F460337

General Info

Members Datasets Scaffolds Average Seq Length
532 266 1064 198

Family's Representative Sequence

Representative Sequence 3300050005|Ga0501284_00045|Ga0501284_00045_216_836
Length 206
Sequence MTPERYERLVSVLNKRQHDLCVVLENVFDPHNISAVMRTCDAVGVQEIFVLNTKIPRHKKFGARSSSSAAKWLTVHQFTDAASCFAALRTKYDRILTTHLSSDAVDLYKVDFAATSIALVFGNEHSGVSDEIRALADGNFVIPQVGIIRSLNISVACAVSLYEAYRQKTVAGHYAQRRMSGEQLESLLGEWKLQLEASDQQESLEK

Samples

Sample ID Description Type Environment
1 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
188 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
189 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
190 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
191 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
192 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
230 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
231 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
235 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
245 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
246 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
247 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
248 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
249 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
254 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
255 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
258 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
259 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
260 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
261 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
262 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
263 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
264 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
265 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
266 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 0
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.95
Nodule 0
Rhizoplane 0.19
Rhizosphere 87.97
Stem 0
Stem Tuber 0
Unclassified 14.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501284_00045 3300050005 Bacteria 48266
2 JGI24751J29686_10016050 3300002459 Bacteria 1545
3 rootH2_10009699 3300003320 Bacteria 7141
4 rootH2_10013801 3300003320 Bacteria 25943
5 rootH2_10015657 3300003320 Bacteria 5176
6 rootH2_10288550 3300003320 Eukaryota 1071
7 rootL2_10302135 3300003322 Bacteria 4794
8 rootH1_10266015 3300003323 Bacteria 1942
9 rootH1_10282532 3300003323 Bacteria 2097
10 JGI25160J50197_1008651 3300003354 Bacteria 3859
11 Ga0055542_1002956 3300003762 Bacteria 4988
12 Ga0055526_1025008 3300003771 Bacteria 1931
13 Ga0055528_1000552 3300003790 Bacteria 28584
14 Ga0055530_10011765 3300003791 Bacteria 3110
15 Ga0055543_1006512 3300004625 Bacteria 2811
16 Ga0065165_1000010 3300005262 Bacteria 323737
17 Ga0065165_1020835 3300005262 Bacteria 2294
18 Ga0065714_10112526 3300005288 Bacteria 1454
19 Ga0065704_10207320 3300005289 Bacteria 1061
20 Ga0065704_10278759 3300005289 Bacteria 927
21 Ga0065712_10006730 3300005290 Unclassified 3217
22 Ga0065712_10071273 3300005290 Bacteria 5376
23 Ga0065712_10211643 3300005290 Unclassified 1071
24 Ga0065707_10089660 3300005295 Unclassified 4294
25 Ga0065707_10361720 3300005295 Unclassified 903
26 Ga0070683_100178690 3300005329 Bacteria 2014
27 Ga0070683_100272029 3300005329 Bacteria 1611
28 Ga0070690_100155815 3300005330 Bacteria 1562
29 Ga0070670_100004799 3300005331 Bacteria 11351
30 Ga0070670_100111973 3300005331 Bacteria 2352
31 Ga0070670_100117666 3300005331 Bacteria 2292
32 Ga0070670_100118042 3300005331 Bacteria 2288
33 Ga0070670_100163326 3300005331 Bacteria 1930
34 Ga0070677_10247413 3300005333 Unclassified 883
35 Ga0070677_10384681 3300005333 Bacteria 736
36 Ga0068869_100034275 3300005334 Bacteria 3590
37 Ga0068869_100299113 3300005334 Bacteria 1299
38 Ga0068869_100515928 3300005334 Bacteria 1000
39 Ga0068869_100871087 3300005334 Bacteria 778
40 Ga0070666_10002346 3300005335 Bacteria 11440
41 Ga0070666_10028262 3300005335 Bacteria 3679
42 Ga0070682_100593868 3300005337 Unclassified 873
43 Ga0068868_100071710 3300005338 Bacteria 2762
44 Ga0068868_100165057 3300005338 Unclassified 1831
45 Ga0068868_100203116 3300005338 Bacteria 1653
46 Ga0068868_100308249 3300005338 Bacteria 1346
47 Ga0068868_100315326 3300005338 Bacteria 1331
48 Ga0070689_100079041 3300005340 Bacteria 2579
49 Ga0070689_100435458 3300005340 Bacteria 1113
50 Ga0070687_100040488 3300005343 Unclassified 2348
51 Ga0070687_100375824 3300005343 Bacteria 924
52 Ga0070661_100253617 3300005344 Bacteria 1358
53 Ga0070661_100327355 3300005344 Bacteria 1198
54 Ga0070661_101145267 3300005344 Bacteria 649
55 Ga0070668_100029632 3300005347 Bacteria 4158
56 Ga0070668_100367034 3300005347 Bacteria 1222
57 Ga0070668_100746063 3300005347 Unclassified 866
58 Ga0070669_100025241 3300005353 Bacteria 4268
59 Ga0070669_100527555 3300005353 Bacteria 982
60 Ga0070675_100021680 3300005354 Bacteria 5132
61 Ga0070675_100050372 3300005354 Bacteria 3419
62 Ga0070675_100145110 3300005354 Bacteria 2031
63 Ga0070675_100307529 3300005354 Bacteria 1398
64 Ga0070675_100640849 3300005354 Bacteria 965
65 Ga0070675_101026095 3300005354 Bacteria 758
66 Ga0070671_100311653 3300005355 Bacteria 1340
67 Ga0070671_100332270 3300005355 Unclassified 1296
68 Ga0070674_100131498 3300005356 Unclassified 1866
69 Ga0070674_100234150 3300005356 Bacteria 1435
70 Ga0070673_100013228 3300005364 Bacteria 5698
71 Ga0070673_100041443 3300005364 Bacteria 3542
72 Ga0070673_100113929 3300005364 Bacteria 2246
73 Ga0070673_100151009 3300005364 Bacteria 1967
74 Ga0070673_100424255 3300005364 Unclassified 1193
75 Ga0070688_100003172 3300005365 Bacteria 8420
76 Ga0070688_100007291 3300005365 Bacteria 5957
77 Ga0070688_100275177 3300005365 Bacteria 1207
78 Ga0070659_100210267 3300005366 Bacteria 1603
79 Ga0070667_100046703 3300005367 Bacteria 3643
80 Ga0070667_100483937 3300005367 Bacteria 1133
81 Ga0070667_101138999 3300005367 Bacteria 729
82 Ga0070700_100054298 3300005441 Unclassified 2503
83 Ga0070663_100719487 3300005455 Unclassified 850
84 Ga0070678_100244487 3300005456 Bacteria 1502
85 Ga0070678_100788445 3300005456 Bacteria 862
86 Ga0070662_100140368 3300005457 Bacteria 1871
87 Ga0070681_10283794 3300005458 Bacteria 1566
88 Ga0068867_100028165 3300005459 Bacteria 4043
89 Ga0068867_100155381 3300005459 Bacteria 1800
90 Ga0068867_100168280 3300005459 Bacteria 1734
91 Ga0068867_100767294 3300005459 Unclassified 857
92 Ga0070685_10000962 3300005466 Bacteria 15477
93 Ga0070706_100333145 3300005467 Bacteria 1415
94 Ga0070698_100005620 3300005471 Bacteria 13714
95 Ga0070699_100383435 3300005518 Unclassified 1269
96 Ga0070679_100879167 3300005530 Bacteria 839
97 Ga0070684_100028921 3300005535 Bacteria 4691
98 Ga0070684_100068221 3300005535 Bacteria 3125
99 Ga0068853_100019410 3300005539 Bacteria 5635
100 Ga0068853_100968804 3300005539 Bacteria 818
101 Ga0070672_100052419 3300005543 Bacteria 3185
102 Ga0070672_100167163 3300005543 Bacteria 1827
103 Ga0070672_100767398 3300005543 Bacteria 847
104 Ga0070665_100000009 3300005548 Bacteria 562640
105 Ga0068855_100004710 3300005563 Bacteria 16680
106 Ga0070664_100023622 3300005564 Bacteria 5079
107 Ga0070664_100054740 3300005564 Unclassified 3386
108 Ga0070664_100077776 3300005564 Bacteria 2853
109 Ga0068857_100008152 3300005577 Bacteria 9046
110 Ga0068857_100083470 3300005577 Unclassified 2854
111 Ga0068857_100121170 3300005577 Bacteria 2355
112 Ga0068857_100271804 3300005577 Bacteria 1558
113 Ga0068854_100098090 3300005578 Bacteria 2192
114 Ga0068856_100041992 3300005614 Bacteria 4497
115 Ga0068852_100001323 3300005616 Bacteria 16594
116 Ga0068852_100052723 3300005616 Bacteria 3497
117 Ga0068852_100053945 3300005616 Unclassified 3463
118 Ga0068852_100155521 3300005616 Bacteria 2130
119 Ga0068852_100266881 3300005616 Bacteria 1646
120 Ga0068852_100337372 3300005616 Unclassified 1468
121 Ga0068859_100000186 3300005617 Bacteria 60206
122 Ga0068859_100175394 3300005617 Bacteria 2225
123 Ga0068859_100257031 3300005617 Bacteria 1837
124 Ga0068859_100444892 3300005617 Bacteria 1392
125 Ga0068864_100008303 3300005618 Bacteria 8565
126 Ga0068864_100045392 3300005618 Unclassified 3769
127 Ga0068864_100429130 3300005618 Bacteria 1261
128 Ga0068864_100431029 3300005618 Bacteria 1258
129 Ga0068866_10019397 3300005718 Bacteria 3095
130 Ga0068866_10487241 3300005718 Bacteria 813
131 Ga0068866_10632478 3300005718 Unclassified 726
132 Ga0068861_100003143 3300005719 Bacteria 10914
133 Ga0068861_100016218 3300005719 Bacteria 5267
134 Ga0068861_100382249 3300005719 Bacteria 1244
135 Ga0068861_100482476 3300005719 Bacteria 1117
136 Ga0068861_100601689 3300005719 Bacteria 1009
137 Ga0068861_100890466 3300005719 Bacteria 842
138 Ga0068851_10078376 3300005834 Bacteria 1722
139 Ga0068851_10153487 3300005834 Unclassified 1260
140 Ga0068851_10256377 3300005834 Unclassified 993
141 Ga0068870_10029014 3300005840 Bacteria 2784
142 Ga0068870_10411502 3300005840 Bacteria 882
143 Ga0068863_100013293 3300005841 Bacteria 7943
144 Ga0068863_100033693 3300005841 Bacteria 4879
145 Ga0068863_100415050 3300005841 Unclassified 1318
146 Ga0068858_100491397 3300005842 Bacteria 1185
147 Ga0068858_100636898 3300005842 Bacteria 1036
148 Ga0068858_101070140 3300005842 Bacteria 791
149 Ga0068860_100000103 3300005843 Bacteria 139076
150 Ga0068860_100002588 3300005843 Bacteria 18925
151 Ga0068860_100016594 3300005843 Bacteria 7182
152 Ga0068860_100016702 3300005843 Bacteria 7158
153 Ga0068862_100032257 3300005844 Unclassified 4425
154 Ga0068862_100330398 3300005844 Bacteria 1410
155 Ga0081540_1024128 3300005983 Bacteria 3536
156 Ga0070715_10191270 3300006163 Bacteria 1033
157 Ga0075366_10098663 3300006195 Unclassified 1752
158 Ga0097621_100003071 3300006237 Bacteria 11446
159 Ga0097621_100037643 3300006237 Bacteria 3878
160 Ga0097621_100064443 3300006237 Bacteria 3014
161 Ga0097621_100234571 3300006237 Bacteria 1602
162 Ga0068871_100001472 3300006358 Bacteria 15784
163 Ga0068871_100010375 3300006358 Bacteria 6794
164 Ga0068871_100056523 3300006358 Bacteria 3190
165 Ga0068871_100083695 3300006358 Bacteria 2646
166 Ga0075428_100346573 3300006844 Bacteria 1594
167 Ga0075428_101576225 3300006844 Bacteria 687
168 Ga0075430_100011429 3300006846 Bacteria 7538
169 Ga0075431_100070380 3300006847 Bacteria 3610
170 Ga0075429_100020707 3300006880 Bacteria 5709
171 Ga0068865_100128593 3300006881 Bacteria 1895
172 Ga0068865_100439618 3300006881 Bacteria 1076
173 Ga0097620_100000186 3300006931 Bacteria 60206
174 Ga0097620_100175410 3300006931 Bacteria 2225
175 Ga0097620_100257029 3300006931 Bacteria 1837
176 Ga0097620_100318375 3300006931 Bacteria 1649
177 Ga0097620_100444824 3300006931 Bacteria 1392
178 Ga0105240_10000188 3300009093 Bacteria 126031
179 Ga0105240_10003898 3300009093 Bacteria 23042
180 Ga0105240_10018065 3300009093 Bacteria 9482
181 Ga0105240_10233470 3300009093 Bacteria 2136
182 Ga0105240_10248636 3300009093 Bacteria 2058
183 Ga0111539_10003454 3300009094 Bacteria 20812
184 Ga0111539_10110425 3300009094 Bacteria 3227
185 Ga0111539_10926515 3300009094 Bacteria 1013
186 Ga0105247_10008274 3300009101 Bacteria 6347
187 Ga0105247_10134438 3300009101 Bacteria 1614
188 Ga0105247_10627781 3300009101 Unclassified 800
189 Ga0114129_10295951 3300009147 Bacteria 2159
190 Ga0105243_10864480 3300009148 Bacteria 897
191 Ga0105241_10005553 3300009174 Bacteria 9315
192 Ga0105241_10023753 3300009174 Bacteria 4549
193 Ga0105241_10113434 3300009174 Bacteria 2173
194 Ga0105242_10087332 3300009176 Bacteria 2618
195 Ga0105242_10100777 3300009176 Bacteria 2447
196 Ga0105242_10177553 3300009176 Unclassified 1876
197 Ga0105248_10059950 3300009177 Bacteria 4274
198 Ga0105237_10009446 3300009545 Bacteria 10447
199 Ga0105237_10035739 3300009545 Bacteria 5026
200 Ga0105237_10531428 3300009545 Bacteria 1183
201 Ga0105237_10832669 3300009545 Bacteria 929
202 Ga0105238_10047259 3300009551 Unclassified 4342
203 Ga0105238_10464877 3300009551 Bacteria 1263
204 Ga0105249_10011582 3300009553 Bacteria 7750
205 Ga0105249_10035187 3300009553 Bacteria 4541
206 Ga0105249_10040089 3300009553 Unclassified 4253
207 Ga0105249_10047526 3300009553 Bacteria 3911
208 Ga0105249_10056179 3300009553 Bacteria 3604
209 Ga0105249_10239167 3300009553 Bacteria 1794
210 Ga0105249_10442979 3300009553 Bacteria 1336
211 Ga0105249_10703857 3300009553 Bacteria 1070
212 Ga0105239_10000675 3300010375 Bacteria 48613
213 Ga0105239_10005163 3300010375 Bacteria 15405
214 Ga0105239_10008963 3300010375 Bacteria 11321
215 Ga0105239_10262562 3300010375 Bacteria 1941
216 Ga0157371_10006472 3300013102 Bacteria 9653
217 Ga0157370_10010054 3300013104 Bacteria 10005
218 Ga0157370_10025137 3300013104 Bacteria 5896
219 Ga0157370_10397341 3300013104 Bacteria 1269
220 Ga0157369_10034023 3300013105 Bacteria 5596
221 Ga0157374_10118590 3300013296 Unclassified 2552
222 Ga0157374_10392892 3300013296 Bacteria 1383
223 Ga0157374_11410663 3300013296 Unclassified 719
224 Ga0157378_10025854 3300013297 Bacteria 5172
225 Ga0157378_10136595 3300013297 Bacteria 2274
226 Ga0157378_10296681 3300013297 Unclassified 1563
227 Ga0157378_10328795 3300013297 Bacteria 1487
228 Ga0163162_10000533 3300013306 Bacteria 35238
229 Ga0163162_10001119 3300013306 Bacteria 24928
230 Ga0163162_10006332 3300013306 Bacteria 11462
231 Ga0163162_10006348 3300013306 Bacteria 11447
232 Ga0163162_10007342 3300013306 Bacteria 10712
233 Ga0163162_10023940 3300013306 Bacteria 6026
234 Ga0163162_10093275 3300013306 Bacteria 3095
235 Ga0163162_12265611 3300013306 Unclassified 624
236 Ga0157372_10001035 3300013307 Bacteria 30418
237 Ga0157372_10015836 3300013307 Bacteria 8090
238 Ga0157375_10000324 3300013308 Bacteria 42877
239 Ga0157375_10038974 3300013308 Bacteria 4568
240 Ga0157375_10129561 3300013308 Bacteria 2641
241 Ga0157375_10131514 3300013308 Unclassified 2622
242 Ga0157375_10140841 3300013308 Bacteria 2539
243 Ga0157375_10737338 3300013308 Bacteria 1137
244 Ga0157375_11118828 3300013308 Bacteria 922
245 Ga0157375_11585430 3300013308 Bacteria 774
246 Ga0163163_10050570 3300014325 Bacteria 4093
247 Ga0163163_10091207 3300014325 Unclassified 3061
248 Ga0163163_10160212 3300014325 Bacteria 2295
249 Ga0163163_10204032 3300014325 Bacteria 2025
250 Ga0163163_10340454 3300014325 Bacteria 1555
251 Ga0163163_11644226 3300014325 Bacteria 703
252 Ga0157380_10000544 3300014326 Bacteria 23197
253 Ga0157380_10001175 3300014326 Bacteria 16963
254 Ga0157380_10074280 3300014326 Bacteria 2759
255 Ga0157380_10267296 3300014326 Bacteria 1557
256 Ga0157380_10812029 3300014326 Bacteria 953
257 Ga0157377_10006870 3300014745 Bacteria 5457
258 Ga0157377_10070528 3300014745 Unclassified 2019
259 Ga0157377_10187248 3300014745 Bacteria 1306
260 Ga0157379_10011377 3300014968 Bacteria 7761
261 Ga0157379_10017815 3300014968 Bacteria 6257
262 Ga0157379_10242613 3300014968 Unclassified 1634
263 Ga0157379_10482018 3300014968 Bacteria 1148
264 Ga0157376_10014701 3300014969 Bacteria 5885
265 Ga0157376_10152432 3300014969 Bacteria 2086
266 Ga0182005_1000215 3300015265 Bacteria 38214
267 Ga0163161_10018334 3300017792 Unclassified 4906
268 Ga0163161_10165769 3300017792 Bacteria 1687
269 Ga0163161_10337455 3300017792 Bacteria 1195
270 Ga0209436_101105 3300025208 Bacteria 10037
271 Ga0209436_104258 3300025208 Bacteria 3571
272 Ga0209258_100219 3300025242 Bacteria 108974
273 Ga0209148_1000283 3300025254 Bacteria 77780
274 Ga0209673_1000082 3300025273 Bacteria 219716
275 Ga0209564_1016912 3300025295 Bacteria 2875
276 Ga0209758_1002720 3300025297 Bacteria 17416
277 Ga0209050_1000389 3300025298 Bacteria 82517
278 Ga0207426_1000341 3300025302 Bacteria 87735
279 Ga0207426_1002748 3300025302 Bacteria 10650
280 Ga0207426_1004384 3300025302 Bacteria 6920
281 Ga0209257_1006346 3300025304 Bacteria 7683
282 Ga0207656_10118294 3300025321 Bacteria 1231
283 Ga0207682_10012126 3300025893 Bacteria 3366
284 Ga0207642_10444251 3300025899 Bacteria 784
285 Ga0207710_10003698 3300025900 Bacteria 6780
286 Ga0207680_10018761 3300025903 Bacteria 3686
287 Ga0207647_10157281 3300025904 Bacteria 1327
288 Ga0207685_10153454 3300025905 Bacteria 1044
289 Ga0207643_10003830 3300025908 Bacteria 8090
290 Ga0207643_10006359 3300025908 Bacteria 6326
291 Ga0207684_10501660 3300025910 Bacteria 1040
292 Ga0207707_10114242 3300025912 Bacteria 2360
293 Ga0207695_10000016 3300025913 Bacteria 771991
294 Ga0207695_10000284 3300025913 Bacteria 126041
295 Ga0207695_10007537 3300025913 Bacteria 13795
296 Ga0207695_10064011 3300025913 Unclassified 3789
297 Ga0207695_10154815 3300025913 Bacteria 2228
298 Ga0207671_10003986 3300025914 Bacteria 14347
299 Ga0207671_10007233 3300025914 Bacteria 9666
300 Ga0207662_10023825 3300025918 Bacteria 3519
301 Ga0207662_10379194 3300025918 Bacteria 955
302 Ga0207657_10399662 3300025919 Unclassified 1081
303 Ga0207649_10156669 3300025920 Bacteria 1574
304 Ga0207652_10684770 3300025921 Bacteria 915
305 Ga0207681_10029119 3300025923 Bacteria 3582
306 Ga0207681_10128534 3300025923 Bacteria 1870
307 Ga0207681_10191622 3300025923 Bacteria 1564
308 Ga0207694_10027803 3300025924 Bacteria 4309
309 Ga0207694_10176270 3300025924 Bacteria 1732
310 Ga0207650_10004560 3300025925 Bacteria 9471
311 Ga0207650_10070478 3300025925 Bacteria 2628
312 Ga0207650_10578459 3300025925 Unclassified 943
313 Ga0207659_10076709 3300025926 Bacteria 2458
314 Ga0207659_10117426 3300025926 Bacteria 2033
315 Ga0207659_10141018 3300025926 Unclassified 1871
316 Ga0207659_10145628 3300025926 Unclassified 1844
317 Ga0207659_10605908 3300025926 Bacteria 934
318 Ga0207659_10715593 3300025926 Bacteria 858
319 Ga0207706_10004736 3300025933 Bacteria 12739
320 Ga0207706_10195318 3300025933 Bacteria 1775
321 Ga0207686_10000375 3300025934 Bacteria 31141
322 Ga0207709_10944688 3300025935 Unclassified 702
323 Ga0207670_10008310 3300025936 Bacteria 5850
324 Ga0207670_10140154 3300025936 Bacteria 1782
325 Ga0207670_10229320 3300025936 Bacteria 1425
326 Ga0207669_10224257 3300025937 Bacteria 1382
327 Ga0207704_10168677 3300025938 Bacteria 1567
328 Ga0207704_10315469 3300025938 Bacteria 1204
329 Ga0207691_10041796 3300025940 Bacteria 4229
330 Ga0207691_10097911 3300025940 Unclassified 2621
331 Ga0207691_10113602 3300025940 Bacteria 2407
332 Ga0207691_10190364 3300025940 Bacteria 1789
333 Ga0207691_10607282 3300025940 Bacteria 926
334 Ga0207689_10094914 3300025942 Bacteria 2449
335 Ga0207689_10150367 3300025942 Bacteria 1919
336 Ga0207689_10184789 3300025942 Unclassified 1719
337 Ga0207661_10224768 3300025944 Bacteria 1660
338 Ga0207661_10538003 3300025944 Bacteria 1069
339 Ga0207679_10042344 3300025945 Bacteria 3272
340 Ga0207667_10002492 3300025949 Bacteria 22948
341 Ga0207651_10015753 3300025960 Bacteria 4405
342 Ga0207651_10079772 3300025960 Bacteria 2353
343 Ga0207651_10392242 3300025960 Unclassified 1179
344 Ga0207651_10435895 3300025960 Bacteria 1121
345 Ga0207651_10560906 3300025960 Bacteria 994
346 Ga0207712_10005746 3300025961 Bacteria 7819
347 Ga0207712_10007534 3300025961 Bacteria 6874
348 Ga0207712_10018495 3300025961 Bacteria 4540
349 Ga0207712_10062337 3300025961 Unclassified 2650
350 Ga0207668_10060929 3300025972 Unclassified 2651
351 Ga0207668_10980644 3300025972 Unclassified 755
352 Ga0207640_10006797 3300025981 Bacteria 6291
353 Ga0207640_10021754 3300025981 Bacteria 3827
354 Ga0207640_10596931 3300025981 Bacteria 934
355 Ga0207677_10079715 3300026023 Bacteria 2342
356 Ga0207677_10225968 3300026023 Bacteria 1504
357 Ga0207677_10349622 3300026023 Bacteria 1238
358 Ga0207703_10155324 3300026035 Bacteria 1999
359 Ga0207703_10390598 3300026035 Bacteria 1289
360 Ga0207639_10006644 3300026041 Bacteria 7865
361 Ga0207639_10662227 3300026041 Bacteria 966
362 Ga0207639_11119411 3300026041 Bacteria 739
363 Ga0207708_10092307 3300026075 Unclassified 2336
364 Ga0207702_10194068 3300026078 Bacteria 1878
365 Ga0207641_10011023 3300026088 Bacteria 7413
366 Ga0207641_10437343 3300026088 Unclassified 1262
367 Ga0207641_10757980 3300026088 Bacteria 958
368 Ga0207648_10002952 3300026089 Bacteria 17989
369 Ga0207648_10064881 3300026089 Bacteria 3183
370 Ga0207648_10099899 3300026089 Bacteria 2541
371 Ga0207648_10110786 3300026089 Bacteria 2410
372 Ga0207648_10262540 3300026089 Bacteria 1541
373 Ga0207648_11042511 3300026089 Bacteria 766
374 Ga0207648_11135546 3300026089 Bacteria 733
375 Ga0207676_10334145 3300026095 Unclassified 1396
376 Ga0207676_10447524 3300026095 Bacteria 1217
377 Ga0207674_10001043 3300026116 Bacteria 36010
378 Ga0207674_10011135 3300026116 Bacteria 10115
379 Ga0207674_10043287 3300026116 Bacteria 4643
380 Ga0207674_10158529 3300026116 Bacteria 2218
381 Ga0207674_10310818 3300026116 Bacteria 1525
382 Ga0207674_10328623 3300026116 Bacteria 1479
383 Ga0207675_100000359 3300026118 Bacteria 43729
384 Ga0207675_100164895 3300026118 Bacteria 2115
385 Ga0207675_100195304 3300026118 Bacteria 1942
386 Ga0207675_100233938 3300026118 Bacteria 1773
387 Ga0207675_100345372 3300026118 Bacteria 1457
388 Ga0207683_10182229 3300026121 Bacteria 1904
389 Ga0207683_10334008 3300026121 Bacteria 1389
390 Ga0207683_10909166 3300026121 Unclassified 817
391 Ga0207698_10098134 3300026142 Bacteria 2420
392 Ga0207698_10119608 3300026142 Bacteria 2226
393 Ga0207698_10163818 3300026142 Unclassified 1948
394 Ga0207698_10915142 3300026142 Bacteria 885
395 Ga0207428_10008958 3300027907 Bacteria 9014
396 Ga0268266_10000105 3300028379 Bacteria 176691
397 Ga0268265_10009168 3300028380 Bacteria 6688
398 Ga0268265_10116171 3300028380 Unclassified 2195
399 Ga0268264_10000013 3300028381 Bacteria 513859
400 Ga0268264_10001619 3300028381 Bacteria 20805
401 Ga0268264_10011517 3300028381 Bacteria 7305
402 Ga0268264_10276282 3300028381 Bacteria 1571
403 Ga0307515_10195608 3300028794 Bacteria 1916
404 Ga0265338_10429122 3300028800 Bacteria 938
405 Ga0265327_10001115 3300031251 Bacteria 37124
406 Ga0307513_10261677 3300031456 Bacteria 1519
407 Ga0307509_10064127 3300031507 Bacteria 3866
408 Ga0265313_10114134 3300031595 Bacteria 1185
409 Ga0307508_10037821 3300031616 Bacteria 4338
410 Ga0307516_10006111 3300031730 Bacteria 14203
411 Ga0307405_10445604 3300031731 Bacteria 1025
412 Ga0307407_10319049 3300031903 Bacteria 1090
413 Ga0307407_10633232 3300031903 Bacteria 799
414 Ga0307409_100323267 3300031995 Bacteria 1445
415 Ga0307411_10335264 3300032005 Bacteria 1227
416 Ga0307415_100448666 3300032126 Bacteria 1114
417 Ga0307507_10421507 3300033179 Unclassified 749
418 Ga0373936_0294731 3300035113 Bacteria 731
419 Ga0395900_0515713 3300037418 Bacteria 1144
420 Ga0395900_0520222 3300037418 Bacteria 1138
421 Ga0395900_0543122 3300037418 Bacteria 1108
422 Ga0395905_0601814 3300037471 Bacteria 1001
423 Ga0395905_0984611 3300037471 Unclassified 746
424 Ga0395901_0073502 3300038443 Bacteria 3566
425 Ga0436365_0103853 3300039437 Bacteria 48297
426 Ga0436365_0723874 3300039437 Bacteria 1038
427 Ga0451843_1761783 3300041509 Bacteria 1096
428 Ga0451853_1170832 3300041512 Bacteria 1367
429 Ga0439431_0089717 3300041997 Bacteria 836
430 Ga0439441_016862 3300042001 Unclassified 1306
431 Ga0439445_0009545 3300042004 Bacteria 2288
432 Ga0439449_0016574 3300042007 Bacteria 2769
433 Ga0439449_0055367 3300042007 Bacteria 1465
434 Ga0439454_032494 3300042011 Unclassified 824
435 Ga0439457_036611 3300042014 Bacteria 1092
436 Ga0439460_0038197 3300042461 Unclassified 1400
437 Ga0451577_0145322 3300042876 Unclassified 2132
438 Ga0466969_0072296 3300044656 Bacteria 1657
439 Ga0466969_0301709 3300044656 Bacteria 725
440 Ga0466972_0002178 3300044658 Bacteria 9609
441 Ga0453683_0274562 3300044673 Bacteria 1076
442 Ga0466964_0045800 3300044706 Bacteria 1781
443 Ga0453684_0248564 3300044712 Viruses 2043
444 Ga0453684_0284058 3300044712 Bacteria 1886
445 Ga0453684_0415693 3300044712 Bacteria 1503
446 Ga0466968_0088056 3300044735 Unclassified 1372
447 Ga0466970_0056916 3300044765 Bacteria 2090
448 Ga0466957_0301165 3300044842 Unclassified 1077
449 Ga0451576_0218161 3300045051 Unclassified 1992
450 Ga0451576_0618816 3300045051 Bacteria 1138
451 Ga0451576_0785851 3300045051 Bacteria 1000
452 Ga0495638_0075624 3300046460 Bacteria 2052
453 Ga0495638_0123581 3300046460 Bacteria 1527
454 Ga0495638_0460974 3300046460 Unclassified 647
455 Ga0495606_0080048 3300046507 Bacteria 2034
456 Ga0495643_0042550 3300046522 Unclassified 2475
457 Ga0495648_0001451 3300046524 Bacteria 23185
458 Ga0495635_0229609 3300046663 Bacteria 1254
459 Ga0495670_0209919 3300046691 Bacteria 1033
460 Ga0495672_0021334 3300047320 Bacteria 4226
461 Ga0495686_0000195 3300047472 Bacteria 113003
462 Ga0496110_0753594 3300048913 Bacteria 877
463 Ga0496121_0000020 3300048924 Bacteria 498732
464 Ga0501031_0032828 3300049568 Bacteria 3385
465 Ga0501032_0047357 3300049569 Bacteria 2903
466 Ga0501033_0073950 3300049570 Bacteria 2502
467 Ga0501034_0011121 3300049571 Bacteria 9339
468 Ga0501034_0071735 3300049571 Bacteria 3473
469 Ga0501034_0161217 3300049571 Bacteria 2214
470 Ga0501034_0387004 3300049571 Bacteria 1323
471 Ga0501036_0043523 3300049572 Bacteria 3803
472 Ga0501036_0062827 3300049572 Bacteria 3145
473 Ga0501037_0008518 3300049573 Bacteria 7523
474 Ga0501037_0042178 3300049573 Bacteria 3354
475 Ga0501038_0010723 3300049574 Bacteria 8377
476 Ga0501038_0021386 3300049574 Bacteria 5807
477 Ga0501039_0047056 3300049575 Bacteria 3333
478 Ga0501043_0011472 3300049579 Bacteria 6937
479 Ga0501043_0094371 3300049579 Bacteria 2352
480 Ga0501046_0031566 3300049580 Bacteria 4292
481 Ga0501047_0032546 3300049581 Bacteria 5033
482 Ga0501047_0468786 3300049581 Unclassified 1088
483 Ga0501048_0037795 3300049582 Bacteria 3467
484 Ga0501070_0022381 3300049586 Bacteria 5294
485 Ga0501073_0000371 3300049589 Bacteria 30293
486 Ga0501074_0001823 3300049590 Bacteria 14583
487 Ga0501217_008429 3300049661 Bacteria 2227
488 Ga0501242_007027 3300049674 Bacteria 1293
489 Ga0501219_008154 3300049703 Unclassified 764
490 Ga0501080_0441006 3300049742 Unclassified 1168
491 Ga0501083_0094802 3300049744 Bacteria 1970
492 Ga0501266_017130 3300049763 Bacteria 967
493 Ga0501275_019296 3300049772 Unclassified 823
494 Ga0501035_0010622 3300049822 Bacteria 8526
495 Ga0501035_0105923 3300049822 Bacteria 2465
496 Ga0501044_0013657 3300049823 Bacteria 8776
497 Ga0501044_0017262 3300049823 Bacteria 7742
498 nmdc:mga0k408_213606_c1 3300050493 Bacteria 1152
499 nmdc:mga0k408_283094_c1 3300050493 Unclassified 990
500 nmdc:mga05p37_1347203_c1 3300050507 Bacteria 723
501 nmdc:mga05p37_138757_c1 3300050507 Unclassified 2979
502 nmdc:mga09592_174082_c1 3300050508 Unclassified 1861
503 nmdc:mga09592_31136_c1 3300050508 Bacteria 4444
504 nmdc:mga0qj67_873461_c1 3300050509 Bacteria 710
505 nmdc:mga06r32_241448_c1 3300050510 Bacteria 1794
506 nmdc:mga08y16_3350_c1 3300050511 Bacteria 16593
507 nmdc:mga08y16_904474_c1 3300050511 Bacteria 868
508 Ga0500644_0000108 3300053088 Bacteria 52348
509 Ga0500646_0001854 3300053090 Bacteria 5548
510 Ga0500646_0021606 3300053090 Bacteria 1716
511 Ga0500641_0141480 3300053096 Bacteria 1039
512 Ga0500569_000422 3300053109 Bacteria 6897
513 Ga0500658_0001169 3300053134 Bacteria 10690
514 Ga0500559_0114566 3300053136 Bacteria 1250
515 Ga0500568_0000562 3300053139 Bacteria 27303
516 Ga0500577_0155138 3300053142 Unclassified 972
517 Ga0500616_0002889 3300053153 Bacteria 13770
518 Ga0500616_0020472 3300053153 Bacteria 3716
519 Ga0500622_0142783 3300053156 Bacteria 1140
520 Ga0500633_0000550 3300053160 Bacteria 6077
521 Ga0500611_000092 3300053727 Bacteria 25966
522 Ga0501084_0377737 3300054114 Bacteria 1198
523 2819573768 2818991442 Bacteria 8318214
524 2819680504 2818991460 Bacteria 7595395
525 2821137103 2821136567 Bacteria 8080116
526 2840677598 2840677318 Bacteria 2664183
527 2884798085 2884791551 Bacteria 8511252
528 2896085416 2896085136 Bacteria 6129793
529 2904468155 2904467357 Bacteria 8057758
530 2929182797 2929177148 Bacteria 7883697
531 2945978752 2945977869 Bacteria 7777518
532 2946015381 2946013367 Bacteria 7766675
533 Ga0501284_00045
534 JGI24751J29686_10016050
535 rootH2_10009699
536 rootH2_10013801
537 rootH2_10015657
538 rootH2_10288550
539 rootL2_10302135
540 rootH1_10266015
541 rootH1_10282532
542 JGI25160J50197_1008651
543 Ga0055542_1002956
544 Ga0055526_1025008
545 Ga0055528_1000552
546 Ga0055530_10011765
547 Ga0055543_1006512
548 Ga0065165_1000010
549 Ga0065165_1020835
550 Ga0065714_10112526
551 Ga0065704_10207320
552 Ga0065704_10278759
553 Ga0065712_10006730
554 Ga0065712_10071273
555 Ga0065712_10211643
556 Ga0065707_10089660
557 Ga0065707_10361720
558 Ga0070683_100178690
559 Ga0070683_100272029
560 Ga0070690_100155815
561 Ga0070670_100004799
562 Ga0070670_100111973
563 Ga0070670_100117666
564 Ga0070670_100118042
565 Ga0070670_100163326
566 Ga0070677_10247413
567 Ga0070677_10384681
568 Ga0068869_100034275
569 Ga0068869_100299113
570 Ga0068869_100515928
571 Ga0068869_100871087
572 Ga0070666_10002346
573 Ga0070666_10028262
574 Ga0070682_100593868
575 Ga0068868_100071710
576 Ga0068868_100165057
577 Ga0068868_100203116
578 Ga0068868_100308249
579 Ga0068868_100315326
580 Ga0070689_100079041
581 Ga0070689_100435458
582 Ga0070687_100040488
583 Ga0070687_100375824
584 Ga0070661_100253617
585 Ga0070661_100327355
586 Ga0070661_101145267
587 Ga0070668_100029632
588 Ga0070668_100367034
589 Ga0070668_100746063
590 Ga0070669_100025241
591 Ga0070669_100527555
592 Ga0070675_100021680
593 Ga0070675_100050372
594 Ga0070675_100145110
595 Ga0070675_100307529
596 Ga0070675_100640849
597 Ga0070675_101026095
598 Ga0070671_100311653
599 Ga0070671_100332270
600 Ga0070674_100131498
601 Ga0070674_100234150
602 Ga0070673_100013228
603 Ga0070673_100041443
604 Ga0070673_100113929
605 Ga0070673_100151009
606 Ga0070673_100424255
607 Ga0070688_100003172
608 Ga0070688_100007291
609 Ga0070688_100275177
610 Ga0070659_100210267
611 Ga0070667_100046703
612 Ga0070667_100483937
613 Ga0070667_101138999
614 Ga0070700_100054298
615 Ga0070663_100719487
616 Ga0070678_100244487
617 Ga0070678_100788445
618 Ga0070662_100140368
619 Ga0070681_10283794
620 Ga0068867_100028165
621 Ga0068867_100155381
622 Ga0068867_100168280
623 Ga0068867_100767294
624 Ga0070685_10000962
625 Ga0070706_100333145
626 Ga0070698_100005620
627 Ga0070699_100383435
628 Ga0070679_100879167
629 Ga0070684_100028921
630 Ga0070684_100068221
631 Ga0068853_100019410
632 Ga0068853_100968804
633 Ga0070672_100052419
634 Ga0070672_100167163
635 Ga0070672_100767398
636 Ga0070665_100000009
637 Ga0068855_100004710
638 Ga0070664_100023622
639 Ga0070664_100054740
640 Ga0070664_100077776
641 Ga0068857_100008152
642 Ga0068857_100083470
643 Ga0068857_100121170
644 Ga0068857_100271804
645 Ga0068854_100098090
646 Ga0068856_100041992
647 Ga0068852_100001323
648 Ga0068852_100052723
649 Ga0068852_100053945
650 Ga0068852_100155521
651 Ga0068852_100266881
652 Ga0068852_100337372
653 Ga0068859_100000186
654 Ga0068859_100175394
655 Ga0068859_100257031
656 Ga0068859_100444892
657 Ga0068864_100008303
658 Ga0068864_100045392
659 Ga0068864_100429130
660 Ga0068864_100431029
661 Ga0068866_10019397
662 Ga0068866_10487241
663 Ga0068866_10632478
664 Ga0068861_100003143
665 Ga0068861_100016218
666 Ga0068861_100382249
667 Ga0068861_100482476
668 Ga0068861_100601689
669 Ga0068861_100890466
670 Ga0068851_10078376
671 Ga0068851_10153487
672 Ga0068851_10256377
673 Ga0068870_10029014
674 Ga0068870_10411502
675 Ga0068863_100013293
676 Ga0068863_100033693
677 Ga0068863_100415050
678 Ga0068858_100491397
679 Ga0068858_100636898
680 Ga0068858_101070140
681 Ga0068860_100000103
682 Ga0068860_100002588
683 Ga0068860_100016594
684 Ga0068860_100016702
685 Ga0068862_100032257
686 Ga0068862_100330398
687 Ga0081540_1024128
688 Ga0070715_10191270
689 Ga0075366_10098663
690 Ga0097621_100003071
691 Ga0097621_100037643
692 Ga0097621_100064443
693 Ga0097621_100234571
694 Ga0068871_100001472
695 Ga0068871_100010375
696 Ga0068871_100056523
697 Ga0068871_100083695
698 Ga0075428_100346573
699 Ga0075428_101576225
700 Ga0075430_100011429
701 Ga0075431_100070380
702 Ga0075429_100020707
703 Ga0068865_100128593
704 Ga0068865_100439618
705 Ga0097620_100000186
706 Ga0097620_100175410
707 Ga0097620_100257029
708 Ga0097620_100318375
709 Ga0097620_100444824
710 Ga0105240_10000188
711 Ga0105240_10003898
712 Ga0105240_10018065
713 Ga0105240_10233470
714 Ga0105240_10248636
715 Ga0111539_10003454
716 Ga0111539_10110425
717 Ga0111539_10926515
718 Ga0105247_10008274
719 Ga0105247_10134438
720 Ga0105247_10627781
721 Ga0114129_10295951
722 Ga0105243_10864480
723 Ga0105241_10005553
724 Ga0105241_10023753
725 Ga0105241_10113434
726 Ga0105242_10087332
727 Ga0105242_10100777
728 Ga0105242_10177553
729 Ga0105248_10059950
730 Ga0105237_10009446
731 Ga0105237_10035739
732 Ga0105237_10531428
733 Ga0105237_10832669
734 Ga0105238_10047259
735 Ga0105238_10464877
736 Ga0105249_10011582
737 Ga0105249_10035187
738 Ga0105249_10040089
739 Ga0105249_10047526
740 Ga0105249_10056179
741 Ga0105249_10239167
742 Ga0105249_10442979
743 Ga0105249_10703857
744 Ga0105239_10000675
745 Ga0105239_10005163
746 Ga0105239_10008963
747 Ga0105239_10262562
748 Ga0157371_10006472
749 Ga0157370_10010054
750 Ga0157370_10025137
751 Ga0157370_10397341
752 Ga0157369_10034023
753 Ga0157374_10118590
754 Ga0157374_10392892
755 Ga0157374_11410663
756 Ga0157378_10025854
757 Ga0157378_10136595
758 Ga0157378_10296681
759 Ga0157378_10328795
760 Ga0163162_10000533
761 Ga0163162_10001119
762 Ga0163162_10006332
763 Ga0163162_10006348
764 Ga0163162_10007342
765 Ga0163162_10023940
766 Ga0163162_10093275
767 Ga0163162_12265611
768 Ga0157372_10001035
769 Ga0157372_10015836
770 Ga0157375_10000324
771 Ga0157375_10038974
772 Ga0157375_10129561
773 Ga0157375_10131514
774 Ga0157375_10140841
775 Ga0157375_10737338
776 Ga0157375_11118828
777 Ga0157375_11585430
778 Ga0163163_10050570
779 Ga0163163_10091207
780 Ga0163163_10160212
781 Ga0163163_10204032
782 Ga0163163_10340454
783 Ga0163163_11644226
784 Ga0157380_10000544
785 Ga0157380_10001175
786 Ga0157380_10074280
787 Ga0157380_10267296
788 Ga0157380_10812029
789 Ga0157377_10006870
790 Ga0157377_10070528
791 Ga0157377_10187248
792 Ga0157379_10011377
793 Ga0157379_10017815
794 Ga0157379_10242613
795 Ga0157379_10482018
796 Ga0157376_10014701
797 Ga0157376_10152432
798 Ga0182005_1000215
799 Ga0163161_10018334
800 Ga0163161_10165769
801 Ga0163161_10337455
802 Ga0209436_101105
803 Ga0209436_104258
804 Ga0209258_100219
805 Ga0209148_1000283
806 Ga0209673_1000082
807 Ga0209564_1016912
808 Ga0209758_1002720
809 Ga0209050_1000389
810 Ga0207426_1000341
811 Ga0207426_1002748
812 Ga0207426_1004384
813 Ga0209257_1006346
814 Ga0207656_10118294
815 Ga0207682_10012126
816 Ga0207642_10444251
817 Ga0207710_10003698
818 Ga0207680_10018761
819 Ga0207647_10157281
820 Ga0207685_10153454
821 Ga0207643_10003830
822 Ga0207643_10006359
823 Ga0207684_10501660
824 Ga0207707_10114242
825 Ga0207695_10000016
826 Ga0207695_10000284
827 Ga0207695_10007537
828 Ga0207695_10064011
829 Ga0207695_10154815
830 Ga0207671_10003986
831 Ga0207671_10007233
832 Ga0207662_10023825
833 Ga0207662_10379194
834 Ga0207657_10399662
835 Ga0207649_10156669
836 Ga0207652_10684770
837 Ga0207681_10029119
838 Ga0207681_10128534
839 Ga0207681_10191622
840 Ga0207694_10027803
841 Ga0207694_10176270
842 Ga0207650_10004560
843 Ga0207650_10070478
844 Ga0207650_10578459
845 Ga0207659_10076709
846 Ga0207659_10117426
847 Ga0207659_10141018
848 Ga0207659_10145628
849 Ga0207659_10605908
850 Ga0207659_10715593
851 Ga0207706_10004736
852 Ga0207706_10195318
853 Ga0207686_10000375
854 Ga0207709_10944688
855 Ga0207670_10008310
856 Ga0207670_10140154
857 Ga0207670_10229320
858 Ga0207669_10224257
859 Ga0207704_10168677
860 Ga0207704_10315469
861 Ga0207691_10041796
862 Ga0207691_10097911
863 Ga0207691_10113602
864 Ga0207691_10190364
865 Ga0207691_10607282
866 Ga0207689_10094914
867 Ga0207689_10150367
868 Ga0207689_10184789
869 Ga0207661_10224768
870 Ga0207661_10538003
871 Ga0207679_10042344
872 Ga0207667_10002492
873 Ga0207651_10015753
874 Ga0207651_10079772
875 Ga0207651_10392242
876 Ga0207651_10435895
877 Ga0207651_10560906
878 Ga0207712_10005746
879 Ga0207712_10007534
880 Ga0207712_10018495
881 Ga0207712_10062337
882 Ga0207668_10060929
883 Ga0207668_10980644
884 Ga0207640_10006797
885 Ga0207640_10021754
886 Ga0207640_10596931
887 Ga0207677_10079715
888 Ga0207677_10225968
889 Ga0207677_10349622
890 Ga0207703_10155324
891 Ga0207703_10390598
892 Ga0207639_10006644
893 Ga0207639_10662227
894 Ga0207639_11119411
895 Ga0207708_10092307
896 Ga0207702_10194068
897 Ga0207641_10011023
898 Ga0207641_10437343
899 Ga0207641_10757980
900 Ga0207648_10002952
901 Ga0207648_10064881
902 Ga0207648_10099899
903 Ga0207648_10110786
904 Ga0207648_10262540
905 Ga0207648_11042511
906 Ga0207648_11135546
907 Ga0207676_10334145
908 Ga0207676_10447524
909 Ga0207674_10001043
910 Ga0207674_10011135
911 Ga0207674_10043287
912 Ga0207674_10158529
913 Ga0207674_10310818
914 Ga0207674_10328623
915 Ga0207675_100000359
916 Ga0207675_100164895
917 Ga0207675_100195304
918 Ga0207675_100233938
919 Ga0207675_100345372
920 Ga0207683_10182229
921 Ga0207683_10334008
922 Ga0207683_10909166
923 Ga0207698_10098134
924 Ga0207698_10119608
925 Ga0207698_10163818
926 Ga0207698_10915142
927 Ga0207428_10008958
928 Ga0268266_10000105
929 Ga0268265_10009168
930 Ga0268265_10116171
931 Ga0268264_10000013
932 Ga0268264_10001619
933 Ga0268264_10011517
934 Ga0268264_10276282
935 Ga0307515_10195608
936 Ga0265338_10429122
937 Ga0265327_10001115
938 Ga0307513_10261677
939 Ga0307509_10064127
940 Ga0265313_10114134
941 Ga0307508_10037821
942 Ga0307516_10006111
943 Ga0307405_10445604
944 Ga0307407_10319049
945 Ga0307407_10633232
946 Ga0307409_100323267
947 Ga0307411_10335264
948 Ga0307415_100448666
949 Ga0307507_10421507
950 Ga0373936_0294731
951 Ga0395900_0515713
952 Ga0395900_0520222
953 Ga0395900_0543122
954 Ga0395905_0601814
955 Ga0395905_0984611
956 Ga0395901_0073502
957 Ga0436365_0103853
958 Ga0436365_0723874
959 Ga0451843_1761783
960 Ga0451853_1170832
961 Ga0439431_0089717
962 Ga0439441_016862
963 Ga0439445_0009545
964 Ga0439449_0016574
965 Ga0439449_0055367
966 Ga0439454_032494
967 Ga0439457_036611
968 Ga0439460_0038197
969 Ga0451577_0145322
970 Ga0466969_0072296
971 Ga0466969_0301709
972 Ga0466972_0002178
973 Ga0453683_0274562
974 Ga0466964_0045800
975 Ga0453684_0248564
976 Ga0453684_0284058
977 Ga0453684_0415693
978 Ga0466968_0088056
979 Ga0466970_0056916
980 Ga0466957_0301165
981 Ga0451576_0218161
982 Ga0451576_0618816
983 Ga0451576_0785851
984 Ga0495638_0075624
985 Ga0495638_0123581
986 Ga0495638_0460974
987 Ga0495606_0080048
988 Ga0495643_0042550
989 Ga0495648_0001451
990 Ga0495635_0229609
991 Ga0495670_0209919
992 Ga0495672_0021334
993 Ga0495686_0000195
994 Ga0496110_0753594
995 Ga0496121_0000020
996 Ga0501031_0032828
997 Ga0501032_0047357
998 Ga0501033_0073950
999 Ga0501034_0011121
1000 Ga0501034_0071735
1001 Ga0501034_0161217
1002 Ga0501034_0387004
1003 Ga0501036_0043523
1004 Ga0501036_0062827
1005 Ga0501037_0008518
1006 Ga0501037_0042178
1007 Ga0501038_0010723
1008 Ga0501038_0021386
1009 Ga0501039_0047056
1010 Ga0501043_0011472
1011 Ga0501043_0094371
1012 Ga0501046_0031566
1013 Ga0501047_0032546
1014 Ga0501047_0468786
1015 Ga0501048_0037795
1016 Ga0501070_0022381
1017 Ga0501073_0000371
1018 Ga0501074_0001823
1019 Ga0501217_008429
1020 Ga0501242_007027
1021 Ga0501219_008154
1022 Ga0501080_0441006
1023 Ga0501083_0094802
1024 Ga0501266_017130
1025 Ga0501275_019296
1026 Ga0501035_0010622
1027 Ga0501035_0105923
1028 Ga0501044_0013657
1029 Ga0501044_0017262
1030 nmdc:mga0k408_213606_c1
1031 nmdc:mga0k408_283094_c1
1032 nmdc:mga05p37_1347203_c1
1033 nmdc:mga05p37_138757_c1
1034 nmdc:mga09592_174082_c1
1035 nmdc:mga09592_31136_c1
1036 nmdc:mga0qj67_873461_c1
1037 nmdc:mga06r32_241448_c1
1038 nmdc:mga08y16_3350_c1
1039 nmdc:mga08y16_904474_c1
1040 Ga0500644_0000108
1041 Ga0500646_0001854
1042 Ga0500646_0021606
1043 Ga0500641_0141480
1044 Ga0500569_000422
1045 Ga0500658_0001169
1046 Ga0500559_0114566
1047 Ga0500568_0000562
1048 Ga0500577_0155138
1049 Ga0500616_0002889
1050 Ga0500616_0020472
1051 Ga0500622_0142783
1052 Ga0500633_0000550
1053 Ga0500611_000092
1054 Ga0501084_0377737
1055 2819573768
1056 2819680504
1057 2821137103
1058 2840677598
1059 2884798085
1060 2896085416
1061 2904468155
1062 2929182797
1063 2945978752
1064 2946015381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

19

162

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v2x-assembly1.cif.gz_A-2 trmh 0.9276 5 190
1zjr-assembly1.cif.gz_A crystal structure of a. aeolicus trmh/spou trna modifying enzyme 0.8948 4 193
1v2x-assembly1.cif.gz_A-2 trmh 0.8898 5 190
7edc-assembly1.cif.gz_A-2 crystal structure of mutant trna [gm18] methyltransferase trmh (e107g) in complex with s-adenosyl-l-methionine from escherichia coli 0.881 1 186
1x7o-assembly1.cif.gz_B crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes 0.8758 16 170
ID Description Score Start End Superfamily
1v2xA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9276 5 190 3.40.1280.10
1zjrA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8948 4 193 3.40.1280.10
af_I1KWB6_105_310_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8935 1 195 3.40.1280.10
1v2xA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8898 5 190 3.40.1280.10
af_Q55BF9_32_294_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8856 1 193 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A1I4YGV5-F1-model_v4 tRNA (guanosine(18)-2'-O)-methyltransferase (EC 2.1.1.34) (tRNA [Gm18] methyltransferase) 0.9878 1 190 GO:0000049
GO:0002938
GO:0141100
AF-A0A2T7Q5P5-F1-model_v4 tRNA (guanosine(18)-2'-O)-methyltransferase (EC 2.1.1.34) (tRNA [Gm18] methyltransferase) 0.9849 1 190 GO:0000049
GO:0002938
GO:0141100
AF-A0A849URT8-F1-model_v4 tRNA (guanosine(18)-2'-O)-methyltransferase (EC 2.1.1.34) (tRNA [Gm18] methyltransferase) 0.9808 1 191 GO:0000049
GO:0002938
GO:0141100
AF-A0A3C0R9Q8-F1-model_v4 RNA methyltransferase 0.9807 1 166 GO:0000049
GO:0002938
GO:0008173
AF-A0A3C0R9Q8-F1-model_v4 RNA methyltransferase 0.9749 1 166 GO:0000049
GO:0002938
GO:0008173

Map