 1899
243 Ga0207649_10138219 3300025920 Bacteria 1663
244 Ga0207652_10063414 3300025921 Bacteria 3196
245 Ga0207652_10107581 3300025921 Bacteria 2470
246 Ga0207646_10000002 3300025922 Bacteria 550880
247 Ga0207646_10084589 3300025922 Bacteria 2839
248 Ga0207681_10007353 3300025923 Bacteria 6746
249 Ga0207681_10078341 3300025923 Bacteria 2325
250 Ga0207650_10028346 3300025925 Bacteria 4014
251 Ga0207659_10070962 3300025926 Bacteria 2542
252 Ga0207659_10141810 3300025926 Bacteria 1866
253 Ga0207700_10013697 3300025928 Bacteria 5288
254 Ga0207690_10041191 3300025932 Bacteria 3025
255 Ga0207706_10001209 3300025933 Bacteria 26097
256 Ga0207670_10000098 3300025936 Bacteria 60320
257 Ga0207670_10006458 3300025936 Bacteria 6504
258 Ga0207670_10069318 3300025936 Bacteria 2432
259 Ga0207670_10121442 3300025936 Bacteria 1900
260 Ga0207669_10000358 3300025937 Bacteria 20723
261 Ga0207704_10022133 3300025938 Bacteria 3399
262 Ga0207704_10432912 3300025938 Bacteria 1046
263 Ga0207691_10000555 3300025940 Bacteria 37340
264 Ga0207691_10102607 3300025940 Bacteria 2551
265 Ga0207691_10392893 3300025940 Unclassified 1183
266 Ga0207711_10005850 3300025941 Bacteria 10384
267 Ga0207711_10069993 3300025941 Unclassified 3042
268 Ga0207689_10003806 3300025942 Bacteria 13754
269 Ga0207689_10093509 3300025942 Bacteria 2470
270 Ga0207661_10507493 3300025944 Bacteria 1102
271 Ga0207679_10002301 3300025945 Bacteria 11774
272 Ga0207679_10003057 3300025945 Bacteria 10362
273 Ga0207667_10191581 3300025949 Bacteria 2098
274 Ga0207651_10003023 3300025960 Bacteria 8151
275 Ga0207651_10219155 3300025960 Bacteria 1537
276 Ga0207712_10006987 3300025961 Bacteria 7118
277 Ga0207668_10001671 3300025972 Bacteria 12968
278 Ga0207668_10053140 3300025972 Bacteria 2806
279 Ga0207640_10011726 3300025981 Bacteria 4970
280 Ga0207658_10011910 3300025986 Bacteria 5930
281 Ga0207677_10072678 3300026023 Bacteria 2432
282 Ga0207677_10802127 3300026023 Unclassified 843
283 Ga0207708_10003299 3300026075 Bacteria 11877
284 Ga0207708_10015027 3300026075 Bacteria 5802
285 Ga0207708_10048088 3300026075 Bacteria 3247
286 Ga0207641_10037514 3300026088 Bacteria 4048
287 Ga0207648_10000276 3300026089 Bacteria 55713
288 Ga0207648_10000543 3300026089 Bacteria 42056
289 Ga0207648_10001721 3300026089 Bacteria 23956
290 Ga0207648_10224956 3300026089 Unclassified 1668
291 Ga0207648_10383978 3300026089 Bacteria 1270
292 Ga0207674_10029412 3300026116 Bacteria 5784
293 Ga0207674_10205004 3300026116 Bacteria 1921
294 Ga0207675_100007574 3300026118 Bacteria 10257
295 Ga0207675_100096568 3300026118 Bacteria 2782
296 Ga0207675_100458692 3300026118 Bacteria 1264
297 Ga0207675_100740546 3300026118 Bacteria 994
298 Ga0207683_10001107 3300026121 Bacteria 24547
299 Ga0209973_1000627 3300027252 Bacteria 2769
300 Ga0209969_1000008 3300027360 Bacteria 28047
301 Ga0209967_1000144 3300027364 Bacteria 9733
302 Ga0209981_1000003 3300027378 Bacteria 30420
303 Ga0209996_1000058 3300027395 Bacteria 15054
304 Ga0210000_1000024 3300027462 Bacteria 23307
305 Ga0209995_1000087 3300027471 Bacteria 14662
306 Ga0209968_1000019 3300027526 Bacteria 32234
307 Ga0209968_1036060 3300027526 Bacteria 836
308 Ga0209999_1000055 3300027543 Bacteria 12672
309 Ga0209982_1000541 3300027552 Bacteria 4709
310 Ga0209982_1028476 3300027552 Bacteria 874
311 Ga0209970_1000013 3300027614 Bacteria 24097
312 Ga0210002_1000024 3300027617 Bacteria 23321
313 Ga0210002_1047157 3300027617 Bacteria 739
314 Ga0209983_1000253 3300027665 Bacteria 10950
315 Ga0209971_1000232 3300027682 Bacteria 15872
316 Ga0209966_1000331 3300027695 Bacteria 14989
317 Ga0209998_10000094 3300027717 Bacteria 35182
318 Ga0209998_10010297 3300027717 Bacteria 1936
319 Ga0209998_10017197 3300027717 Bacteria 1526
320 Ga0209974_10000076 3300027876 Bacteria 26650
321 Ga0209974_10001696 3300027876 Bacteria 7979
322 Ga0209974_10029023 3300027876 Bacteria 1833
323 Ga0209974_10063014 3300027876 Unclassified 1257
324 Ga0207428_10000529 3300027907 Bacteria 45592
325 Ga0207428_10003555 3300027907 Bacteria 15064
326 Ga0207428_10039242 3300027907 Bacteria 3845
327 Ga0207428_10508084 3300027907 Bacteria 875
328 Ga0268266_10196812 3300028379 Bacteria 1843
329 Ga0268265_10036624 3300028380 Bacteria 3595
330 Ga0268265_10037045 3300028380 Bacteria 3576
331 Ga0268265_10070008 3300028380 Bacteria 2726
332 Ga0268265_10861719 3300028380 Bacteria 887
333 Ga0268264_10197119 3300028381 Bacteria 1839
334 Ga0265318_10006061 3300028577 Bacteria 5603
335 Ga0307408_100010072 3300031548 Bacteria 6231
336 Ga0307408_100129805 3300031548 Bacteria 1964
337 Ga0307408_100203369 3300031548 Bacteria 1605
338 Ga0307405_10017480 3300031731 Bacteria 3936
339 Ga0307405_10339847 3300031731 Bacteria 1154
340 Ga0307413_10498568 3300031824 Bacteria 977
341 Ga0307410_10453259 3300031852 Unclassified 1047
342 Ga0307407_10112802 3300031903 Unclassified 1710
343 Ga0307409_100205553 3300031995 Bacteria 1765
344 Ga0307409_100544098 3300031995 Bacteria 1139
345 Ga0307416_100088592 3300032002 Bacteria 2647
346 Ga0307416_101325507 3300032002 Unclassified 826
347 Ga0307414_10050348 3300032004 Bacteria 2885
348 Ga0307411_10106373 3300032005 Bacteria 1997
349 Ga0307411_10117509 3300032005 Bacteria 1916
350 Ga0307415_100246860 3300032126 Bacteria 1448
351 Ga0307415_100300003 3300032126 Bacteria 1330
352 Ga0373940_0143078 3300035088 Bacteria 757
353 Ga0373941_0065300 3300035115 Bacteria 1194
354 Ga0373941_0072554 3300035115 Bacteria 1146
355 Ga0373942_0019679 3300035207 Bacteria 1687
356 Ga0373942_0076952 3300035207 Bacteria 984
357 Ga0373961_0025237 3300035241 Bacteria 1614
358 Ga0373931_0012622 3300035691 Bacteria 4097
359 Ga0373931_0427214 3300035691 Unclassified 843
360 Ga0395900_0858248 3300037418 Bacteria 833
361 Ga0439438_015089 3300041405 Bacteria 2282
362 Ga0439441_011852 3300042001 Bacteria 1486
363 Ga0439445_0032238 3300042004 Bacteria 1365
364 Ga0439432_018382 3300042006 Bacteria 2336
365 Ga0439450_000289 3300042008 Bacteria 6222
366 Ga0439452_012134 3300042010 Bacteria 2460
367 Ga0439462_0011814 3300042015 Bacteria 2227
368 Ga0439463_049351 3300042016 Bacteria 1073
369 Ga0450888_005211 3300042126 Bacteria 1379
370 Ga0450905_015836 3300042142 Bacteria 1083
371 Ga0439458_0036830 3300042157 Bacteria 1178
372 Ga0439434_0003138 3300042435 Bacteria 4858
373 Ga0439464_0053663 3300042439 Bacteria 1170
374 Ga0439460_0019607 3300042461 Bacteria 1833
375 Ga0439460_0028323 3300042461 Bacteria 1580
376 Ga0453683_0152319 3300044673 Bacteria 1461
377 Ga0453684_0025592 3300044712 Bacteria 8563
378 Ga0451576_0005198 3300045051 Bacteria 16438
379 Ga0451576_0021687 3300045051 Bacteria 6978
380 Ga0451576_0060593 3300045051 Bacteria 3948
381 Ga0451576_0076318 3300045051 Bacteria 3488
382 Ga0451576_0101652 3300045051 Unclassified 2990
383 Ga0451576_0522823 3300045051 Bacteria 1247
384 Ga0451576_0577234 3300045051 Bacteria 1181
385 Ga0451576_0903461 3300045051 Bacteria 926
386 Ga0495613_0541488 3300046689 Unclassified 780
387 Ga0496106_0168144 3300048909 Bacteria 1737
388 Ga0496106_0641795 3300048909 Bacteria 849
389 Ga0496112_0650879 3300048915 Bacteria 983
390 Ga0501290_000059 3300049513 Bacteria 15168
391 Ga0501291_000488 3300049514 Bacteria 4616
392 Ga0501291_037816 3300049514 Bacteria 838
393 Ga0501292_000129 3300049515 Bacteria 12783
394 Ga0501294_001147 3300049517 Bacteria 2758
395 Ga0501295_000527 3300049518 Bacteria 3586
396 Ga0501296_000322 3300049519 Bacteria 4918
397 Ga0501297_006586 3300049520 Bacteria 1244
398 Ga0501298_014650 3300049521 Bacteria 1403
399 Ga0501299_000048 3300049522 Bacteria 13201
400 Ga0501300_000939 3300049523 Bacteria 4450
401 Ga0501031_0000180 3300049568 Bacteria 35738
402 Ga0501031_0005414 3300049568 Bacteria 8309
403 Ga0501031_0021701 3300049568 Bacteria 4186
404 Ga0501036_0045620 3300049572 Bacteria 3712
405 Ga0501036_0113453 3300049572 Bacteria 2290
406 Ga0501036_0847867 3300049572 Bacteria 751
407 Ga0501037_0317158 3300049573 Bacteria 1080
408 Ga0501038_0016430 3300049574 Bacteria 6707
409 Ga0501038_0483461 3300049574 Bacteria 949
410 Ga0501039_0000834 3300049575 Bacteria 22277
411 Ga0501039_0000919 3300049575 Bacteria 21494
412 Ga0501039_0688762 3300049575 Bacteria 799
413 Ga0501040_0003533 3300049576 Bacteria 10103
414 Ga0501040_0011021 3300049576 Bacteria 5910
415 Ga0501040_0036594 3300049576 Bacteria 3332
416 Ga0501041_0000481 3300049577 Bacteria 20342
417 Ga0501041_0229934 3300049577 Bacteria 1164
418 Ga0501042_0000164 3300049578 Bacteria 30409
419 Ga0501042_0031091 3300049578 Bacteria 3777
420 Ga0501042_0495586 3300049578 Bacteria 887
421 Ga0501043_0048992 3300049579 Bacteria 3321
422 Ga0501046_0002388 3300049580 Bacteria 17642
423 Ga0501046_0003725 3300049580 Bacteria 13952
424 Ga0501046_0235579 3300049580 Bacteria 1351
425 Ga0501048_0001626 3300049582 Bacteria 17099
426 Ga0501048_0058909 3300049582 Bacteria 2721
427 Ga0501067_0050791 3300049583 Bacteria 2298
428 Ga0501068_0401912 3300049584 Bacteria 883
429 Ga0501070_0009317 3300049586 Bacteria 8305
430 Ga0501071_0038595 3300049587 Bacteria 3413
431 Ga0501071_0051850 3300049587 Bacteria 2957
432 Ga0501071_0052916 3300049587 Bacteria 2928
433 Ga0501072_0440431 3300049588 Bacteria 1032
434 Ga0501075_0093869 3300049591 Bacteria 2277
435 Ga0501075_0105994 3300049591 Bacteria 2136
436 Ga0501075_0349573 3300049591 Bacteria 1127
437 Ga0501076_0020223 3300049592 Bacteria 5094
438 Ga0501076_0038758 3300049592 Bacteria 3741
439 Ga0501076_0150033 3300049592 Bacteria 1896
440 Ga0501076_0304192 3300049592 Bacteria 1307
441 Ga0501077_0025561 3300049593 Bacteria 3750
442 Ga0501077_0081064 3300049593 Bacteria 2055
443 Ga0501077_0428857 3300049593 Unclassified 846
444 Ga0501201_002201 3300049651 Bacteria 1789
445 Ga0501202_002220 3300049652 Bacteria 3241
446 Ga0501207_002773 3300049654 Bacteria 2288
447 Ga0501216_026863 3300049660 Bacteria 1041
448 Ga0501217_006804 3300049661 Bacteria 2438
449 Ga0501227_054178 3300049665 Bacteria 1017
450 Ga0501228_000969 3300049666 Bacteria 1983
451 Ga0501230_003655 3300049667 Bacteria 2060
452 Ga0501233_001024 3300049668 Bacteria 4752
453 Ga0501235_005843 3300049669 Bacteria 2679
454 Ga0501236_002097 3300049670 Bacteria 2274
455 Ga0501239_002111 3300049672 Bacteria 1780
456 Ga0501243_001231 3300049675 Bacteria 3669
457 Ga0501246_000121 3300049676 Bacteria 4745
458 Ga0501249_005735 3300049679 Bacteria 2537
459 Ga0501251_000290 3300049681 Bacteria 4440
460 Ga0501251_010919 3300049681 Bacteria 1074
461 Ga0501252_003336 3300049682 Bacteria 1648
462 Ga0501258_000856 3300049687 Bacteria 2277
463 Ga0501261_024892 3300049690 Bacteria 878
464 Ga0501219_001566 3300049703 Bacteria 2106
465 Ga0501221_002583 3300049704 Bacteria 2986
466 Ga0501225_0044852 3300049705 Bacteria 1223
467 Ga0501234_000290 3300049707 Bacteria 7353
468 Ga0501245_002169 3300049708 Bacteria 2609
469 Ga0501079_0012495 3300049741 Bacteria 6481
470 Ga0501079_0019443 3300049741 Bacteria 5188
471 Ga0501079_0061866 3300049741 Bacteria 2887
472 Ga0501079_0335315 3300049741 Bacteria 1184
473 Ga0501080_0085095 3300049742 Bacteria 2938
474 Ga0501080_0263680 3300049742 Bacteria 1569
475 Ga0501081_0108341 3300049743 Bacteria 1970
476 Ga0501081_0170750 3300049743 Unclassified 1570
477 Ga0501083_0055564 3300049744 Bacteria 2654
478 Ga0501232_002905 3300049757 Bacteria 1526
479 Ga0501263_032821 3300049760 Unclassified 739
480 Ga0501264_000674 3300049761 Bacteria 4684
481 Ga0501265_000090 3300049762 Bacteria 7953
482 Ga0501265_013488 3300049762 Bacteria 1029
483 Ga0501266_001401 3300049763 Bacteria 3079
484 Ga0501268_005185 3300049765 Bacteria 1864
485 Ga0501270_003400 3300049767 Bacteria 1715
486 Ga0501273_006029 3300049770 Bacteria 1389
487 Ga0501275_001141 3300049772 Bacteria 2682
488 Ga0501276_000898 3300049773 Bacteria 1908
489 Ga0501279_005900 3300049775 Bacteria 1612
490 Ga0501279_041955 3300049775 Bacteria 705
491 Ga0501283_004101 3300049779 Bacteria 1955
492 Ga0501035_0003730 3300049822 Bacteria 14525
493 Ga0501035_0020689 3300049822 Bacteria 6047
494 Ga0501035_0048260 3300049822 Bacteria 3819
495 Ga0501045_0409737 3300049824 Bacteria 1008
496 Ga0501226_002731 3300049853 Bacteria 2128
497 nmdc:mga05p37_35207_c1 3300050507 Bacteria 6138
498 nmdc:mga05p37_358868_c1 3300050507 Bacteria 1714
499 nmdc:mga05p37_384581_c1 3300050507 Bacteria 1643
500 nmdc:mga05p37_592468_c1 3300050507 Bacteria 1253
501 nmdc:mga05p37_7114_c1 3300050507 Bacteria 13190
502 nmdc:mga09592_21121_c1 3300050508 Bacteria 5363
503 nmdc:mga09592_57742_c1 3300050508 Bacteria 3281
504 nmdc:mga0qj67_123910_c1 3300050509 Bacteria 2091
505 nmdc:mga0qj67_324046_c1 3300050509 Bacteria 1247
506 nmdc:mga0qj67_570435_c1 3300050509 Bacteria 907
507 nmdc:mga0qj67_59229_c1 3300050509 Bacteria 3037
508 nmdc:mga0qj67_62613_c1 3300050509 Bacteria 2956
509 nmdc:mga0qj67_7716_c1 3300050509 Bacteria 7952
510 nmdc:mga06r32_12645_c1 3300050510 Bacteria 7627
511 nmdc:mga06r32_170190_c1 3300050510 Bacteria 2162
512 nmdc:mga06r32_31431_c1 3300050510 Bacteria 4987
513 nmdc:mga06r32_541094_c1 3300050510 Bacteria 1139
514 nmdc:mga06r32_629_c1 3300050510 Bacteria 6261
515 nmdc:mga06r32_81312_c1 3300050510 Bacteria 3155
516 nmdc:mga06r32_861914_c1 3300050510 Bacteria 864
517 nmdc:mga06r32_965086_c1 3300050510 Bacteria 806
518 nmdc:mga08y16_21330_c1 3300050511 Bacteria 6840
519 nmdc:mga08y16_21638_c1 3300050511 Bacteria 6790
520 nmdc:mga08y16_579686_c1 3300050511 Bacteria 1133
521 nmdc:mga0n895_124385_c1 3300050512 Bacteria 2602
522 nmdc:mga0n895_296077_c1 3300050512 Bacteria 1641
523 nmdc:mga0n895_33678_c1 3300050512 Bacteria 4924
524 nmdc:mga0n895_530764_c1 3300050512 Bacteria 1184
525 nmdc:mga0n895_53286_c1 3300050512 Bacteria 3975
526 nmdc:mga0rr50_11342_c1 3300050513 Bacteria 5701
527 nmdc:mga0a205_6503_c1 3300050515 Bacteria 10566
528 Ga0501084_0312913 3300054114 Unclassified 1326
529 Ga0501082_0103840 3300060353 Bacteria 2458
530 Ga0501082_0157448 3300060353 Bacteria 1973
531 Ga0530510_0031102 3300061734 Bacteria 3837
532 Ga0530510_0363815 3300061734 Bacteria 1087
533 Ga0451576_0206586
534 JGI24737J22298_10035592
535 JGI25162J39368_1001285
536 JGI25165J46597_1000649
537 JGI26145J50221_1000622
538 Ga0058862_12494334
539 Ga0065715_10343468
540 Ga0065707_10082920
541 Ga0065707_10147163
542 Ga0065707_10155957
543 Ga0065707_10156844
544 Ga0070676_10000208
545 Ga0070676_10334801
546 Ga0070683_100013326
547 Ga0070690_100000336
548 Ga0070690_100053293
549 Ga0070690_100255661
550 Ga0070670_100035231
551 Ga0070677_10033528
552 Ga0070677_10125513
553 Ga0068869_100044072
554 Ga0070666_10093743
555 Ga0070680_100014057
556 Ga0070680_100015879
557 Ga0070680_100245468
558 Ga0068868_100003923
559 Ga0070660_100155336
560 Ga0070689_100000066
561 Ga0070689_100013687
562 Ga0070689_100027407
563 Ga0070689_100166053
564 Ga0070689_100499628
565 Ga0070689_100922121
566 Ga0070691_10000458
567 Ga0070691_10098550
568 Ga0070687_100007886
569 Ga0070687_100014961
570 Ga0070661_100059011
571 Ga0070661_100162922
572 Ga0070692_10007059
573 Ga0070692_10052047
574 Ga0070692_10065240
575 Ga0070692_10351715
576 Ga0070669_100001454
577 Ga0070675_100022925
578 Ga0070675_100121241
579 Ga0070674_100002716
580 Ga0070674_100622115
581 Ga0070673_100003965
582 Ga0070673_100166502
583 Ga0070688_100000114
584 Ga0070688_100003042
585 Ga0070659_100045053
586 Ga0070667_100044367
587 Ga0070703_10098849
588 Ga0070713_100039551
589 Ga0070713_100082959
590 Ga0070701_10000020
591 Ga0070701_10083380
592 Ga0070705_100173865
593 Ga0070700_100000818
594 Ga0070700_100006314
595 Ga0070700_100019665
596 Ga0070700_100137940
597 Ga0070700_100174157
598 Ga0070700_100387141
599 Ga0070694_100085689
600 Ga0070694_100131611
601 Ga0070678_100002436
602 Ga0070662_100027204
603 Ga0070681_10000949
604 Ga0070681_10065947
605 Ga0068867_100001096
606 Ga0068867_100004904
607 Ga0068867_100010555
608 Ga0068867_100184350
609 Ga0068867_100298694
610 Ga0070685_10000069
611 Ga0070706_100046137
612 Ga0070707_100000174
613 Ga0070707_100043125
614 Ga0070698_100055324
615 Ga0070699_100000203
616 Ga0070699_100007807
617 Ga0070699_100025037
618 Ga0070699_100054256
619 Ga0070699_100109040
620 Ga0070699_100615989
621 Ga0070679_100073196
622 Ga0070679_100086185
623 Ga0070697_100000769
624 Ga0070697_100006083
625 Ga0070697_100009078
626 Ga0070697_100094160
627 Ga0070697_100384266
628 Ga0070672_100014728
629 Ga0070672_100018616
630 Ga0070672_100462267
631 Ga0070686_100000100
632 Ga0070686_100112019
633 Ga0070686_100152750
634 Ga0070695_100017152
635 Ga0070695_100161371
636 Ga0070696_100001020
637 Ga0070696_100003911
638 Ga0070696_100171976
639 Ga0070696_100248670
640 Ga0070696_100356335
641 Ga0070665_100011203
642 Ga0070704_100012684
643 Ga0070704_100059758
644 Ga0070704_100260063
645 Ga0070664_100000584
646 Ga0070664_100029223
647 Ga0068857_100020770
648 Ga0068857_100164213
649 Ga0068854_100360819
650 Ga0070702_100125430
651 Ga0070702_100176181
652 Ga0068859_100000797
653 Ga0068859_100314500
654 Ga0068866_10008391
655 Ga0068861_100003214
656 Ga0068861_100325067
657 Ga0068861_100418324
658 Ga0068851_10000190
659 Ga0068870_10642586
660 Ga0068860_100033522
661 Ga0068860_100247168
662 Ga0068862_100005771
663 Ga0068862_100018207
664 Ga0068862_100711854
665 Ga0081455_10000786
666 Ga0070717_10022747
667 Ga0070717_10057237
668 Ga0075432_10000036
669 Ga0075427_10008727
670 Ga0097621_100050861
671 Ga0097621_100185432
672 Ga0068871_100142571
673 Ga0075428_100047540
674 Ga0075428_100063247
675 Ga0075428_100791110
676 Ga0075428_100818097
677 Ga0075428_101342255
678 Ga0075430_100003725
679 Ga0075430_100006133
680 Ga0075430_100033289
681 Ga0075430_100113843
682 Ga0075430_100120701
683 Ga0075431_100001499
684 Ga0075431_100002174
685 Ga0075431_100124758
686 Ga0075431_100171987
687 Ga0075431_100452497
688 Ga0075431_100580619
689 Ga0075431_100752293
690 Ga0075433_10034668
691 Ga0075433_10073129
692 Ga0075433_10413226
693 Ga0075434_100025831
694 Ga0075434_100551876
695 Ga0075429_100001236
696 Ga0075429_100018761
697 Ga0075429_100044800
698 Ga0075429_100150385
699 Ga0075429_100323505
700 Ga0075429_100886570
701 Ga0068865_100005516
702 Ga0068865_100061183
703 Ga0075436_100025325
704 Ga0075436_100120137
705 Ga0097620_100000797
706 Ga0097620_100314511
707 Ga0075435_100015728
708 Ga0075435_100120978
709 Ga0105240_10317588
710 Ga0111539_10086759
711 Ga0111539_10221675
712 Ga0111539_11377951
713 Ga0105245_10012432
714 Ga0114129_10016132
715 Ga0114129_10018292
716 Ga0114129_10036857
717 Ga0114129_10094153
718 Ga0114129_10471088
719 Ga0114129_10698086
720 Ga0114129_10992145
721 Ga0105243_10000238
722 Ga0105243_10003957
723 Ga0105243_10621152
724 Ga0105243_10746354
725 Ga0105243_11091783
726 Ga0105242_10001243
727 Ga0105242_10022908
728 Ga0105248_10000910
729 Ga0105248_10039972
730 Ga0105249_10011144
731 Ga0105249_10063640
732 Ga0105249_10172519
733 Ga0105246_10077959
734 Ga0157373_10218328
735 Ga0157374_10064849
736 Ga0157374_10334043
737 Ga0157374_10632712
738 Ga0157378_10009137
739 Ga0163162_10209229
740 Ga0163162_10593695
741 Ga0163162_10598085
742 Ga0157375_10082249
743 Ga0157375_10681122
744 Ga0157380_10011230
745 Ga0157380_10029960
746 Ga0157380_10653923
747 Ga0157380_10687698
748 Ga0157377_10018864
749 Ga0157377_10415448
750 Ga0157376_10080700
751 Ga0209437_100301
752 Ga0209233_1000285
753 Ga0207682_10011353
754 Ga0207692_10100998
755 Ga0207642_10005018
756 Ga0207688_10016869
757 Ga0207680_10065528
758 Ga0207645_10000472
759 Ga0207643_10215690
760 Ga0207684_10039479
761 Ga0207684_10227179
762 Ga0207684_10367547
763 Ga0207707_10003210
764 Ga0207707_10223182
765 Ga0207660_10004716
766 Ga0207660_10016768
767 Ga0207660_10135434
768 Ga0207660_10230076
769 Ga0207662_10001208
770 Ga0207662_10001387
771 Ga0207662_10243616
772 Ga0207662_10438188
773 Ga0207657_10026122
774 Ga0207649_10102270
775 Ga0207649_10138219
776 Ga0207652_10063414
777 Ga0207652_10107581
778 Ga0207646_10000002
779 Ga0207646_10084589
780 Ga0207681_10007353
781 Ga0207681_10078341
782 Ga0207650_10028346
783 Ga0207659_10070962
784 Ga0207659_10141810
785 Ga0207700_10013697
786 Ga0207690_10041191
787 Ga0207706_10001209
788 Ga0207670_10000098
789 Ga0207670_10006458
790 Ga0207670_10069318
791 Ga0207670_10121442
792 Ga0207669_10000358
793 Ga0207704_10022133
794 Ga0207704_10432912
795 Ga0207691_10000555
796 Ga0207691_10102607
797 Ga0207691_10392893
798 Ga0207711_10005850
799 Ga0207711_10069993
800 Ga0207689_10003806
801 Ga0207689_10093509
802 Ga0207661_10507493
803 Ga0207679_10002301
804 Ga0207679_10003057
805 Ga0207667_10191581
806 Ga0207651_10003023
807 Ga0207651_10219155
808 Ga0207712_10006987
809 Ga0207668_10001671
810 Ga0207668_10053140
811 Ga0207640_10011726
812 Ga0207658_10011910
813 Ga0207677_10072678
814 Ga0207677_10802127
815 Ga0207708_10003299
816 Ga0207708_10015027
817 Ga0207708_10048088
818 Ga0207641_10037514
819 Ga0207648_10000276
820 Ga0207648_10000543
821 Ga0207648_10001721
822 Ga0207648_10224956
823 Ga0207648_10383978
824 Ga0207674_10029412
825 Ga0207674_10205004
826 Ga0207675_100007574
827 Ga0207675_100096568
828 Ga0207675_100458692
829 Ga0207675_100740546
830 Ga0207683_10001107
831 Ga0209973_1000627
832 Ga0209969_1000008
833 Ga0209967_1000144
834 Ga0209981_1000003
835 Ga0209996_1000058
836 Ga0210000_1000024
837 Ga0209995_1000087
838 Ga0209968_1000019
839 Ga0209968_1036060
840 Ga0209999_1000055
841 Ga0209982_1000541
842 Ga0209982_1028476
843 Ga0209970_1000013
844 Ga0210002_1000024
845 Ga0210002_1047157
846 Ga0209983_1000253
847 Ga0209971_1000232
848 Ga0209966_1000331
849 Ga0209998_10000094
850 Ga0209998_10010297
851 Ga0209998_10017197
852 Ga0209974_10000076
853 Ga0209974_10001696
854 Ga0209974_10029023
855 Ga0209974_10063014
856 Ga0207428_10000529
857 Ga0207428_10003555
858 Ga0207428_10039242
859 Ga0207428_10508084
860 Ga0268266_10196812
861 Ga0268265_10036624
862 Ga0268265_10037045
863 Ga0268265_10070008
864 Ga0268265_10861719
865 Ga0268264_10197119
866 Ga0265318_10006061
867 Ga0307408_100010072
868 Ga0307408_100129805
869 Ga0307408_100203369
870 Ga0307405_10017480
871 Ga0307405_10339847
872 Ga0307413_10498568
873 Ga0307410_10453259
874 Ga0307407_10112802
875 Ga0307409_100205553
876 Ga0307409_100544098
877 Ga0307416_100088592
878 Ga0307416_101325507
879 Ga0307414_10050348
880 Ga0307411_10106373
881 Ga0307411_10117509
882 Ga0307415_100246860
883 Ga0307415_100300003
884 Ga0373940_0143078
885 Ga0373941_0065300
886 Ga0373941_0072554
887 Ga0373942_0019679
888 Ga0373942_0076952
889 Ga0373961_0025237
890 Ga0373931_0012622
891 Ga0373931_0427214
892 Ga0395900_0858248
893 Ga0439438_015089
894 Ga0439441_011852
895 Ga0439445_0032238
896 Ga0439432_018382
897 Ga0439450_000289
898 Ga0439452_012134
899 Ga0439462_0011814
900 Ga0439463_049351
901 Ga0450888_005211
902 Ga0450905_015836
903 Ga0439458_0036830
904 Ga0439434_0003138
905 Ga0439464_0053663
906 Ga0439460_0019607
907 Ga0439460_0028323
908 Ga0453683_0152319
909 Ga0453684_0025592
910 Ga0451576_0005198
911 Ga0451576_0021687
912 Ga0451576_0060593
913 Ga0451576_0076318
914 Ga0451576_0101652
915 Ga0451576_0522823
916 Ga0451576_0577234
917 Ga0451576_0903461
918 Ga0495613_0541488
919 Ga0496106_0168144
920 Ga0496106_0641795
921 Ga0496112_0650879
922 Ga0501290_000059
923 Ga0501291_000488
924 Ga0501291_037816
925 Ga0501292_000129
926 Ga0501294_001147
927 Ga0501295_000527
928 Ga0501296_000322
929 Ga0501297_006586
930 Ga0501298_014650
931 Ga0501299_000048
932 Ga0501300_000939
933 Ga0501031_0000180
934 Ga0501031_0005414
935 Ga0501031_0021701
936 Ga0501036_0045620
937 Ga0501036_0113453
938 Ga0501036_0847867
939 Ga0501037_0317158
940 Ga0501038_0016430
941 Ga0501038_0483461
942 Ga0501039_0000834
943 Ga0501039_0000919
944 Ga0501039_0688762
945 Ga0501040_0003533
946 Ga0501040_0011021
947 Ga0501040_0036594
948 Ga0501041_0000481
949 Ga0501041_0229934
950 Ga0501042_0000164
951 Ga0501042_0031091
952 Ga0501042_0495586
953 Ga0501043_0048992
954 Ga0501046_0002388
955 Ga0501046_0003725
956 Ga0501046_0235579
957 Ga0501048_0001626
958 Ga0501048_0058909
959 Ga0501067_0050791
960 Ga0501068_0401912
961 Ga0501070_0009317
962 Ga0501071_0038595
963 Ga0501071_0051850
964 Ga0501071_0052916
965 Ga0501072_0440431
966 Ga0501075_0093869
967 Ga0501075_0105994
968 Ga0501075_0349573
969 Ga0501076_0020223
970 Ga0501076_0038758
971 Ga0501076_0150033
972 Ga0501076_0304192
973 Ga0501077_0025561
974 Ga0501077_0081064
975 Ga0501077_0428857
976 Ga0501201_002201
977 Ga0501202_002220
978 Ga0501207_002773
979 Ga0501216_026863
980 Ga0501217_006804
981 Ga0501227_054178
982 Ga0501228_000969
983 Ga0501230_003655
984 Ga0501233_001024
985 Ga0501235_005843
986 Ga0501236_002097
987 Ga0501239_002111
988 Ga0501243_001231
989 Ga0501246_000121
990 Ga0501249_005735
991 Ga0501251_000290
992 Ga0501251_010919
993 Ga0501252_003336
994 Ga0501258_000856
995 Ga0501261_024892
996 Ga0501219_001566
997 Ga0501221_002583
998 Ga0501225_0044852
999 Ga0501234_000290
1000 Ga0501245_002169
1001 Ga0501079_0012495
1002 Ga0501079_0019443
1003 Ga0501079_0061866
1004 Ga0501079_0335315
1005 Ga0501080_0085095
1006 Ga0501080_0263680
1007 Ga0501081_0108341
1008 Ga0501081_0170750
1009 Ga0501083_0055564
1010 Ga0501232_002905
1011 Ga0501263_032821
1012 Ga0501264_000674
1013 Ga0501265_000090
1014 Ga0501265_013488
1015 Ga0501266_001401
1016 Ga0501268_005185
1017 Ga0501270_003400
1018 Ga0501273_006029
1019 Ga0501275_001141
1020 Ga0501276_000898
1021 Ga0501279_005900
1022 Ga0501279_041955
1023 Ga0501283_004101
1024 Ga0501035_0003730
1025 Ga0501035_0020689
1026 Ga0501035_0048260
1027 Ga0501045_0409737
1028 Ga0501226_002731
1029 nmdc:mga05p37_35207_c1
1030 nmdc:mga05p37_358868_c1
1031 nmdc:mga05p37_384581_c1
1032 nmdc:mga05p37_592468_c1
1033 nmdc:mga05p37_7114_c1
1034 nmdc:mga09592_21121_c1
1035 nmdc:mga09592_57742_c1
1036 nmdc:mga0qj67_123910_c1
1037 nmdc:mga0qj67_324046_c1
1038 nmdc:mga0qj67_570435_c1
1039 nmdc:mga0qj67_59229_c1
1040 nmdc:mga0qj67_62613_c1
1041 nmdc:mga0qj67_7716_c1
1042 nmdc:mga06r32_12645_c1
1043 nmdc:mga06r32_170190_c1
1044 nmdc:mga06r32_31431_c1
1045 nmdc:mga06r32_541094_c1
1046 nmdc:mga06r32_629_c1
1047 nmdc:mga06r32_81312_c1
1048 nmdc:mga06r32_861914_c1
1049 nmdc:mga06r32_965086_c1
1050 nmdc:mga08y16_21330_c1
1051 nmdc:mga08y16_21638_c1
1052 nmdc:mga08y16_579686_c1
1053 nmdc:mga0n895_124385_c1
1054 nmdc:mga0n895_296077_c1
1055 nmdc:mga0n895_33678_c1
1056 nmdc:mga0n895_530764_c1
1057 nmdc:mga0n895_53286_c1
1058 nmdc:mga0rr50_11342_c1
1059 nmdc:mga0a205_6503_c1
1060 Ga0501084_0312913
1061 Ga0501082_0103840
1062 Ga0501082_0157448
1063 Ga0530510_0031102
1064 Ga0530510_0363815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

32

144

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

178

234

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

178

222

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.98 173 230
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.972 171 230
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9712 171 230
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9687 171 230
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9686 173 224
ID Description Score Start End Superfamily
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9686 173 224 1.10.10.10
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9613 20 138 3.40.50.2300
4tmyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9588 22 138 3.40.50.2300
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.958 173 229 1.10.10.10
3eulC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9574 22 139 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A5J4KWZ3-F1-model_v4 Response regulatory domain-containing protein 0.9728 18 115 GO:0000160
GO:0003677
AF-A0A4Y1ZA51-F1-model_v4 DNA-binding response regulator, LuxR family 0.9696 22 98 GO:0000160
GO:0003677
AF-A0A7S8FEZ6-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9673 21 138 GO:0000155
GO:0005524
GO:0016020
GO:0046983
AF-A0A701W0F1-F1-model_v4 Response regulator 0.9667 21 106 GO:0000160
GO:0003677
AF-A0A2M7A5F5-F1-model_v4 Two-component system response regulator 0.9647 48 139 GO:0000160

Map