F460320

General Info

Members Datasets Scaffolds Average Seq Length
532 281 1064 169

Family's Representative Sequence

Representative Sequence 3300046531|Ga0495665_0269206|Ga0495665_0269206_179_784
Length 201
Sequence MAGTIPEDLGETIRSARQIIINHKKKKKMKNVLQFDFIADKKKNTLTIRREFLAGRQLVWDCYTKRELLDRWFAPKPLTTKTKSMDFREGGHWHYAMVEPNGNEYWGWTEYRKIKPIDYYTTFDAFSNSEGEINKDMPRADWRVNFTDKGKNTLVETIVTYQSLSDLEKVIQMGMEQGMMATLEKLDELLLTIKAEELSTN

Samples

Sample ID Description Type Environment
1 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
23 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
24 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
25 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
26 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
29 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
30 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
39 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
40 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
85 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
90 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
105 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
106 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
153 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
231 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
232 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
237 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
238 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
239 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
240 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
241 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
242 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
243 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
244 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
245 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
248 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
249 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
250 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
251 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
254 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
255 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
257 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
258 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
259 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
260 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
261 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
262 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
263 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
264 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
265 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
266 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
267 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
268 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
269 2738543013 Variovorax sp. BT01 Isolate Unclassified
270 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
271 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
272 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
273 2842711865 Duganella sp. R-73148 Isolate Unclassified
274 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
275 2885266251 Ralstonia sp. SET104 Isolate Nodule
276 2928058823 Ralstonia sp. 1138 Isolate Unclassified
277 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
278 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
279 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
280 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
281 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.74
Metatranscriptomes 0.94
Isolates 4.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.51
Nodule 0.56
Rhizoplane 2.82
Rhizosphere 50.94
Stem 0
Stem Tuber 0
Unclassified 8.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495665_0269206 3300046531 Bacteria 875
2 JGI24740J21852_10000062 3300001979 Bacteria 34499
3 JGI24740J21852_10000068 3300001979 Bacteria 34079
4 JGI24739J22299_10019673 3300001989 Bacteria 2415
5 JGI24737J22298_10001993 3300001990 Bacteria 7298
6 JGI24735J21928_10000002 3300002067 Bacteria 624895
7 JGI25155J39150_1000039 3300002704 Bacteria 91670
8 JGI25156J39149_1000096 3300002705 Bacteria 64397
9 JGI25156J39149_1000605 3300002705 Bacteria 19928
10 JGI25156J39149_1009020 3300002705 Bacteria 2457
11 JGI25156J39149_1022615 3300002705 Bacteria 1064
12 JGI25162J39368_1000022 3300002737 Bacteria 239510
13 JGI25154J39366_1000077 3300002738 Bacteria 90455
14 JGI25154J39366_1002516 3300002738 Bacteria 4673
15 JGI25158J39367_1000006 3300002739 Bacteria 58790
16 JGI25157J39369_1000027 3300002741 Bacteria 147448
17 JGI25157J39369_1000065 3300002741 Bacteria 98536
18 JGI25152J39213_1000240 3300002773 Bacteria 36681
19 JGI25150J39212_1000170 3300002774 Bacteria 36653
20 JGI25159J45721_1000955 3300002987 Bacteria 12587
21 JGI25151J46595_10000109 3300003187 Bacteria 112044
22 JGI25153J46596_10000084 3300003215 Bacteria 112044
23 JGI25153J46596_10000384 3300003215 Bacteria 30265
24 JGI25153J46596_10011599 3300003215 Bacteria 3880
25 JGI25153J46596_10035547 3300003215 Bacteria 1612
26 rootH1_10029039 3300003316 Bacteria 16566
27 rootH1_10029241 3300003316 Bacteria 22966
28 rootH2_10138129 3300003320 Bacteria 3653
29 rootH2_10173933 3300003320 Bacteria 1063
30 rootH2_10285773 3300003320 Bacteria 1954
31 rootL2_10011108 3300003322 Bacteria 5247
32 rootL2_10031845 3300003322 Bacteria 4320
33 rootL2_10074573 3300003322 Bacteria 18789
34 rootL2_10094528 3300003322 Bacteria 1712
35 rootL2_10243958 3300003322 Bacteria 1578
36 rootL2_10358003 3300003322 Bacteria 1556
37 rootL2_10371739 3300003322 Unclassified 1634
38 rootH1_10005821 3300003323 Bacteria 129122
39 rootH1_10006108 3300003323 Bacteria 45232
40 rootH1_10064984 3300003323 Bacteria 4125
41 rootH1_10091093 3300003323 Bacteria 10113
42 rootH1_10099652 3300003323 Bacteria 1486
43 rootH1_10143664 3300003323 Bacteria 4069
44 rootH1_10225319 3300003323 Bacteria 4718
45 JGI25160J50197_1009273 3300003354 Bacteria 3668
46 JGI25161J50226_1000052 3300003374 Bacteria 107273
47 Ga0055538_1000010 3300003751 Bacteria 376599
48 Ga0055539_1000015 3300003752 Bacteria 376599
49 Ga0055539_1000081 3300003752 Bacteria 122891
50 Ga0055533_1000018 3300003756 Bacteria 376599
51 Ga0055533_1000131 3300003756 Bacteria 82822
52 Ga0055532_1000005 3300003758 Bacteria 458107
53 Ga0055532_1000048 3300003758 Bacteria 175560
54 Ga0055525_1000020 3300003759 Bacteria 376599
55 Ga0055525_1000527 3300003759 Bacteria 18442
56 Ga0055525_1001710 3300003759 Bacteria 3274
57 Ga0055527_1010497 3300003760 Bacteria 1068
58 Ga0055535_1000035 3300003761 Bacteria 175560
59 Ga0055535_1000183 3300003761 Bacteria 66520
60 Ga0055535_1002937 3300003761 Bacteria 5288
61 Ga0055535_1005431 3300003761 Bacteria 2796
62 Ga0055529_1000064 3300003763 Bacteria 178831
63 Ga0055529_1000079 3300003763 Bacteria 149370
64 Ga0055529_1000101 3300003763 Bacteria 130709
65 Ga0055529_1020913 3300003763 Bacteria 814
66 Ga0055526_1000424 3300003771 Bacteria 33964
67 Ga0055537_1000330 3300003773 Bacteria 32350
68 Ga0055524_1002724 3300003775 Bacteria 8922
69 Ga0055524_1009673 3300003775 Bacteria 3898
70 Ga0055536_1006526 3300003781 Bacteria 5421
71 Ga0055534_1000147 3300003784 Bacteria 52707
72 Ga0055534_1002631 3300003784 Bacteria 6099
73 Ga0055534_1022956 3300003784 Bacteria 1027
74 Ga0055528_1000364 3300003790 Bacteria 36795
75 Ga0055530_10000281 3300003791 Bacteria 46223
76 Ga0055530_10006402 3300003791 Bacteria 5272
77 Ga0055541_1000011 3300003841 Bacteria 376599
78 Ga0055541_1018067 3300003841 Bacteria 879
79 Ga0055543_1000038 3300004625 Bacteria 124032
80 Ga0058862_11507154 3300004803 Bacteria 655
81 Ga0065165_1000117 3300005262 Bacteria 134716
82 Ga0065165_1000857 3300005262 Bacteria 39843
83 Ga0065714_10068968 3300005288 Bacteria 4446
84 Ga0065715_10170229 3300005293 Bacteria 1553
85 Ga0070658_10558538 3300005327 Bacteria 991
86 Ga0070661_100000093 3300005344 Bacteria 73157
87 Ga0070668_100510837 3300005347 Bacteria 1041
88 Ga0070673_100005614 3300005364 Bacteria 8048
89 Ga0070714_100376145 3300005435 Bacteria 1338
90 Ga0070713_100026357 3300005436 Bacteria 4562
91 Ga0070663_100000024 3300005455 Bacteria 108544
92 Ga0070663_100059125 3300005455 Bacteria 2755
93 Ga0068853_100196931 3300005539 Bacteria 1832
94 Ga0068855_100006571 3300005563 Bacteria 14136
95 Ga0068855_100061784 3300005563 Bacteria 4376
96 Ga0068855_100610359 3300005563 Bacteria 1175
97 Ga0070664_100000022 3300005564 Bacteria 108544
98 Ga0068857_100000118 3300005577 Bacteria 47043
99 Ga0068857_100007706 3300005577 Bacteria 9279
100 Ga0068857_100296179 3300005577 Bacteria 1491
101 Ga0068854_100000088 3300005578 Bacteria 65455
102 Ga0068854_100054035 3300005578 Bacteria 2887
103 Ga0068854_100208120 3300005578 Unclassified 1541
104 Ga0068856_100000049 3300005614 Bacteria 108544
105 Ga0068856_100073627 3300005614 Bacteria 3382
106 Ga0068856_100174048 3300005614 Bacteria 2165
107 Ga0068856_100587045 3300005614 Bacteria 1135
108 Ga0068852_100043749 3300005616 Bacteria 3799
109 Ga0068852_100104990 3300005616 Bacteria 2558
110 Ga0068852_101240047 3300005616 Unclassified 767
111 Ga0068861_100153118 3300005719 Bacteria 1894
112 Ga0068851_10679665 3300005834 Bacteria 632
113 Ga0068863_101067987 3300005841 Bacteria 811
114 Ga0068860_100074666 3300005843 Bacteria 3224
115 Ga0068860_100162927 3300005843 Bacteria 2151
116 Ga0075366_10142893 3300006195 Bacteria 1447
117 Ga0097621_100115098 3300006237 Bacteria 2276
118 Ga0075370_10782410 3300006353 Bacteria 581
119 Ga0105244_10006928 3300009036 Bacteria 7266
120 Ga0105240_10157322 3300009093 Bacteria 2702
121 Ga0105240_10197747 3300009093 Bacteria 2358
122 Ga0105240_10286904 3300009093 Bacteria 1889
123 Ga0105240_10639706 3300009093 Bacteria 1167
124 Ga0105240_11029541 3300009093 Unclassified 879
125 Ga0105248_10254867 3300009177 Bacteria 1975
126 Ga0105248_11886564 3300009177 Bacteria 678
127 Ga0105237_10002188 3300009545 Bacteria 24484
128 Ga0105237_10008413 3300009545 Bacteria 11176
129 Ga0105237_10041872 3300009545 Bacteria 4618
130 Ga0105237_10091278 3300009545 Bacteria 3035
131 Ga0105237_10141965 3300009545 Bacteria 2396
132 Ga0105238_10012222 3300009551 Bacteria 8657
133 Ga0105238_10024113 3300009551 Bacteria 6202
134 Ga0105238_10124023 3300009551 Bacteria 2562
135 Ga0105238_10231416 3300009551 Bacteria 1825
136 Ga0105238_10696729 3300009551 Unclassified 1028
137 Ga0105249_11050826 3300009553 Bacteria 884
138 Ga0105239_10012650 3300010375 Bacteria 9390
139 Ga0105239_10012782 3300010375 Bacteria 9339
140 Ga0105239_10019626 3300010375 Bacteria 7462
141 Ga0105239_10254117 3300010375 Bacteria 1974
142 Ga0105239_10434765 3300010375 Unclassified 1488
143 Ga0105239_11381870 3300010375 Bacteria 813
144 Ga0157373_10006107 3300013100 Bacteria 9005
145 Ga0157373_10308273 3300013100 Bacteria 1125
146 Ga0157371_10000089 3300013102 Bacteria 145483
147 Ga0157370_10000002 3300013104 Bacteria 431400
148 Ga0157370_10008088 3300013104 Bacteria 11385
149 Ga0157370_10034396 3300013104 Bacteria 4936
150 Ga0157370_10501356 3300013104 Bacteria 1115
151 Ga0157369_10005069 3300013105 Bacteria 15412
152 Ga0157369_10101180 3300013105 Bacteria 3072
153 Ga0157369_10243364 3300013105 Bacteria 1878
154 Ga0157369_10894739 3300013105 Bacteria 910
155 Ga0157374_10113027 3300013296 Bacteria 2614
156 Ga0157374_10411884 3300013296 Bacteria 1349
157 Ga0163162_10038580 3300013306 Bacteria 4767
158 Ga0163162_10107897 3300013306 Bacteria 2880
159 Ga0163162_10910816 3300013306 Bacteria 992
160 Ga0157372_10000363 3300013307 Bacteria 50093
161 Ga0157372_10623937 3300013307 Bacteria 1256
162 Ga0182008_10000008 3300014497 Bacteria 371823
163 Ga0182008_10000972 3300014497 Bacteria 19898
164 Ga0182008_10132228 3300014497 Unclassified 1244
165 Ga0182008_10431124 3300014497 Bacteria 713
166 Ga0157379_10057987 3300014968 Bacteria 3461
167 Ga0182006_1000897 3300015261 Bacteria 19959
168 Ga0182006_1004679 3300015261 Bacteria 6701
169 Ga0182006_1005509 3300015261 Bacteria 6016
170 Ga0182007_10021484 3300015262 Bacteria 2292
171 Ga0182007_10185297 3300015262 Bacteria 721
172 Ga0163161_10005762 3300017792 Bacteria 8587
173 Ga0206355_1336479 3300020076 Bacteria 1133
174 Ga0206351_10029301 3300020077 Bacteria 3643
175 Ga0154015_1150051 3300020610 Bacteria 8173
176 Ga0213872_10000398 3300021361 Bacteria 36154
177 Ga0213872_10108643 3300021361 Bacteria 1233
178 Ga0224712_10179304 3300022467 Bacteria 954
179 Ga0209435_100043 3300025206 Bacteria 102049
180 Ga0209435_100050 3300025206 Bacteria 91356
181 Ga0209436_100033 3300025208 Bacteria 80428
182 Ga0209784_100024 3300025224 Bacteria 394613
183 Ga0209784_100025 3300025224 Bacteria 376681
184 Ga0209784_101058 3300025224 Bacteria 4716
185 Ga0209566_100018 3300025225 Bacteria 448638
186 Ga0209566_100025 3300025225 Bacteria 376681
187 Ga0209566_101160 3300025225 Bacteria 9647
188 Ga0209674_100042 3300025226 Bacteria 376681
189 Ga0209674_100046 3300025226 Bacteria 357920
190 Ga0209674_100169 3300025226 Bacteria 82874
191 Ga0209674_104270 3300025226 Bacteria 2361
192 Ga0209672_100127 3300025228 Bacteria 78095
193 Ga0209672_103260 3300025228 Bacteria 3439
194 Ga0209147_100008 3300025229 Bacteria 777096
195 Ga0209147_100011 3300025229 Bacteria 702140
196 Ga0209563_100039 3300025230 Bacteria 409717
197 Ga0209563_100046 3300025230 Bacteria 376681
198 Ga0209563_100090 3300025230 Bacteria 169322
199 Ga0209563_100139 3300025230 Bacteria 82846
200 Ga0209563_110787 3300025230 Bacteria 1316
201 Ga0209437_100024 3300025233 Bacteria 592878
202 Ga0209258_100013 3300025242 Bacteria 777096
203 Ga0209258_100124 3300025242 Bacteria 178883
204 Ga0209258_100359 3300025242 Bacteria 61630
205 Ga0209258_100385 3300025242 Bacteria 56396
206 Ga0207425_1000455 3300025245 Bacteria 26503
207 Ga0209646_1000005 3300025246 Bacteria 717627
208 Ga0209646_1000161 3300025246 Bacteria 91356
209 Ga0209646_1000196 3300025246 Bacteria 72959
210 Ga0209026_1000011 3300025250 Bacteria 507291
211 Ga0209026_1000173 3300025250 Bacteria 98585
212 Ga0209026_1000232 3300025250 Bacteria 75219
213 Ga0209677_100024 3300025253 Bacteria 406035
214 Ga0209677_100027 3300025253 Bacteria 376681
215 Ga0209677_100115 3300025253 Bacteria 82874
216 Ga0209677_100237 3300025253 Bacteria 38817
217 Ga0209148_1001103 3300025254 Bacteria 16204
218 Ga0209148_1002698 3300025254 Bacteria 5673
219 Ga0209148_1012337 3300025254 Bacteria 1565
220 Ga0209148_1019567 3300025254 Bacteria 1122
221 Ga0209759_1000107 3300025256 Bacteria 147025
222 Ga0209759_1000169 3300025256 Bacteria 110110
223 Ga0209759_1000980 3300025256 Bacteria 19760
224 Ga0209759_1001128 3300025256 Bacteria 17161
225 Ga0209759_1003995 3300025256 Bacteria 5652
226 Ga0209759_1026711 3300025256 Bacteria 1205
227 Ga0209129_1000202 3300025258 Bacteria 72795
228 Ga0209129_1021343 3300025258 Bacteria 1189
229 Ga0209565_1000003 3300025263 Bacteria 1099648
230 Ga0209565_1007334 3300025263 Bacteria 2983
231 Ga0209455_1000042 3300025272 Bacteria 419638
232 Ga0209455_1000070 3300025272 Bacteria 307867
233 Ga0209455_1000114 3300025272 Bacteria 178883
234 Ga0209455_1001110 3300025272 Bacteria 13190
235 Ga0209455_1005365 3300025272 Bacteria 3979
236 Ga0209673_1000017 3300025273 Bacteria 492994
237 Ga0209673_1076779 3300025273 Bacteria 777
238 Ga0209130_1000059 3300025284 Bacteria 204772
239 Ga0209675_1000053 3300025291 Bacteria 194511
240 Ga0209675_1000119 3300025291 Bacteria 110218
241 Ga0209675_1017688 3300025291 Bacteria 2027
242 Ga0209675_1046786 3300025291 Unclassified 913
243 Ga0209676_1001375 3300025292 Bacteria 23746
244 Ga0209025_1000013 3300025294 Bacteria 871757
245 Ga0209564_1000011 3300025295 Bacteria 822327
246 Ga0209564_1000016 3300025295 Bacteria 613131
247 Ga0209564_1000199 3300025295 Bacteria 138027
248 Ga0209758_1000014 3300025297 Bacteria 871757
249 Ga0209758_1000126 3300025297 Bacteria 189761
250 Ga0209758_1000286 3300025297 Bacteria 99636
251 Ga0209758_1000904 3300025297 Bacteria 40285
252 Ga0209050_1000089 3300025298 Bacteria 256212
253 Ga0209050_1000335 3300025298 Bacteria 93521
254 Ga0209050_1004379 3300025298 Bacteria 9587
255 Ga0209050_1031534 3300025298 Unclassified 1650
256 Ga0209256_1000130 3300025299 Bacteria 163227
257 Ga0209256_1000210 3300025299 Bacteria 110217
258 Ga0209256_1000334 3300025299 Bacteria 78875
259 Ga0207426_1000600 3300025302 Bacteria 47121
260 Ga0209051_1029287 3300025303 Bacteria 2157
261 Ga0207655_1016247 3300025728 Bacteria 4083
262 Ga0207647_10035844 3300025904 Bacteria 3158
263 Ga0207654_10074617 3300025911 Bacteria 2025
264 Ga0207695_10000739 3300025913 Bacteria 63264
265 Ga0207695_10112686 3300025913 Bacteria 2697
266 Ga0207695_10150260 3300025913 Bacteria 2269
267 Ga0207695_10936049 3300025913 Unclassified 746
268 Ga0207671_10001393 3300025914 Bacteria 28100
269 Ga0207671_10016887 3300025914 Bacteria 5651
270 Ga0207671_10156557 3300025914 Bacteria 1763
271 Ga0207694_10004117 3300025924 Bacteria 11421
272 Ga0207694_10104777 3300025924 Bacteria 2245
273 Ga0207694_10356371 3300025924 Bacteria 1212
274 Ga0207664_10399727 3300025929 Bacteria 1222
275 Ga0207679_10000004 3300025945 Bacteria 589021
276 Ga0207667_10005343 3300025949 Bacteria 15657
277 Ga0207667_10382088 3300025949 Bacteria 1435
278 Ga0207667_10397092 3300025949 Bacteria 1404
279 Ga0207667_10507188 3300025949 Unclassified 1223
280 Ga0207667_10676481 3300025949 Bacteria 1036
281 Ga0207651_10007144 3300025960 Bacteria 5933
282 Ga0207668_10487383 3300025972 Bacteria 1058
283 Ga0207640_10000058 3300025981 Bacteria 92862
284 Ga0207640_10134819 3300025981 Bacteria 1791
285 Ga0207640_10222251 3300025981 Bacteria 1447
286 Ga0207639_10114036 3300026041 Bacteria 2208
287 Ga0207639_10130457 3300026041 Bacteria 2080
288 Ga0207678_10000012 3300026067 Bacteria 145324
289 Ga0207678_10066631 3300026067 Bacteria 3092
290 Ga0207702_10000020 3300026078 Bacteria 203299
291 Ga0207702_10054225 3300026078 Bacteria 3397
292 Ga0207702_10058881 3300026078 Bacteria 3270
293 Ga0207702_10668656 3300026078 Bacteria 1022
294 Ga0207641_10992841 3300026088 Bacteria 836
295 Ga0207674_10003295 3300026116 Bacteria 19862
296 Ga0207674_10075982 3300026116 Bacteria 3368
297 Ga0207674_10252536 3300026116 Bacteria 1710
298 Ga0207698_10054581 3300026142 Bacteria 3075
299 Ga0207698_10226228 3300026142 Bacteria 1695
300 Ga0207698_11132655 3300026142 Bacteria 796
301 Ga0268265_10019681 3300028380 Bacteria 4699
302 Ga0268264_10988329 3300028381 Unclassified 848
303 Ga0307509_10324494 3300031507 Bacteria 1274
304 Ga0307509_10695067 3300031507 Unclassified 684
305 Ga0307414_10260193 3300032004 Unclassified 1448
306 Ga0307415_100357563 3300032126 Bacteria 1232
307 Ga0307510_10015870 3300033180 Bacteria 8901
308 Ga0316574_0272107 3300035398 Bacteria 1080
309 Ga0373933_0286663 3300035724 Bacteria 1065
310 Ga0373937_0338937 3300036401 Bacteria 1424
311 Ga0395899_0001549 3300037312 Bacteria 19405
312 Ga0395899_0210658 3300037312 Bacteria 1350
313 Ga0395899_0478388 3300037312 Bacteria 811
314 Ga0395900_0006841 3300037418 Bacteria 11830
315 Ga0395900_0048618 3300037418 Bacteria 4369
316 Ga0395900_0236248 3300037418 Bacteria 1836
317 Ga0395898_0118478 3300037466 Bacteria 2536
318 Ga0395905_0187978 3300037471 Bacteria 1938
319 Ga0395905_0224928 3300037471 Bacteria 1756
320 Ga0395905_0251100 3300037471 Bacteria 1652
321 Ga0395905_0315222 3300037471 Unclassified 1453
322 Ga0395905_0392772 3300037471 Bacteria 1282
323 Ga0395905_1359574 3300037471 Bacteria 614
324 Ga0395901_0163503 3300038443 Bacteria 2337
325 Ga0395901_0291100 3300038443 Bacteria 1695
326 Ga0395901_0413451 3300038443 Bacteria 1384
327 Ga0395901_1650079 3300038443 Bacteria 593
328 Ga0436361_0139067 3300039447 Bacteria 3043
329 Ga0436361_0412777 3300039447 Bacteria 687
330 Ga0436361_0699546 3300039447 Bacteria 1345
331 Ga0436361_1034323 3300039447 Bacteria 7786
332 Ga0451791_1866294 3300041451 Bacteria 829
333 Ga0451798_1003930 3300041458 Bacteria 1096
334 Ga0451807_0893005 3300041486 Bacteria 2178
335 Ga0451853_1584401 3300041512 Bacteria 1198
336 Ga0466969_0273919 3300044656 Unclassified 764
337 Ga0466966_0045731 3300044684 Bacteria 2797
338 Ga0466964_0321704 3300044706 Bacteria 786
339 Ga0466968_0001716 3300044735 Bacteria 7903
340 Ga0466957_0029549 3300044842 Bacteria 3269
341 Ga0466957_0277771 3300044842 Bacteria 1120
342 Ga0495590_0000001 3300046457 Bacteria 762984
343 Ga0495629_0212089 3300046459 Bacteria 1337
344 Ga0495638_0000102 3300046460 Bacteria 137013
345 Ga0495650_0000137 3300046471 Bacteria 171680
346 Ga0495650_0000138 3300046471 Bacteria 171220
347 Ga0495650_0001979 3300046471 Bacteria 18008
348 Ga0495639_0009293 3300046475 Bacteria 4214
349 Ga0495639_0067547 3300046475 Bacteria 1647
350 Ga0495639_0293649 3300046475 Unclassified 809
351 Ga0495585_0000128 3300046492 Bacteria 82002
352 Ga0495585_0151441 3300046492 Unclassified 1209
353 Ga0495607_0024006 3300046501 Bacteria 3807
354 Ga0495583_0000186 3300046506 Bacteria 105198
355 Ga0495606_0000001 3300046507 Bacteria 592123
356 Ga0495606_0000002 3300046507 Bacteria 554637
357 Ga0495606_0005390 3300046507 Bacteria 12265
358 Ga0495606_0016821 3300046507 Bacteria 5557
359 Ga0495606_0055132 3300046507 Bacteria 2572
360 Ga0495606_0279588 3300046507 Bacteria 913
361 Ga0495608_0348799 3300046511 Bacteria 911
362 Ga0495610_0003621 3300046512 Bacteria 11909
363 Ga0495610_0005408 3300046512 Bacteria 9094
364 Ga0495610_0006895 3300046512 Bacteria 7695
365 Ga0495610_0007187 3300046512 Bacteria 7487
366 Ga0495616_0004530 3300046513 Bacteria 8749
367 Ga0495618_0286698 3300046514 Unclassified 1026
368 Ga0495628_0378601 3300046516 Unclassified 1037
369 Ga0495637_0121628 3300046520 Bacteria 1003
370 Ga0495643_0000137 3300046522 Bacteria 117968
371 Ga0495648_0000001 3300046524 Bacteria 696872
372 Ga0495648_0014199 3300046524 Bacteria 5843
373 Ga0495648_0021583 3300046524 Bacteria 4455
374 Ga0495666_0262266 3300046526 Unclassified 786
375 Ga0495642_0005754 3300046528 Bacteria 4755
376 Ga0495652_0098856 3300046529 Bacteria 2371
377 Ga0495652_0526193 3300046529 Bacteria 816
378 Ga0495586_0356595 3300046535 Unclassified 840
379 Ga0495587_0126555 3300046536 Bacteria 1462
380 Ga0495609_0011494 3300046538 Bacteria 4216
381 Ga0495609_0039623 3300046538 Bacteria 2120
382 Ga0495622_0000152 3300046557 Bacteria 59373
383 Ga0495622_0054532 3300046557 Unclassified 1855
384 Ga0495633_0000096 3300046558 Bacteria 118933
385 Ga0495633_0003857 3300046558 Bacteria 9801
386 Ga0495633_0006583 3300046558 Bacteria 6865
387 Ga0495633_0014264 3300046558 Bacteria 4161
388 Ga0495667_0400835 3300046559 Unclassified 864
389 Ga0495667_0861818 3300046559 Bacteria 557
390 Ga0495668_0000151 3300046616 Bacteria 105466
391 Ga0495668_0000241 3300046616 Bacteria 78040
392 Ga0495668_0513964 3300046616 Unclassified 660
393 Ga0495634_0315277 3300046642 Bacteria 943
394 Ga0495625_0000005 3300046660 Bacteria 596135
395 Ga0495625_0000065 3300046660 Bacteria 173230
396 Ga0495625_0002959 3300046660 Bacteria 17676
397 Ga0495625_0032012 3300046660 Bacteria 3906
398 Ga0495625_0224015 3300046660 Bacteria 1231
399 Ga0495635_0081065 3300046663 Bacteria 2221
400 Ga0495661_0002667 3300046665 Bacteria 13658
401 Ga0495588_0121700 3300046674 Unclassified 1375
402 Ga0495657_0225383 3300046675 Unclassified 1135
403 Ga0495599_0098086 3300046678 Bacteria 1827
404 Ga0495647_0274115 3300046681 Unclassified 756
405 Ga0495658_0082169 3300046683 Bacteria 1893
406 Ga0495658_0180258 3300046683 Unclassified 1310
407 Ga0495613_0264638 3300046689 Unclassified 1197
408 Ga0495624_0119441 3300046690 Unclassified 1619
409 Ga0495670_0087197 3300046691 Bacteria 1595
410 Ga0495670_0190634 3300046691 Bacteria 1084
411 Ga0495671_0054076 3300046692 Bacteria 1991
412 Ga0495649_0000003 3300046694 Bacteria 880817
413 Ga0495649_0017448 3300046694 Bacteria 4049
414 Ga0495660_0013872 3300046810 Bacteria 4671
415 Ga0495660_0014896 3300046810 Bacteria 4497
416 Ga0495581_0122177 3300047315 Unclassified 1516
417 Ga0495604_0202020 3300047317 Bacteria 1378
418 Ga0495672_0002335 3300047320 Bacteria 17574
419 Ga0495676_0000324 3300047321 Bacteria 38811
420 Ga0495683_0215403 3300047323 Bacteria 859
421 Ga0495687_155930 3300047443 Bacteria 774
422 Ga0495686_0000402 3300047472 Bacteria 68501
423 Ga0495686_0019273 3300047472 Bacteria 4561
424 Ga0495593_0009368 3300047673 Bacteria 5682
425 Ga0495593_0049769 3300047673 Unclassified 2222
426 Ga0495602_0736586 3300048088 Unclassified 666
427 Ga0495614_0026681 3300048089 Bacteria 2490
428 Ga0496101_0730436 3300048904 Bacteria 782
429 Ga0496102_0009914 3300048905 Bacteria 8194
430 Ga0496102_0376321 3300048905 Bacteria 1336
431 Ga0496103_0202887 3300048906 Bacteria 1275
432 Ga0496103_0276026 3300048906 Bacteria 1081
433 Ga0496104_0556801 3300048907 Bacteria 1057
434 Ga0496105_0606408 3300048908 Bacteria 849
435 Ga0496113_0233615 3300048916 Bacteria 1466
436 Ga0496113_0360501 3300048916 Bacteria 1166
437 Ga0496115_0093019 3300048918 Unclassified 2465
438 Ga0496116_0000006 3300048919 Bacteria 811937
439 Ga0496116_0101298 3300048919 Bacteria 1720
440 Ga0496117_0000027 3300048920 Bacteria 412234
441 Ga0496118_0000141 3300048921 Bacteria 126552
442 Ga0496118_0036813 3300048921 Bacteria 3950
443 Ga0496119_0000006 3300048922 Bacteria 505999
444 Ga0496119_0233441 3300048922 Bacteria 935
445 Ga0496121_0218618 3300048924 Bacteria 1344
446 Ga0496122_0000391 3300048925 Bacteria 93479
447 Ga0496122_0001741 3300048925 Bacteria 33738
448 Ga0496122_0002084 3300048925 Bacteria 29646
449 Ga0496122_0008848 3300048925 Bacteria 10743
450 Ga0496123_0001461 3300048926 Bacteria 32867
451 Ga0496123_0011250 3300048926 Bacteria 7780
452 Ga0496123_0277573 3300048926 Bacteria 812
453 Ga0496124_0017492 3300048927 Bacteria 6752
454 Ga0496124_0018315 3300048927 Bacteria 6561
455 Ga0496125_0000256 3300048928 Bacteria 109696
456 Ga0496125_0001989 3300048928 Bacteria 27733
457 Ga0496125_0002001 3300048928 Bacteria 27630
458 Ga0496125_0002112 3300048928 Bacteria 26704
459 Ga0496125_0029245 3300048928 Bacteria 4956
460 Ga0496125_0106071 3300048928 Bacteria 2052
461 Ga0496125_0154894 3300048928 Bacteria 1567
462 Ga0496126_0039136 3300048929 Bacteria 4403
463 Ga0496126_0189370 3300048929 Bacteria 1743
464 Ga0495678_001729 3300049459 Bacteria 16278
465 Ga0495678_006395 3300049459 Bacteria 6274
466 Ga0495678_080107 3300049459 Bacteria 1174
467 Ga0495682_0064469 3300049460 Bacteria 1321
468 Ga0501217_143805 3300049661 Bacteria 708
469 Ga0501044_0993469 3300049823 Bacteria 711
470 nmdc:mga0k408_145547_c1 3300050493 Bacteria 1410
471 nmdc:mga0k408_292290_c1 3300050493 Bacteria 972
472 nmdc:mga0k408_300585_c1 3300050493 Bacteria 958
473 nmdc:mga07m45_350364_c1 3300050496 Bacteria 858
474 Ga0500578_0000244 3300053086 Bacteria 67335
475 Ga0500578_0035158 3300053086 Bacteria 3220
476 Ga0500566_0405443 3300053094 Unclassified 609
477 Ga0500562_019852 3300053108 Bacteria 1742
478 Ga0500562_100650 3300053108 Unclassified 787
479 Ga0500571_000094 3300053110 Bacteria 28973
480 Ga0500597_057611 3300053120 Unclassified 1665
481 Ga0500608_012634 3300053122 Bacteria 3710
482 Ga0500608_085507 3300053122 Unclassified 1482
483 Ga0500618_014478 3300053125 Bacteria 2012
484 Ga0500623_038459 3300053127 Bacteria 2453
485 Ga0500652_019841 3300053131 Bacteria 2505
486 Ga0500652_104680 3300053131 Unclassified 1183
487 Ga0500655_000060 3300053133 Bacteria 30372
488 Ga0500559_0163515 3300053136 Bacteria 1046
489 Ga0500559_0267771 3300053136 Bacteria 804
490 Ga0500568_0010694 3300053139 Bacteria 4286
491 Ga0500586_001546 3300053145 Bacteria 4890
492 Ga0500588_0028674 3300053146 Bacteria 1580
493 Ga0500590_037210 3300053148 Bacteria 2516
494 Ga0500590_115327 3300053148 Bacteria 1268
495 Ga0500604_0002004 3300053151 Bacteria 5637
496 Ga0500604_0010405 3300053151 Bacteria 2489
497 Ga0500616_0212596 3300053153 Bacteria 849
498 Ga0500622_0000015 3300053156 Bacteria 346227
499 Ga0500622_0000022 3300053156 Bacteria 267246
500 Ga0500622_0001421 3300053156 Bacteria 19275
501 Ga0500622_0011232 3300053156 Bacteria 4888
502 Ga0500622_0028521 3300053156 Bacteria 2939
503 Ga0500627_0144154 3300053158 Bacteria 1076
504 Ga0500638_001711 3300053162 Bacteria 7144
505 Ga0500636_0124709 3300053177 Unclassified 1441
506 Ga0500636_0185173 3300053177 Unclassified 1114
507 Ga0500637_0040337 3300053178 Bacteria 2637
508 Ga0500637_0344319 3300053178 Bacteria 796
509 Ga0500565_001698 3300053734 Unclassified 1532
510 2550694952 2548876994 Bacteria 4904866
511 2587727563 2585428057 Bacteria 6737412
512 2588210294 2585428182 Bacteria 5007281
513 2588223084 2585428185 Bacteria 4969476
514 2597028029 2596583598 Bacteria 5251611
515 2599444701 2599185178 Bacteria 5365746
516 2599478700 2599185184 Bacteria 6430550
517 2643967888 2643221592 Bacteria 6608788
518 2644143212 2643221625 Bacteria 6512927
519 2644271700 2643221648 Bacteria 6521465
520 2739252098 2738543013 Bacteria 5618633
521 2776263878 2775506901 Bacteria 9631051
522 2819594591 2818991445 Bacteria 4955017
523 2819680633 2818991460 Bacteria 7595395
524 2842715918 2842711865 Bacteria 7155354
525 2871724098 2871720351 Bacteria 4862476
526 2885266372 2885266251 Bacteria 4796748
527 2928059839 2928058823 Bacteria 5520022
528 2928080243 2928078545 Bacteria 6534839
529 2928149585 2928147474 Bacteria 6512076
530 2929924042 2929921140 Bacteria 8649150
531 2932083415 2932082852 Bacteria 6563563
532 8003152489 8003151029 Bacteria 8187759
533 Ga0495665_0269206
534 JGI24740J21852_10000062
535 JGI24740J21852_10000068
536 JGI24739J22299_10019673
537 JGI24737J22298_10001993
538 JGI24735J21928_10000002
539 JGI25155J39150_1000039
540 JGI25156J39149_1000096
541 JGI25156J39149_1000605
542 JGI25156J39149_1009020
543 JGI25156J39149_1022615
544 JGI25162J39368_1000022
545 JGI25154J39366_1000077
546 JGI25154J39366_1002516
547 JGI25158J39367_1000006
548 JGI25157J39369_1000027
549 JGI25157J39369_1000065
550 JGI25152J39213_1000240
551 JGI25150J39212_1000170
552 JGI25159J45721_1000955
553 JGI25151J46595_10000109
554 JGI25153J46596_10000084
555 JGI25153J46596_10000384
556 JGI25153J46596_10011599
557 JGI25153J46596_10035547
558 rootH1_10029039
559 rootH1_10029241
560 rootH2_10138129
561 rootH2_10173933
562 rootH2_10285773
563 rootL2_10011108
564 rootL2_10031845
565 rootL2_10074573
566 rootL2_10094528
567 rootL2_10243958
568 rootL2_10358003
569 rootL2_10371739
570 rootH1_10005821
571 rootH1_10006108
572 rootH1_10064984
573 rootH1_10091093
574 rootH1_10099652
575 rootH1_10143664
576 rootH1_10225319
577 JGI25160J50197_1009273
578 JGI25161J50226_1000052
579 Ga0055538_1000010
580 Ga0055539_1000015
581 Ga0055539_1000081
582 Ga0055533_1000018
583 Ga0055533_1000131
584 Ga0055532_1000005
585 Ga0055532_1000048
586 Ga0055525_1000020
587 Ga0055525_1000527
588 Ga0055525_1001710
589 Ga0055527_1010497
590 Ga0055535_1000035
591 Ga0055535_1000183
592 Ga0055535_1002937
593 Ga0055535_1005431
594 Ga0055529_1000064
595 Ga0055529_1000079
596 Ga0055529_1000101
597 Ga0055529_1020913
598 Ga0055526_1000424
599 Ga0055537_1000330
600 Ga0055524_1002724
601 Ga0055524_1009673
602 Ga0055536_1006526
603 Ga0055534_1000147
604 Ga0055534_1002631
605 Ga0055534_1022956
606 Ga0055528_1000364
607 Ga0055530_10000281
608 Ga0055530_10006402
609 Ga0055541_1000011
610 Ga0055541_1018067
611 Ga0055543_1000038
612 Ga0058862_11507154
613 Ga0065165_1000117
614 Ga0065165_1000857
615 Ga0065714_10068968
616 Ga0065715_10170229
617 Ga0070658_10558538
618 Ga0070661_100000093
619 Ga0070668_100510837
620 Ga0070673_100005614
621 Ga0070714_100376145
622 Ga0070713_100026357
623 Ga0070663_100000024
624 Ga0070663_100059125
625 Ga0068853_100196931
626 Ga0068855_100006571
627 Ga0068855_100061784
628 Ga0068855_100610359
629 Ga0070664_100000022
630 Ga0068857_100000118
631 Ga0068857_100007706
632 Ga0068857_100296179
633 Ga0068854_100000088
634 Ga0068854_100054035
635 Ga0068854_100208120
636 Ga0068856_100000049
637 Ga0068856_100073627
638 Ga0068856_100174048
639 Ga0068856_100587045
640 Ga0068852_100043749
641 Ga0068852_100104990
642 Ga0068852_101240047
643 Ga0068861_100153118
644 Ga0068851_10679665
645 Ga0068863_101067987
646 Ga0068860_100074666
647 Ga0068860_100162927
648 Ga0075366_10142893
649 Ga0097621_100115098
650 Ga0075370_10782410
651 Ga0105244_10006928
652 Ga0105240_10157322
653 Ga0105240_10197747
654 Ga0105240_10286904
655 Ga0105240_10639706
656 Ga0105240_11029541
657 Ga0105248_10254867
658 Ga0105248_11886564
659 Ga0105237_10002188
660 Ga0105237_10008413
661 Ga0105237_10041872
662 Ga0105237_10091278
663 Ga0105237_10141965
664 Ga0105238_10012222
665 Ga0105238_10024113
666 Ga0105238_10124023
667 Ga0105238_10231416
668 Ga0105238_10696729
669 Ga0105249_11050826
670 Ga0105239_10012650
671 Ga0105239_10012782
672 Ga0105239_10019626
673 Ga0105239_10254117
674 Ga0105239_10434765
675 Ga0105239_11381870
676 Ga0157373_10006107
677 Ga0157373_10308273
678 Ga0157371_10000089
679 Ga0157370_10000002
680 Ga0157370_10008088
681 Ga0157370_10034396
682 Ga0157370_10501356
683 Ga0157369_10005069
684 Ga0157369_10101180
685 Ga0157369_10243364
686 Ga0157369_10894739
687 Ga0157374_10113027
688 Ga0157374_10411884
689 Ga0163162_10038580
690 Ga0163162_10107897
691 Ga0163162_10910816
692 Ga0157372_10000363
693 Ga0157372_10623937
694 Ga0182008_10000008
695 Ga0182008_10000972
696 Ga0182008_10132228
697 Ga0182008_10431124
698 Ga0157379_10057987
699 Ga0182006_1000897
700 Ga0182006_1004679
701 Ga0182006_1005509
702 Ga0182007_10021484
703 Ga0182007_10185297
704 Ga0163161_10005762
705 Ga0206355_1336479
706 Ga0206351_10029301
707 Ga0154015_1150051
708 Ga0213872_10000398
709 Ga0213872_10108643
710 Ga0224712_10179304
711 Ga0209435_100043
712 Ga0209435_100050
713 Ga0209436_100033
714 Ga0209784_100024
715 Ga0209784_100025
716 Ga0209784_101058
717 Ga0209566_100018
718 Ga0209566_100025
719 Ga0209566_101160
720 Ga0209674_100042
721 Ga0209674_100046
722 Ga0209674_100169
723 Ga0209674_104270
724 Ga0209672_100127
725 Ga0209672_103260
726 Ga0209147_100008
727 Ga0209147_100011
728 Ga0209563_100039
729 Ga0209563_100046
730 Ga0209563_100090
731 Ga0209563_100139
732 Ga0209563_110787
733 Ga0209437_100024
734 Ga0209258_100013
735 Ga0209258_100124
736 Ga0209258_100359
737 Ga0209258_100385
738 Ga0207425_1000455
739 Ga0209646_1000005
740 Ga0209646_1000161
741 Ga0209646_1000196
742 Ga0209026_1000011
743 Ga0209026_1000173
744 Ga0209026_1000232
745 Ga0209677_100024
746 Ga0209677_100027
747 Ga0209677_100115
748 Ga0209677_100237
749 Ga0209148_1001103
750 Ga0209148_1002698
751 Ga0209148_1012337
752 Ga0209148_1019567
753 Ga0209759_1000107
754 Ga0209759_1000169
755 Ga0209759_1000980
756 Ga0209759_1001128
757 Ga0209759_1003995
758 Ga0209759_1026711
759 Ga0209129_1000202
760 Ga0209129_1021343
761 Ga0209565_1000003
762 Ga0209565_1007334
763 Ga0209455_1000042
764 Ga0209455_1000070
765 Ga0209455_1000114
766 Ga0209455_1001110
767 Ga0209455_1005365
768 Ga0209673_1000017
769 Ga0209673_1076779
770 Ga0209130_1000059
771 Ga0209675_1000053
772 Ga0209675_1000119
773 Ga0209675_1017688
774 Ga0209675_1046786
775 Ga0209676_1001375
776 Ga0209025_1000013
777 Ga0209564_1000011
778 Ga0209564_1000016
779 Ga0209564_1000199
780 Ga0209758_1000014
781 Ga0209758_1000126
782 Ga0209758_1000286
783 Ga0209758_1000904
784 Ga0209050_1000089
785 Ga0209050_1000335
786 Ga0209050_1004379
787 Ga0209050_1031534
788 Ga0209256_1000130
789 Ga0209256_1000210
790 Ga0209256_1000334
791 Ga0207426_1000600
792 Ga0209051_1029287
793 Ga0207655_1016247
794 Ga0207647_10035844
795 Ga0207654_10074617
796 Ga0207695_10000739
797 Ga0207695_10112686
798 Ga0207695_10150260
799 Ga0207695_10936049
800 Ga0207671_10001393
801 Ga0207671_10016887
802 Ga0207671_10156557
803 Ga0207694_10004117
804 Ga0207694_10104777
805 Ga0207694_10356371
806 Ga0207664_10399727
807 Ga0207679_10000004
808 Ga0207667_10005343
809 Ga0207667_10382088
810 Ga0207667_10397092
811 Ga0207667_10507188
812 Ga0207667_10676481
813 Ga0207651_10007144
814 Ga0207668_10487383
815 Ga0207640_10000058
816 Ga0207640_10134819
817 Ga0207640_10222251
818 Ga0207639_10114036
819 Ga0207639_10130457
820 Ga0207678_10000012
821 Ga0207678_10066631
822 Ga0207702_10000020
823 Ga0207702_10054225
824 Ga0207702_10058881
825 Ga0207702_10668656
826 Ga0207641_10992841
827 Ga0207674_10003295
828 Ga0207674_10075982
829 Ga0207674_10252536
830 Ga0207698_10054581
831 Ga0207698_10226228
832 Ga0207698_11132655
833 Ga0268265_10019681
834 Ga0268264_10988329
835 Ga0307509_10324494
836 Ga0307509_10695067
837 Ga0307414_10260193
838 Ga0307415_100357563
839 Ga0307510_10015870
840 Ga0316574_0272107
841 Ga0373933_0286663
842 Ga0373937_0338937
843 Ga0395899_0001549
844 Ga0395899_0210658
845 Ga0395899_0478388
846 Ga0395900_0006841
847 Ga0395900_0048618
848 Ga0395900_0236248
849 Ga0395898_0118478
850 Ga0395905_0187978
851 Ga0395905_0224928
852 Ga0395905_0251100
853 Ga0395905_0315222
854 Ga0395905_0392772
855 Ga0395905_1359574
856 Ga0395901_0163503
857 Ga0395901_0291100
858 Ga0395901_0413451
859 Ga0395901_1650079
860 Ga0436361_0139067
861 Ga0436361_0412777
862 Ga0436361_0699546
863 Ga0436361_1034323
864 Ga0451791_1866294
865 Ga0451798_1003930
866 Ga0451807_0893005
867 Ga0451853_1584401
868 Ga0466969_0273919
869 Ga0466966_0045731
870 Ga0466964_0321704
871 Ga0466968_0001716
872 Ga0466957_0029549
873 Ga0466957_0277771
874 Ga0495590_0000001
875 Ga0495629_0212089
876 Ga0495638_0000102
877 Ga0495650_0000137
878 Ga0495650_0000138
879 Ga0495650_0001979
880 Ga0495639_0009293
881 Ga0495639_0067547
882 Ga0495639_0293649
883 Ga0495585_0000128
884 Ga0495585_0151441
885 Ga0495607_0024006
886 Ga0495583_0000186
887 Ga0495606_0000001
888 Ga0495606_0000002
889 Ga0495606_0005390
890 Ga0495606_0016821
891 Ga0495606_0055132
892 Ga0495606_0279588
893 Ga0495608_0348799
894 Ga0495610_0003621
895 Ga0495610_0005408
896 Ga0495610_0006895
897 Ga0495610_0007187
898 Ga0495616_0004530
899 Ga0495618_0286698
900 Ga0495628_0378601
901 Ga0495637_0121628
902 Ga0495643_0000137
903 Ga0495648_0000001
904 Ga0495648_0014199
905 Ga0495648_0021583
906 Ga0495666_0262266
907 Ga0495642_0005754
908 Ga0495652_0098856
909 Ga0495652_0526193
910 Ga0495586_0356595
911 Ga0495587_0126555
912 Ga0495609_0011494
913 Ga0495609_0039623
914 Ga0495622_0000152
915 Ga0495622_0054532
916 Ga0495633_0000096
917 Ga0495633_0003857
918 Ga0495633_0006583
919 Ga0495633_0014264
920 Ga0495667_0400835
921 Ga0495667_0861818
922 Ga0495668_0000151
923 Ga0495668_0000241
924 Ga0495668_0513964
925 Ga0495634_0315277
926 Ga0495625_0000005
927 Ga0495625_0000065
928 Ga0495625_0002959
929 Ga0495625_0032012
930 Ga0495625_0224015
931 Ga0495635_0081065
932 Ga0495661_0002667
933 Ga0495588_0121700
934 Ga0495657_0225383
935 Ga0495599_0098086
936 Ga0495647_0274115
937 Ga0495658_0082169
938 Ga0495658_0180258
939 Ga0495613_0264638
940 Ga0495624_0119441
941 Ga0495670_0087197
942 Ga0495670_0190634
943 Ga0495671_0054076
944 Ga0495649_0000003
945 Ga0495649_0017448
946 Ga0495660_0013872
947 Ga0495660_0014896
948 Ga0495581_0122177
949 Ga0495604_0202020
950 Ga0495672_0002335
951 Ga0495676_0000324
952 Ga0495683_0215403
953 Ga0495687_155930
954 Ga0495686_0000402
955 Ga0495686_0019273
956 Ga0495593_0009368
957 Ga0495593_0049769
958 Ga0495602_0736586
959 Ga0495614_0026681
960 Ga0496101_0730436
961 Ga0496102_0009914
962 Ga0496102_0376321
963 Ga0496103_0202887
964 Ga0496103_0276026
965 Ga0496104_0556801
966 Ga0496105_0606408
967 Ga0496113_0233615
968 Ga0496113_0360501
969 Ga0496115_0093019
970 Ga0496116_0000006
971 Ga0496116_0101298
972 Ga0496117_0000027
973 Ga0496118_0000141
974 Ga0496118_0036813
975 Ga0496119_0000006
976 Ga0496119_0233441
977 Ga0496121_0218618
978 Ga0496122_0000391
979 Ga0496122_0001741
980 Ga0496122_0002084
981 Ga0496122_0008848
982 Ga0496123_0001461
983 Ga0496123_0011250
984 Ga0496123_0277573
985 Ga0496124_0017492
986 Ga0496124_0018315
987 Ga0496125_0000256
988 Ga0496125_0001989
989 Ga0496125_0002001
990 Ga0496125_0002112
991 Ga0496125_0029245
992 Ga0496125_0106071
993 Ga0496125_0154894
994 Ga0496126_0039136
995 Ga0496126_0189370
996 Ga0495678_001729
997 Ga0495678_006395
998 Ga0495678_080107
999 Ga0495682_0064469
1000 Ga0501217_143805
1001 Ga0501044_0993469
1002 nmdc:mga0k408_145547_c1
1003 nmdc:mga0k408_292290_c1
1004 nmdc:mga0k408_300585_c1
1005 nmdc:mga07m45_350364_c1
1006 Ga0500578_0000244
1007 Ga0500578_0035158
1008 Ga0500566_0405443
1009 Ga0500562_019852
1010 Ga0500562_100650
1011 Ga0500571_000094
1012 Ga0500597_057611
1013 Ga0500608_012634
1014 Ga0500608_085507
1015 Ga0500618_014478
1016 Ga0500623_038459
1017 Ga0500652_019841
1018 Ga0500652_104680
1019 Ga0500655_000060
1020 Ga0500559_0163515
1021 Ga0500559_0267771
1022 Ga0500568_0010694
1023 Ga0500586_001546
1024 Ga0500588_0028674
1025 Ga0500590_037210
1026 Ga0500590_115327
1027 Ga0500604_0002004
1028 Ga0500604_0010405
1029 Ga0500616_0212596
1030 Ga0500622_0000015
1031 Ga0500622_0000022
1032 Ga0500622_0001421
1033 Ga0500622_0011232
1034 Ga0500622_0028521
1035 Ga0500627_0144154
1036 Ga0500638_001711
1037 Ga0500636_0124709
1038 Ga0500636_0185173
1039 Ga0500637_0040337
1040 Ga0500637_0344319
1041 Ga0500565_001698
1042 2550694952
1043 2587727563
1044 2588210294
1045 2588223084
1046 2597028029
1047 2599444701
1048 2599478700
1049 2643967888
1050 2644143212
1051 2644271700
1052 2739252098
1053 2776263878
1054 2819594591
1055 2819680633
1056 2842715918
1057 2871724098
1058 2885266372
1059 2928059839
1060 2928080243
1061 2928149585
1062 2929924042
1063 2932083415
1064 8003152489

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

54

191

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ldk-assembly1.cif.gz_A solution nmr structure of protein aaur_3427 from arthrobacter aurescens, northeast structural genomics consortium target aar96 0.9466 8 159
3uid-assembly2.cif.gz_B crystal structure of protein ms6760 from mycobacterium smegmatis 0.9413 5 164
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.925 6 166
3uid-assembly1.cif.gz_A crystal structure of protein ms6760 from mycobacterium smegmatis 0.9196 5 162
3uid-assembly2.cif.gz_B crystal structure of protein ms6760 from mycobacterium smegmatis 0.9182 5 164
ID Description Score Start End Superfamily
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9466 8 159 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9413 5 164 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9204 6 166 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9182 5 164 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9076 4 161 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A1G9HHE1-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 1.004 4 165
AF-A0A848FML0-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9991 1 167
AF-A0A3E1NX79-F1-model_v4 SRPBCC domain-containing protein 0.9966 6 161
AF-A0A848FML0-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9931 1 167
AF-F4CBB1-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.9919 1 167

Map