F460338

General Info

Members Datasets Scaffolds Average Seq Length
532 293 532 130

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_474124_c1|nmdc:mga0a205_474124_c1_77_472
Length 122
Sequence LAATIEYYGTGKRKNAVARVLLRPGQGEIKINDRDIETYFPSAVLRTVVRSPLLVTETAERFNMAGQAGAVRHGISRALLEYNTELRMKLKEAGFLTRDSRIKERKKYGQKGARKRFQFSKR

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
160 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
161 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
162 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
179 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
180 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
181 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
185 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
186 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
187 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
188 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
191 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
192 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
193 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
194 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
195 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
288 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 2.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.76
Nodule 0
Rhizoplane 1.88
Rhizosphere 93.61
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10071135 3300002239 Bacteria 623
2 JGI24742J22300_10016149 3300002244 Bacteria 1259
3 rootL2_10015203 3300003322 Bacteria 2099
4 Ga0065714_10137061 3300005288 Bacteria 1201
5 Ga0065712_10003855 3300005290 Bacteria 5392
6 Ga0065715_10143316 3300005293 Bacteria 1822
7 Ga0065707_10008765 3300005295 Bacteria 2558
8 Ga0065707_10097393 3300005295 Bacteria 3178
9 Ga0070676_10023072 3300005328 Bacteria 3495
10 Ga0070676_10167156 3300005328 Bacteria 1420
11 Ga0070690_100066053 3300005330 Bacteria 2340
12 Ga0070690_100237886 3300005330 Bacteria 1283
13 Ga0070690_100365598 3300005330 Bacteria 1051
14 Ga0070670_100011000 3300005331 Bacteria 7730
15 Ga0068869_100122584 3300005334 Bacteria 1990
16 Ga0068869_100188931 3300005334 Bacteria 1619
17 Ga0068869_100264147 3300005334 Bacteria 1379
18 Ga0068869_100501258 3300005334 Bacteria 1014
19 Ga0070666_10022827 3300005335 Bacteria 4066
20 Ga0070666_10127318 3300005335 Bacteria 1768
21 Ga0070680_100492119 3300005336 Bacteria 1049
22 Ga0070682_100085309 3300005337 Bacteria 2054
23 Ga0070689_100879759 3300005340 Bacteria 792
24 Ga0070687_100278628 3300005343 Bacteria 1051
25 Ga0070687_101269176 3300005343 Bacteria 546
26 Ga0070692_10209495 3300005345 Bacteria 1146
27 Ga0070668_100509239 3300005347 Bacteria 1043
28 Ga0070669_100000164 3300005353 Bacteria 58203
29 Ga0070669_100065955 3300005353 Bacteria 2667
30 Ga0070669_100682001 3300005353 Bacteria 866
31 Ga0070669_101295211 3300005353 Bacteria 631
32 Ga0070675_100319443 3300005354 Bacteria 1371
33 Ga0070675_100356665 3300005354 Bacteria 1298
34 Ga0070674_101148759 3300005356 Bacteria 687
35 Ga0070673_100044423 3300005364 Bacteria 3440
36 Ga0070673_100238814 3300005364 Bacteria 1579
37 Ga0070688_100353334 3300005365 Bacteria 1076
38 Ga0070688_100654026 3300005365 Bacteria 810
39 Ga0070688_100664474 3300005365 Bacteria 804
40 Ga0070688_101044665 3300005365 Bacteria 651
41 Ga0070659_101669334 3300005366 Bacteria 569
42 Ga0070667_102097513 3300005367 Bacteria 532
43 Ga0070703_10169917 3300005406 Bacteria 834
44 Ga0070709_10000083 3300005434 Bacteria 70658
45 Ga0070709_10272640 3300005434 Bacteria 1227
46 Ga0070709_11224656 3300005434 Unclassified 604
47 Ga0070713_101524428 3300005436 Bacteria 649
48 Ga0070710_10232429 3300005437 Bacteria 1178
49 Ga0070701_10087987 3300005438 Bacteria 1696
50 Ga0070700_100119768 3300005441 Bacteria 1762
51 Ga0070700_100347971 3300005441 Bacteria 1098
52 Ga0070700_100486101 3300005441 Bacteria 947
53 Ga0070694_100001347 3300005444 Bacteria 14324
54 Ga0070708_101104893 3300005445 Bacteria 743
55 Ga0070708_101469618 3300005445 Bacteria 635
56 Ga0070708_101867310 3300005445 Bacteria 557
57 Ga0070663_100582943 3300005455 Bacteria 938
58 Ga0070663_100642522 3300005455 Bacteria 896
59 Ga0070663_100682182 3300005455 Unclassified 872
60 Ga0070662_100043656 3300005457 Bacteria 3208
61 Ga0070681_10266198 3300005458 Bacteria 1625
62 Ga0068867_100319593 3300005459 Bacteria 1286
63 Ga0068867_101437055 3300005459 Bacteria 640
64 Ga0070685_10002620 3300005466 Bacteria 9214
65 Ga0070685_10500286 3300005466 Bacteria 860
66 Ga0070685_11084095 3300005466 Bacteria 604
67 Ga0070706_100253590 3300005467 Bacteria 1642
68 Ga0070706_100686934 3300005467 Bacteria 950
69 Ga0070698_100041601 3300005471 Bacteria 4717
70 Ga0070699_100000291 3300005518 Bacteria 48229
71 Ga0070699_100069114 3300005518 Bacteria 3069
72 Ga0070699_101261717 3300005518 Bacteria 678
73 Ga0070679_100061330 3300005530 Bacteria 3748
74 Ga0070684_100454525 3300005535 Bacteria 1184
75 Ga0070697_100004085 3300005536 Bacteria 11195
76 Ga0070697_100049641 3300005536 Bacteria 3406
77 Ga0070672_100169632 3300005543 Bacteria 1814
78 Ga0070672_100511948 3300005543 Bacteria 1039
79 Ga0070686_100078006 3300005544 Bacteria 2186
80 Ga0070695_100117342 3300005545 Bacteria 1816
81 Ga0070693_100716578 3300005547 Bacteria 734
82 Ga0070665_100000280 3300005548 Bacteria 83526
83 Ga0070704_100030445 3300005549 Bacteria 3617
84 Ga0070704_100141791 3300005549 Bacteria 1877
85 Ga0070704_100158377 3300005549 Bacteria 1788
86 Ga0070704_100380185 3300005549 Bacteria 1199
87 Ga0070704_100832523 3300005549 Bacteria 826
88 Ga0068855_100605004 3300005563 Bacteria 1182
89 Ga0068857_100313554 3300005577 Bacteria 1447
90 Ga0068857_100331733 3300005577 Bacteria 1406
91 Ga0068854_100250909 3300005578 Bacteria 1413
92 Ga0070702_101497065 3300005615 Bacteria 555
93 Ga0068859_100002086 3300005617 Bacteria 20362
94 Ga0068859_100002935 3300005617 Bacteria 17320
95 Ga0068859_100640559 3300005617 Bacteria 1155
96 Ga0068864_100192204 3300005618 Bacteria 1872
97 Ga0068866_10279762 3300005718 Bacteria 1033
98 Ga0068861_100020307 3300005719 Bacteria 4756
99 Ga0068861_100389986 3300005719 Bacteria 1233
100 Ga0068861_100426016 3300005719 Bacteria 1183
101 Ga0068863_100581767 3300005841 Bacteria 1107
102 Ga0068863_100938365 3300005841 Bacteria 866
103 Ga0068858_100260529 3300005842 Bacteria 1648
104 Ga0068860_100729509 3300005843 Bacteria 1002
105 Ga0068860_100872934 3300005843 Bacteria 915
106 Ga0068860_102532044 3300005843 Bacteria 533
107 Ga0068862_100001494 3300005844 Bacteria 21448
108 Ga0068862_100175623 3300005844 Unclassified 1920
109 Ga0081455_10102296 3300005937 Bacteria 2297
110 Ga0081455_10145173 3300005937 Bacteria 1837
111 Ga0081539_10000558 3300005985 Bacteria 77001
112 Ga0070717_10172670 3300006028 Bacteria 1881
113 Ga0070717_10371355 3300006028 Bacteria 1281
114 Ga0075368_10020789 3300006042 Bacteria 2487
115 Ga0075368_10034245 3300006042 Bacteria 1978
116 Ga0075363_100150966 3300006048 Bacteria 1311
117 Ga0075364_10450390 3300006051 Bacteria 879
118 Ga0070715_10515768 3300006163 Bacteria 687
119 Ga0070716_100012129 3300006173 Bacteria 4360
120 Ga0070712_100765704 3300006175 Bacteria 827
121 Ga0075367_10240034 3300006178 Bacteria 1135
122 Ga0075427_10115501 3300006194 Bacteria 508
123 Ga0075366_10051128 3300006195 Bacteria 2455
124 Ga0075370_10044896 3300006353 Bacteria 2498
125 Ga0068871_100390955 3300006358 Bacteria 1237
126 Ga0068871_100541759 3300006358 Bacteria 1053
127 Ga0068871_101112681 3300006358 Bacteria 739
128 Ga0075428_100006266 3300006844 Bacteria 13226
129 Ga0075428_100018361 3300006844 Bacteria 7733
130 Ga0075428_100413861 3300006844 Bacteria 1444
131 Ga0075431_100027553 3300006847 Bacteria 5832
132 Ga0075431_100330565 3300006847 Bacteria 1535
133 Ga0075431_100575504 3300006847 Bacteria 1112
134 Ga0075431_100699802 3300006847 Bacteria 991
135 Ga0075433_10024087 3300006852 Bacteria 5133
136 Ga0075433_10076205 3300006852 Bacteria 2953
137 Ga0075433_10366838 3300006852 Bacteria 1272
138 Ga0075433_10821858 3300006852 Bacteria 812
139 Ga0075434_100057271 3300006871 Bacteria 3873
140 Ga0075434_100134374 3300006871 Bacteria 2493
141 Ga0075434_100287013 3300006871 Bacteria 1665
142 Ga0075434_100318467 3300006871 Bacteria 1576
143 Ga0075434_100530671 3300006871 Bacteria 1197
144 Ga0075434_101569744 3300006871 Bacteria 667
145 Ga0068865_100323411 3300006881 Bacteria 1241
146 Ga0068865_100732029 3300006881 Bacteria 848
147 Ga0068865_101121506 3300006881 Bacteria 694
148 Ga0075436_100019506 3300006914 Bacteria 4647
149 Ga0097620_100002086 3300006931 Bacteria 20362
150 Ga0097620_100002935 3300006931 Bacteria 17320
151 Ga0097620_100640571 3300006931 Bacteria 1155
152 Ga0075435_100032075 3300007076 Bacteria 4147
153 Ga0075435_100066042 3300007076 Bacteria 2942
154 Ga0075435_100421965 3300007076 Bacteria 1149
155 Ga0105240_10102383 3300009093 Bacteria 3480
156 Ga0111539_10053096 3300009094 Bacteria 4824
157 Ga0111539_10165868 3300009094 Bacteria 2582
158 Ga0111539_10166749 3300009094 Bacteria 2575
159 Ga0111539_10421578 3300009094 Bacteria 1554
160 Ga0105245_10043090 3300009098 Bacteria 4026
161 Ga0114129_10028282 3300009147 Bacteria 7943
162 Ga0114129_10037893 3300009147 Bacteria 6803
163 Ga0114129_10241081 3300009147 Bacteria 2430
164 Ga0114129_10378323 3300009147 Bacteria 1870
165 Ga0114129_10869930 3300009147 Bacteria 1144
166 Ga0114129_10981291 3300009147 Bacteria 1065
167 Ga0114129_11684671 3300009147 Bacteria 774
168 Ga0114129_11687242 3300009147 Bacteria 773
169 Ga0105243_10379088 3300009148 Bacteria 1308
170 Ga0105243_11191632 3300009148 Bacteria 774
171 Ga0105241_10096797 3300009174 Bacteria 2339
172 Ga0105242_10155632 3300009176 Bacteria 1996
173 Ga0105242_10520256 3300009176 Bacteria 1135
174 Ga0105242_10632897 3300009176 Bacteria 1038
175 Ga0105238_11227710 3300009551 Bacteria 774
176 Ga0105249_10116457 3300009553 Bacteria 2533
177 Ga0105249_10226052 3300009553 Bacteria 1844
178 Ga0105249_10512621 3300009553 Bacteria 1246
179 Ga0105249_10760271 3300009553 Bacteria 1031
180 Ga0105249_12235691 3300009553 Bacteria 620
181 Ga0105249_13400426 3300009553 Bacteria 512
182 Ga0157369_10279877 3300013105 Bacteria 1737
183 Ga0157378_10455153 3300013297 Bacteria 1271
184 Ga0163162_11315190 3300013306 Bacteria 821
185 Ga0163162_11339418 3300013306 Bacteria 814
186 Ga0157375_10037412 3300013308 Bacteria 4650
187 Ga0157375_10367711 3300013308 Bacteria 1604
188 Ga0157375_10497625 3300013308 Bacteria 1383
189 Ga0163163_10131955 3300014325 Bacteria 2538
190 Ga0163163_11131908 3300014325 Bacteria 846
191 Ga0163163_12880754 3300014325 Unclassified 537
192 Ga0157380_10963869 3300014326 Bacteria 884
193 Ga0157380_12470345 3300014326 Bacteria 585
194 Ga0157380_12751764 3300014326 Bacteria 558
195 Ga0157377_10657843 3300014745 Bacteria 755
196 Ga0163161_10259788 3300017792 Bacteria 1356
197 Ga0206356_10280488 3300020070 Bacteria 2190
198 Ga0224712_10078995 3300022467 Bacteria 1354
199 Ga0207697_10354283 3300025315 Bacteria 652
200 Ga0207653_10138597 3300025885 Bacteria 888
201 Ga0207692_10212724 3300025898 Bacteria 1142
202 Ga0207688_10022213 3300025901 Bacteria 3470
203 Ga0207680_10073099 3300025903 Bacteria 2131
204 Ga0207680_10310372 3300025903 Bacteria 1101
205 Ga0207680_10723624 3300025903 Bacteria 713
206 Ga0207699_10000084 3300025906 Bacteria 70467
207 Ga0207699_10228473 3300025906 Bacteria 1274
208 Ga0207699_10884597 3300025906 Unclassified 659
209 Ga0207645_10013115 3300025907 Bacteria 5599
210 Ga0207645_10904726 3300025907 Bacteria 599
211 Ga0207645_11066913 3300025907 Bacteria 546
212 Ga0207705_10019852 3300025909 Bacteria 4807
213 Ga0207695_10117274 3300025913 Bacteria 2635
214 Ga0207660_10631401 3300025917 Bacteria 873
215 Ga0207652_10397720 3300025921 Bacteria 1243
216 Ga0207646_10521441 3300025922 Bacteria 1070
217 Ga0207681_10000056 3300025923 Bacteria 106145
218 Ga0207681_10050655 3300025923 Bacteria 2810
219 Ga0207681_11224867 3300025923 Bacteria 630
220 Ga0207694_10743660 3300025924 Bacteria 828
221 Ga0207650_10152892 3300025925 Bacteria 1822
222 Ga0207650_10315765 3300025925 Bacteria 1279
223 Ga0207659_10276960 3300025926 Bacteria 1370
224 Ga0207659_11310176 3300025926 Bacteria 622
225 Ga0207700_10140695 3300025928 Bacteria 1982
226 Ga0207700_11001870 3300025928 Bacteria 748
227 Ga0207700_11031704 3300025928 Unclassified 736
228 Ga0207706_10228635 3300025933 Bacteria 1628
229 Ga0207706_10855485 3300025933 Bacteria 770
230 Ga0207686_10445831 3300025934 Bacteria 995
231 Ga0207709_10415395 3300025935 Bacteria 1032
232 Ga0207709_10851898 3300025935 Bacteria 738
233 Ga0207670_10192965 3300025936 Bacteria 1542
234 Ga0207670_10639848 3300025936 Bacteria 876
235 Ga0207669_10006694 3300025937 Bacteria 5284
236 Ga0207704_10316650 3300025938 Bacteria 1202
237 Ga0207704_10495668 3300025938 Bacteria 983
238 Ga0207704_10654450 3300025938 Bacteria 866
239 Ga0207704_11191794 3300025938 Bacteria 649
240 Ga0207665_10014606 3300025939 Bacteria 5169
241 Ga0207691_10012366 3300025940 Bacteria 8181
242 Ga0207691_10801599 3300025940 Unclassified 791
243 Ga0207711_11067443 3300025941 Unclassified 748
244 Ga0207689_10057239 3300025942 Bacteria 3207
245 Ga0207689_10092815 3300025942 Bacteria 2480
246 Ga0207689_10143324 3300025942 Bacteria 1969
247 Ga0207689_11002748 3300025942 Bacteria 704
248 Ga0207667_11514451 3300025949 Bacteria 641
249 Ga0207651_10099523 3300025960 Bacteria 2153
250 Ga0207651_10418676 3300025960 Bacteria 1143
251 Ga0207712_10250909 3300025961 Bacteria 1430
252 Ga0207712_10363984 3300025961 Bacteria 1206
253 Ga0207712_10565236 3300025961 Bacteria 980
254 Ga0207712_12003210 3300025961 Bacteria 518
255 Ga0207658_10903684 3300025986 Bacteria 804
256 Ga0207677_11652512 3300026023 Bacteria 593
257 Ga0207703_10494871 3300026035 Bacteria 1147
258 Ga0207678_10088138 3300026067 Bacteria 2652
259 Ga0207678_10304998 3300026067 Bacteria 1369
260 Ga0207708_10007629 3300026075 Bacteria 8005
261 Ga0207708_10103163 3300026075 Bacteria 2209
262 Ga0207708_10445239 3300026075 Bacteria 1078
263 Ga0207708_11096905 3300026075 Bacteria 694
264 Ga0207702_11741863 3300026078 Bacteria 616
265 Ga0207641_10757831 3300026088 Bacteria 959
266 Ga0207648_10170150 3300026089 Bacteria 1926
267 Ga0207676_10105833 3300026095 Bacteria 2343
268 Ga0207676_10641639 3300026095 Bacteria 1024
269 Ga0207674_10488762 3300026116 Bacteria 1190
270 Ga0207674_10883406 3300026116 Bacteria 862
271 Ga0207675_100043836 3300026118 Bacteria 4179
272 Ga0207675_100063773 3300026118 Bacteria 3443
273 Ga0207675_100982722 3300026118 Bacteria 862
274 Ga0207683_11711497 3300026121 Bacteria 578
275 Ga0207683_11822542 3300026121 Bacteria 557
276 Ga0207698_12543170 3300026142 Bacteria 522
277 Ga0209813_10028285 3300027866 Bacteria 1634
278 Ga0209813_10115076 3300027866 Bacteria 930
279 Ga0209813_10184074 3300027866 Bacteria 766
280 Ga0207428_10168769 3300027907 Bacteria 1658
281 Ga0207428_10294840 3300027907 Bacteria 1201
282 Ga0268266_10001178 3300028379 Bacteria 32300
283 Ga0268265_10000230 3300028380 Bacteria 63968
284 Ga0268265_10284570 3300028380 Bacteria 1481
285 Ga0268265_10587260 3300028380 Bacteria 1063
286 Ga0268264_10102310 3300028381 Bacteria 2493
287 Ga0268264_10255483 3300028381 Bacteria 1630
288 Ga0268264_11144258 3300028381 Bacteria 787
289 Ga0268264_11193180 3300028381 Bacteria 770
290 Ga0268264_11535887 3300028381 Bacteria 676
291 Ga0268264_12041901 3300028381 Bacteria 582
292 Ga0307511_10021467 3300030521 Bacteria 6081
293 Ga0307408_101311951 3300031548 Bacteria 679
294 Ga0316575_10013931 3300031665 Bacteria 3013
295 Ga0316576_10061175 3300031727 Bacteria 2759
296 Ga0316576_10091432 3300031727 Bacteria 2267
297 Ga0316576_10094456 3300031727 Bacteria 2230
298 Ga0316576_10104774 3300031727 Bacteria 2117
299 Ga0316576_10213457 3300031727 Bacteria 1452
300 Ga0316578_10017974 3300031728 Bacteria 3862
301 Ga0316578_10026254 3300031728 Bacteria 3283
302 Ga0316577_10059560 3300031733 Bacteria 2131
303 Ga0316577_10243189 3300031733 Bacteria 1018
304 Ga0316577_10311415 3300031733 Bacteria 892
305 Ga0307416_102041733 3300032002 Bacteria 676
306 Ga0316583_10003154 3300032133 Bacteria 5794
307 Ga0316583_10004720 3300032133 Bacteria 4865
308 Ga0316583_10029653 3300032133 Bacteria 1950
309 Ga0316583_10131006 3300032133 Bacteria 874
310 Ga0316585_10001279 3300032137 Bacteria 6587
311 Ga0316580_10141064 3300032139 Bacteria 739
312 Ga0316593_10032088 3300032168 Bacteria 1714
313 Ga0316593_10056123 3300032168 Bacteria 1339
314 Ga0316593_10149565 3300032168 Bacteria 849
315 Ga0373929_0000001 3300035085 Bacteria 956023
316 Ga0373934_0008552 3300035086 Bacteria 3816
317 Ga0373923_0451656 3300035111 Bacteria 623
318 Ga0373941_0287476 3300035115 Bacteria 652
319 Ga0373954_0027288 3300035118 Bacteria 2620
320 Ga0373956_0119716 3300035119 Bacteria 1229
321 Ga0373956_0402060 3300035119 Bacteria 653
322 Ga0373957_0289497 3300035120 Bacteria 693
323 Ga0373943_0262970 3300035170 Bacteria 972
324 Ga0373955_0711254 3300035172 Bacteria 617
325 Ga0316574_0020417 3300035398 Bacteria 3921
326 Ga0316574_0081022 3300035398 Bacteria 2061
327 Ga0316574_0483000 3300035398 Bacteria 774
328 Ga0316574_0537124 3300035398 Bacteria 727
329 Ga0373935_0277291 3300035692 Bacteria 1180
330 Ga0373933_0010133 3300035724 Bacteria 5160
331 Ga0373933_0768769 3300035724 Bacteria 634
332 Ga0373937_0002505 3300036401 Bacteria 15255
333 Ga0373937_0006813 3300036401 Bacteria 9859
334 Ga0316582_0038604 3300036647 Bacteria 2969
335 Ga0316582_0092199 3300036647 Bacteria 1996
336 Ga0316582_0257144 3300036647 Bacteria 1197
337 Ga0316584_0093223 3300036712 Bacteria 2255
338 Ga0316584_0165820 3300036712 Bacteria 1640
339 Ga0400483_015074 3300039062 Bacteria 1960
340 Ga0451789_0711377 3300041443 Bacteria 1197
341 Ga0451797_1350670 3300041453 Bacteria 1073
342 Ga0451795_0324929 3300041456 Bacteria 657
343 Ga0451802_0479589 3300041460 Bacteria 2023
344 Ga0451802_1679855 3300041460 Bacteria 1053
345 Ga0451807_0377212 3300041486 Bacteria 1876
346 Ga0451807_2063280 3300041486 Bacteria 1527
347 Ga0451841_0760955 3300041498 Bacteria 540
348 Ga0439431_0050350 3300041997 Bacteria 1079
349 Ga0439433_0065882 3300041999 Bacteria 869
350 Ga0439442_037960 3300042002 Bacteria 1010
351 Ga0439445_0165698 3300042004 Bacteria 646
352 Ga0439449_0093936 3300042007 Bacteria 1108
353 Ga0450920_012036 3300042122 Bacteria 1618
354 Ga0450895_001666 3300042132 Bacteria 1571
355 Ga0450896_001923 3300042133 Bacteria 2636
356 Ga0450906_012541 3300042145 Bacteria 1570
357 Ga0450910_033902 3300042147 Bacteria 809
358 Ga0450908_016281 3300042184 Bacteria 1327
359 Ga0451577_0056839 3300042876 Bacteria 3490
360 Ga0451577_0082175 3300042876 Bacteria 2873
361 Ga0451577_1198408 3300042876 Bacteria 677
362 Ga0451577_1584705 3300042876 Bacteria 578
363 Ga0453683_0113285 3300044673 Bacteria 1706
364 Ga0453683_0833824 3300044673 Bacteria 608
365 Ga0453683_1143828 3300044673 Bacteria 520
366 Ga0453684_0101505 3300044712 Bacteria 3520
367 Ga0453684_0549334 3300044712 Bacteria 1272
368 Ga0453684_1622476 3300044712 Bacteria 663
369 Ga0466960_0025774 3300044901 Bacteria 2664
370 Ga0451576_0041983 3300045051 Bacteria 4830
371 Ga0451576_1159845 3300045051 Bacteria 807
372 Ga0466967_2217173 3300045976 Bacteria 545
373 Ga0495629_0001085 3300046459 Bacteria 21608
374 Ga0495629_0018969 3300046459 Bacteria 4919
375 Ga0495638_0006310 3300046460 Bacteria 8643
376 Ga0495638_0255107 3300046460 Bacteria 965
377 Ga0495651_0305636 3300046462 Bacteria 1065
378 Ga0495582_0007932 3300046473 Bacteria 5866
379 Ga0495639_0002890 3300046475 Bacteria 7477
380 Ga0495639_0016731 3300046475 Bacteria 3184
381 Ga0495662_0038269 3300046476 Bacteria 2318
382 Ga0495594_0004579 3300046499 Bacteria 7116
383 Ga0495594_0540581 3300046499 Bacteria 661
384 Ga0495596_0176640 3300046500 Bacteria 830
385 Ga0495630_1296817 3300046517 Bacteria 549
386 Ga0495644_0386885 3300046523 Bacteria 553
387 Ga0495663_0142217 3300046525 Bacteria 815
388 Ga0495640_0663727 3300046533 Bacteria 627
389 Ga0495586_0063358 3300046535 Bacteria 2014
390 Ga0495587_0127747 3300046536 Bacteria 1454
391 Ga0495587_0292827 3300046536 Bacteria 911
392 Ga0495598_0059278 3300046537 Bacteria 1176
393 Ga0495621_0067321 3300046539 Bacteria 1312
394 Ga0495645_0759853 3300046543 Bacteria 584
395 Ga0495622_0221978 3300046557 Bacteria 837
396 Ga0495633_0114400 3300046558 Bacteria 1251
397 Ga0495656_0217655 3300046615 Bacteria 954
398 Ga0495668_0296147 3300046616 Bacteria 887
399 Ga0495634_0860124 3300046642 Bacteria 515
400 Ga0495635_0001421 3300046663 Bacteria 15967
401 Ga0495658_0000401 3300046683 Bacteria 24251
402 Ga0495669_0678074 3300046684 Bacteria 501
403 Ga0495600_0901904 3300046809 Bacteria 521
404 Ga0495581_0000586 3300047315 Bacteria 19006
405 Ga0495581_0053939 3300047315 Bacteria 2321
406 Ga0495636_0421282 3300047318 Bacteria 638
407 Ga0495672_0205463 3300047320 Bacteria 982
408 Ga0495676_0130421 3300047321 Bacteria 1815
409 Ga0495680_0003220 3300047322 Bacteria 16223
410 Ga0495680_0148675 3300047322 Bacteria 1709
411 Ga0495602_0325974 3300048088 Bacteria 1116
412 Ga0495602_0539759 3300048088 Bacteria 810
413 Ga0495614_0095409 3300048089 Bacteria 1296
414 Ga0496103_0235257 3300048906 Bacteria 1179
415 Ga0496104_1056706 3300048907 Bacteria 716
416 Ga0496109_0749565 3300048912 Bacteria 914
417 Ga0501306_013195 3300049127 Bacteria 1075
418 Ga0501311_041273 3300049527 Bacteria 700
419 Ga0501316_044664 3300049532 Bacteria 626
420 Ga0501324_019133 3300049540 Bacteria 690
421 Ga0501032_0390246 3300049569 Bacteria 895
422 Ga0501033_0924096 3300049570 Bacteria 586
423 Ga0501037_0370105 3300049573 Bacteria 986
424 Ga0501038_0005479 3300049574 Bacteria 11789
425 Ga0501038_0208259 3300049574 Bacteria 1566
426 Ga0501039_0199847 3300049575 Bacteria 1572
427 Ga0501039_0434341 3300049575 Bacteria 1031
428 Ga0501039_0879123 3300049575 Bacteria 698
429 Ga0501040_0147414 3300049576 Bacteria 1659
430 Ga0501040_0722678 3300049576 Bacteria 720
431 Ga0501041_0053510 3300049577 Bacteria 2462
432 Ga0501042_0228606 3300049578 Bacteria 1342
433 Ga0501042_0444645 3300049578 Unclassified 940
434 Ga0501043_0014065 3300049579 Bacteria 6264
435 Ga0501046_0096966 3300049580 Bacteria 2265
436 Ga0501047_0002850 3300049581 Bacteria 16394
437 Ga0501047_1249521 3300049581 Bacteria 556
438 Ga0501048_0255283 3300049582 Bacteria 1245
439 Ga0501067_0002959 3300049583 Bacteria 9375
440 Ga0501068_0000298 3300049584 Bacteria 24810
441 Ga0501068_0274123 3300049584 Unclassified 1077
442 Ga0501069_0011603 3300049585 Bacteria 4670
443 Ga0501070_0115439 3300049586 Bacteria 2218
444 Ga0501071_0495094 3300049587 Bacteria 937
445 Ga0501072_0000013 3300049588 Bacteria 172318
446 Ga0501073_0001560 3300049589 Bacteria 16979
447 Ga0501073_0264198 3300049589 Bacteria 1188
448 Ga0501073_0315907 3300049589 Bacteria 1078
449 Ga0501074_0001093 3300049590 Bacteria 17708
450 Ga0501074_0902534 3300049590 Bacteria 622
451 Ga0501075_0462092 3300049591 Bacteria 968
452 Ga0501076_0005208 3300049592 Bacteria 9316
453 Ga0501076_0140135 3300049592 Bacteria 1964
454 Ga0501076_1148669 3300049592 Bacteria 639
455 Ga0501077_0042009 3300049593 Bacteria 2909
456 Ga0501230_168431 3300049667 Bacteria 502
457 Ga0501079_0000583 3300049741 Bacteria 24201
458 Ga0501079_0063163 3300049741 Bacteria 2857
459 Ga0501079_0426994 3300049741 Bacteria 1040
460 Ga0501080_0084855 3300049742 Bacteria 2942
461 Ga0501080_0246537 3300049742 Bacteria 1629
462 Ga0501080_0439657 3300049742 Bacteria 1170
463 Ga0501080_1292158 3300049742 Bacteria 625
464 Ga0501080_1713744 3300049742 Bacteria 530
465 Ga0501081_0070245 3300049743 Bacteria 2440
466 Ga0501081_0259804 3300049743 Bacteria 1269
467 Ga0501081_0932991 3300049743 Bacteria 655
468 Ga0501083_0002132 3300049744 Bacteria 13574
469 Ga0501083_0004309 3300049744 Bacteria 10023
470 Ga0501083_0006433 3300049744 Bacteria 8333
471 Ga0501083_0280312 3300049744 Bacteria 1084
472 Ga0501263_021577 3300049760 Bacteria 870
473 Ga0501035_0437120 3300049822 Unclassified 1084
474 Ga0501044_0061437 3300049823 Bacteria 3843
475 Ga0501045_0180083 3300049824 Bacteria 1575
476 Ga0501045_0965338 3300049824 Bacteria 625
477 nmdc:mga00v17_289450_c1 3300050491 Bacteria 1064
478 nmdc:mga0k408_16714_c2 3300050493 Bacteria 3730
479 nmdc:mga0k408_292593_c1 3300050493 Bacteria 972
480 nmdc:mga06z11_15279_c1 3300050494 Bacteria 3423
481 nmdc:mga04h51_102557_c1 3300050495 Bacteria 1044
482 nmdc:mga04h51_248068_c1 3300050495 Bacteria 713
483 nmdc:mga04h51_39600_c1 3300050495 Bacteria 1532
484 nmdc:mga07m45_151571_c1 3300050496 Bacteria 1345
485 nmdc:mga05p37_116790_c1 3300050507 Bacteria 3279
486 nmdc:mga05p37_1221939_c1 3300050507 Bacteria 774
487 nmdc:mga05p37_1629851_c1 3300050507 Bacteria 634
488 nmdc:mga05p37_367163_c1 3300050507 Bacteria 1690
489 nmdc:mga05p37_45244_c1 3300050507 Bacteria 5415
490 nmdc:mga05p37_720777_c1 3300050507 Bacteria 1104
491 nmdc:mga05p37_7671_c1 3300050507 Bacteria 12731
492 nmdc:mga05p37_89941_c1 3300050507 Bacteria 3783
493 nmdc:mga06r32_361101_c1 3300050510 Bacteria 1436
494 nmdc:mga06r32_49737_c2 3300050510 Bacteria 1033
495 nmdc:mga06r32_532091_c1 3300050510 Bacteria 759
496 nmdc:mga06r32_648054_c1 3300050510 Bacteria 1024
497 nmdc:mga08y16_154847_c1 3300050511 Bacteria 2382
498 nmdc:mga08y16_1757066_c1 3300050511 Bacteria 574
499 nmdc:mga08y16_483482_c1 3300050511 Bacteria 1260
500 nmdc:mga0n895_105622_c1 3300050512 Bacteria 2829
501 nmdc:mga0n895_1750244_c1 3300050512 Bacteria 583
502 nmdc:mga0n895_246885_c1 3300050512 Bacteria 1812
503 nmdc:mga0n895_442043_c1 3300050512 Bacteria 1314
504 nmdc:mga0n895_83882_c1 3300050512 Bacteria 3179
505 nmdc:mga0rr50_223925_c1 3300050513 Bacteria 1554
506 nmdc:mga0rr50_253929_c1 3300050513 Bacteria 1461
507 nmdc:mga0rr50_43944_c1 3300050513 Bacteria 3273
508 nmdc:mga0rr50_67190_c1 3300050513 Bacteria 2722
509 nmdc:mga0rr50_697722_c1 3300050513 Bacteria 866
510 nmdc:mga08x19_449669_c1 3300050514 Bacteria 907
511 nmdc:mga0a205_174267_c1 3300050515 Bacteria 2047
512 nmdc:mga0a205_194006_c1 3300050515 Bacteria 1922
513 nmdc:mga0a205_474124_c1 3300050515 Bacteria 1110
514 nmdc:mga0a205_556941_c1 3300050515 Bacteria 1001
515 nmdc:mga0a205_601841_c1 3300050515 Bacteria 952
516 Ga0495619_0006248 3300053085 Bacteria 7557
517 Ga0495619_0710808 3300053085 Bacteria 683
518 Ga0495619_0753490 3300053085 Bacteria 660
519 Ga0500592_028656 3300053116 Bacteria 898
520 Ga0500568_0004595 3300053139 Bacteria 7346
521 Ga0501084_0000136 3300054114 Bacteria 55694
522 Ga0501084_0035628 3300054114 Bacteria 4160
523 Ga0501084_0649817 3300054114 Bacteria 890
524 Ga0501084_1445030 3300054114 Bacteria 576
525 Ga0587066_160779 3300059490 Bacteria 564
526 Ga0587111_0023103 3300060346 Bacteria 1213
527 Ga0501082_0000651 3300060353 Bacteria 30636
528 Ga0501082_0051914 3300060353 Bacteria 3534
529 Ga0501082_0053520 3300060353 Bacteria 3479
530 Ga0530510_0011015 3300061734 Bacteria 6344
531 Ga0530510_0108011 3300061734 Bacteria 2037
532 Ga0530510_0234601 3300061734 Bacteria 1365

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_1198408 Ga0451577_1198408_308_640 110
2 3300042876 Ga0451577_1584705 Ga0451577_1584705_34_366 110
3 3300009094 Ga0111539_10165868 Ga0111539_101658682 112
4 3300009147 Ga0114129_10981291 Ga0114129_109812912 112
5 3300009553 Ga0105249_10226052 Ga0105249_102260523 112
6 3300035086 Ga0373934_0008552 Ga0373934_0008552_3296_3634 112
7 3300035118 Ga0373954_0027288 Ga0373954_0027288_818_1156 112
8 3300035119 Ga0373956_0402060 Ga0373956_0402060_219_557 112
9 3300035120 Ga0373957_0289497 Ga0373957_0289497_227_565 112
10 3300035724 Ga0373933_0010133 Ga0373933_0010133_591_929 112
11 3300036401 Ga0373937_0002505 Ga0373937_0002505_7254_7592 112
12 3300042122 Ga0450920_012036 Ga0450920_012036_1070_1408 112
13 3300042132 Ga0450895_001666 Ga0450895_001666_157_495 112
14 3300042133 Ga0450896_001923 Ga0450896_001923_26_364 112
15 3300042145 Ga0450906_012541 Ga0450906_012541_646_984 112
16 3300042147 Ga0450910_033902 Ga0450910_033902_442_780 112
17 3300042184 Ga0450908_016281 Ga0450908_016281_901_1239 112
18 3300044673 Ga0453683_1143828 Ga0453683_1143828_163_501 112
19 3300046462 Ga0495651_0305636 Ga0495651_0305636_706_1044 112
20 3300046536 Ga0495587_0292827 Ga0495587_0292827_352_690 112
21 3300047322 Ga0495680_0148675 Ga0495680_0148675_1206_1544 112
22 3300048088 Ga0495602_0539759 Ga0495602_0539759_64_402 112
23 3300049742 Ga0501080_1292158 Ga0501080_1292158_243_581 112
24 3300049743 Ga0501081_0259804 Ga0501081_0259804_805_1143 112
25 3300050507 nmdc:mga05p37_720777_c1 nmdc:mga05p37_720777_c1_438_776 112
26 3300046535 Ga0495586_0063358 Ga0495586_0063358_170_520 114
27 3300025934 Ga0207686_10445831 Ga0207686_104458312 115
28 3300050515 nmdc:mga0a205_474124_c1 nmdc:mga0a205_474124_c1_77_472 121
29 3300049570 Ga0501033_0924096 Ga0501033_0924096_173_559 128
30 3300049574 Ga0501038_0208259 Ga0501038_0208259_1165_1551 128
31 3300049575 Ga0501039_0199847 Ga0501039_0199847_477_863 128
32 3300049576 Ga0501040_0147414 Ga0501040_0147414_839_1225 128
33 3300049577 Ga0501041_0053510 Ga0501041_0053510_1529_1915 128
34 3300049578 Ga0501042_0444645 Ga0501042_0444645_485_871 128
35 3300049580 Ga0501046_0096966 Ga0501046_0096966_946_1332 128
36 3300049584 Ga0501068_0274123 Ga0501068_0274123_75_461 128
37 3300049590 Ga0501074_0902534 Ga0501074_0902534_128_514 128
38 3300049591 Ga0501075_0462092 Ga0501075_0462092_378_764 128
39 3300049592 Ga0501076_0140135 Ga0501076_0140135_601_987 128
40 3300049741 Ga0501079_0063163 Ga0501079_0063163_2079_2465 128
41 3300049742 Ga0501080_0246537 Ga0501080_0246537_413_799 128
42 3300049743 Ga0501081_0070245 Ga0501081_0070245_1920_2306 128
43 3300049744 Ga0501083_0280312 Ga0501083_0280312_525_911 128
44 3300049822 Ga0501035_0437120 Ga0501035_0437120_37_423 128
45 3300049824 Ga0501045_0965338 Ga0501045_0965338_154_540 128
46 3300054114 Ga0501084_0649817 Ga0501084_0649817_403_789 128
47 3300060353 Ga0501082_0051914 Ga0501082_0051914_1634_2020 128
48 3300005334 Ga0068869_100501258 Ga0068869_1005012582 129
49 3300006871 Ga0075434_100318467 Ga0075434_1003184673 129
50 3300025942 Ga0207689_10143324 Ga0207689_101433243 129
51 3300031548 Ga0307408_101311951 Ga0307408_1013119512 129
52 3300046543 Ga0495645_0759853 Ga0495645_0759853_110_502 129
53 3300050493 nmdc:mga0k408_292593_c1 nmdc:mga0k408_292593_c1_339_728 129
54 3300050495 nmdc:mga04h51_102557_c1 nmdc:mga04h51_102557_c1_173_562 129
55 3300050512 nmdc:mga0n895_1750244_c1 nmdc:mga0n895_1750244_c1_49_441 129
56 3300002239 JGI24034J26672_10071135 JGI24034J26672_100711352 130
57 3300002244 JGI24742J22300_10016149 JGI24742J22300_100161492 130
58 3300003322 rootL2_10015203 rootL2_100152031 130
59 3300005288 Ga0065714_10137061 Ga0065714_101370611 130
60 3300005290 Ga0065712_10003855 Ga0065712_100038559 130
61 3300005293 Ga0065715_10143316 Ga0065715_101433162 130
62 3300005295 Ga0065707_10008765 Ga0065707_100087653 130
63 3300005295 Ga0065707_10097393 Ga0065707_100973934 130
64 3300005328 Ga0070676_10023072 Ga0070676_100230725 130
65 3300005328 Ga0070676_10167156 Ga0070676_101671561 130
66 3300005330 Ga0070690_100066053 Ga0070690_1000660533 130
67 3300005330 Ga0070690_100237886 Ga0070690_1002378861 130
68 3300005330 Ga0070690_100365598 Ga0070690_1003655982 130
69 3300005331 Ga0070670_100011000 Ga0070670_1000110003 130
70 3300005334 Ga0068869_100122584 Ga0068869_1001225842 130
71 3300005334 Ga0068869_100188931 Ga0068869_1001889312 130
72 3300005334 Ga0068869_100264147 Ga0068869_1002641472 130
73 3300005335 Ga0070666_10022827 Ga0070666_100228275 130
74 3300005335 Ga0070666_10127318 Ga0070666_101273182 130
75 3300005336 Ga0070680_100492119 Ga0070680_1004921192 130
76 3300005337 Ga0070682_100085309 Ga0070682_1000853092 130
77 3300005340 Ga0070689_100879759 Ga0070689_1008797592 130
78 3300005343 Ga0070687_100278628 Ga0070687_1002786282 130
79 3300005343 Ga0070687_101269176 Ga0070687_1012691761 130
80 3300005345 Ga0070692_10209495 Ga0070692_102094952 130
81 3300005347 Ga0070668_100509239 Ga0070668_1005092392 130
82 3300005353 Ga0070669_100000164 Ga0070669_10000016442 130
83 3300005353 Ga0070669_100065955 Ga0070669_1000659554 130
84 3300005353 Ga0070669_100682001 Ga0070669_1006820012 130
85 3300005353 Ga0070669_101295211 Ga0070669_1012952111 130
86 3300005354 Ga0070675_100319443 Ga0070675_1003194432 130
87 3300005354 Ga0070675_100356665 Ga0070675_1003566652 130
88 3300005356 Ga0070674_101148759 Ga0070674_1011487591 130
89 3300005364 Ga0070673_100044423 Ga0070673_1000444232 130
90 3300005364 Ga0070673_100238814 Ga0070673_1002388142 130
91 3300005365 Ga0070688_100353334 Ga0070688_1003533342 130
92 3300005365 Ga0070688_100654026 Ga0070688_1006540262 130
93 3300005365 Ga0070688_100664474 Ga0070688_1006644742 130
94 3300005365 Ga0070688_101044665 Ga0070688_1010446652 130
95 3300005366 Ga0070659_101669334 Ga0070659_1016693341 130
96 3300005367 Ga0070667_102097513 Ga0070667_1020975131 130
97 3300005406 Ga0070703_10169917 Ga0070703_101699172 130
98 3300005434 Ga0070709_10000083 Ga0070709_100000838 130
99 3300005434 Ga0070709_10272640 Ga0070709_102726402 130
100 3300005434 Ga0070709_11224656 Ga0070709_112246561 130
101 3300005436 Ga0070713_101524428 Ga0070713_1015244281 130
102 3300005437 Ga0070710_10232429 Ga0070710_102324291 130
103 3300005438 Ga0070701_10087987 Ga0070701_100879872 130
104 3300005441 Ga0070700_100119768 Ga0070700_1001197683 130
105 3300005441 Ga0070700_100347971 Ga0070700_1003479712 130
106 3300005441 Ga0070700_100486101 Ga0070700_1004861012 130
107 3300005444 Ga0070694_100001347 Ga0070694_10000134720 130
108 3300005445 Ga0070708_101104893 Ga0070708_1011048932 130
109 3300005445 Ga0070708_101469618 Ga0070708_1014696181 130
110 3300005445 Ga0070708_101867310 Ga0070708_1018673101 130
111 3300005455 Ga0070663_100582943 Ga0070663_1005829432 130
112 3300005455 Ga0070663_100642522 Ga0070663_1006425222 130
113 3300005455 Ga0070663_100682182 Ga0070663_1006821822 130
114 3300005457 Ga0070662_100043656 Ga0070662_1000436562 130
115 3300005458 Ga0070681_10266198 Ga0070681_102661982 130
116 3300005459 Ga0068867_100319593 Ga0068867_1003195932 130
117 3300005459 Ga0068867_101437055 Ga0068867_1014370551 130
118 3300005466 Ga0070685_10002620 Ga0070685_1000262010 130
119 3300005466 Ga0070685_10500286 Ga0070685_105002862 130
120 3300005466 Ga0070685_11084095 Ga0070685_110840952 130
121 3300005467 Ga0070706_100253590 Ga0070706_1002535902 130
122 3300005467 Ga0070706_100686934 Ga0070706_1006869341 130
123 3300005471 Ga0070698_100041601 Ga0070698_1000416014 130
124 3300005518 Ga0070699_100000291 Ga0070699_10000029130 130
125 3300005518 Ga0070699_100069114 Ga0070699_1000691144 130
126 3300005518 Ga0070699_101261717 Ga0070699_1012617172 130
127 3300005530 Ga0070679_100061330 Ga0070679_1000613301 130
128 3300005535 Ga0070684_100454525 Ga0070684_1004545251 130
129 3300005536 Ga0070697_100004085 Ga0070697_1000040853 130
130 3300005536 Ga0070697_100049641 Ga0070697_1000496413 130
131 3300005543 Ga0070672_100169632 Ga0070672_1001696322 130
132 3300005543 Ga0070672_100511948 Ga0070672_1005119482 130
133 3300005544 Ga0070686_100078006 Ga0070686_1000780062 130
134 3300005545 Ga0070695_100117342 Ga0070695_1001173422 130
135 3300005547 Ga0070693_100716578 Ga0070693_1007165781 130
136 3300005548 Ga0070665_100000280 Ga0070665_10000028058 130
137 3300005549 Ga0070704_100030445 Ga0070704_1000304453 130
138 3300005549 Ga0070704_100141791 Ga0070704_1001417912 130
139 3300005549 Ga0070704_100158377 Ga0070704_1001583773 130
140 3300005549 Ga0070704_100380185 Ga0070704_1003801852 130
141 3300005549 Ga0070704_100832523 Ga0070704_1008325232 130
142 3300005563 Ga0068855_100605004 Ga0068855_1006050042 130
143 3300005577 Ga0068857_100313554 Ga0068857_1003135542 130
144 3300005577 Ga0068857_100331733 Ga0068857_1003317332 130
145 3300005578 Ga0068854_100250909 Ga0068854_1002509094 130
146 3300005615 Ga0070702_101497065 Ga0070702_1014970651 130
147 3300005617 Ga0068859_100002086 Ga0068859_10000208619 130
148 3300005617 Ga0068859_100002935 Ga0068859_10000293510 130
149 3300005617 Ga0068859_100640559 Ga0068859_1006405592 130
150 3300005618 Ga0068864_100192204 Ga0068864_1001922045 130
151 3300005718 Ga0068866_10279762 Ga0068866_102797622 130
152 3300005719 Ga0068861_100020307 Ga0068861_1000203072 130
153 3300005719 Ga0068861_100389986 Ga0068861_1003899862 130
154 3300005719 Ga0068861_100426016 Ga0068861_1004260162 130
155 3300005841 Ga0068863_100581767 Ga0068863_1005817673 130
156 3300005841 Ga0068863_100938365 Ga0068863_1009383652 130
157 3300005842 Ga0068858_100260529 Ga0068858_1002605293 130
158 3300005843 Ga0068860_100729509 Ga0068860_1007295092 130
159 3300005843 Ga0068860_100872934 Ga0068860_1008729341 130
160 3300005843 Ga0068860_102532044 Ga0068860_1025320442 130
161 3300005844 Ga0068862_100001494 Ga0068862_10000149417 130
162 3300005844 Ga0068862_100175623 Ga0068862_1001756232 130
163 3300005937 Ga0081455_10102296 Ga0081455_101022961 130
164 3300005937 Ga0081455_10145173 Ga0081455_101451732 130
165 3300005985 Ga0081539_10000558 Ga0081539_1000055869 130
166 3300006028 Ga0070717_10172670 Ga0070717_101726703 130
167 3300006028 Ga0070717_10371355 Ga0070717_103713552 130
168 3300006042 Ga0075368_10020789 Ga0075368_100207892 130
169 3300006042 Ga0075368_10034245 Ga0075368_100342452 130
170 3300006048 Ga0075363_100150966 Ga0075363_1001509663 130
171 3300006051 Ga0075364_10450390 Ga0075364_104503902 130
172 3300006163 Ga0070715_10515768 Ga0070715_105157682 130
173 3300006173 Ga0070716_100012129 Ga0070716_1000121295 130
174 3300006175 Ga0070712_100765704 Ga0070712_1007657042 130
175 3300006178 Ga0075367_10240034 Ga0075367_102400342 130
176 3300006194 Ga0075427_10115501 Ga0075427_101155011 130
177 3300006195 Ga0075366_10051128 Ga0075366_100511284 130
178 3300006353 Ga0075370_10044896 Ga0075370_100448963 130
179 3300006358 Ga0068871_100390955 Ga0068871_1003909552 130
180 3300006358 Ga0068871_100541759 Ga0068871_1005417592 130
181 3300006358 Ga0068871_101112681 Ga0068871_1011126811 130
182 3300006844 Ga0075428_100006266 Ga0075428_1000062667 130
183 3300006844 Ga0075428_100018361 Ga0075428_1000183616 130
184 3300006844 Ga0075428_100413861 Ga0075428_1004138612 130
185 3300006847 Ga0075431_100027553 Ga0075431_1000275538 130
186 3300006847 Ga0075431_100330565 Ga0075431_1003305652 130
187 3300006847 Ga0075431_100575504 Ga0075431_1005755041 130
188 3300006847 Ga0075431_100699802 Ga0075431_1006998022 130
189 3300006852 Ga0075433_10024087 Ga0075433_100240875 130
190 3300006852 Ga0075433_10076205 Ga0075433_100762054 130
191 3300006852 Ga0075433_10366838 Ga0075433_103668382 130
192 3300006852 Ga0075433_10821858 Ga0075433_108218582 130
193 3300006871 Ga0075434_100057271 Ga0075434_1000572715 130
194 3300006871 Ga0075434_100134374 Ga0075434_1001343743 130
195 3300006871 Ga0075434_100287013 Ga0075434_1002870132 130
196 3300006871 Ga0075434_100530671 Ga0075434_1005306712 130
197 3300006871 Ga0075434_101569744 Ga0075434_1015697442 130
198 3300006881 Ga0068865_100323411 Ga0068865_1003234112 130
199 3300006881 Ga0068865_100732029 Ga0068865_1007320291 130
200 3300006881 Ga0068865_101121506 Ga0068865_1011215061 130
201 3300006914 Ga0075436_100019506 Ga0075436_1000195066 130
202 3300006931 Ga0097620_100002086 Ga0097620_1000020862 130
203 3300006931 Ga0097620_100002935 Ga0097620_10000293510 130
204 3300006931 Ga0097620_100640571 Ga0097620_1006405712 130
205 3300007076 Ga0075435_100032075 Ga0075435_1000320753 130
206 3300007076 Ga0075435_100066042 Ga0075435_1000660424 130
207 3300007076 Ga0075435_100421965 Ga0075435_1004219652 130
208 3300009093 Ga0105240_10102383 Ga0105240_101023832 130
209 3300009094 Ga0111539_10053096 Ga0111539_100530965 130
210 3300009094 Ga0111539_10166749 Ga0111539_101667493 130
211 3300009094 Ga0111539_10421578 Ga0111539_104215782 130
212 3300009098 Ga0105245_10043090 Ga0105245_100430903 130
213 3300009147 Ga0114129_10028282 Ga0114129_100282827 130
214 3300009147 Ga0114129_10037893 Ga0114129_100378937 130
215 3300009147 Ga0114129_10241081 Ga0114129_102410812 130
216 3300009147 Ga0114129_10378323 Ga0114129_103783232 130
217 3300009147 Ga0114129_10869930 Ga0114129_108699302 130
218 3300009147 Ga0114129_11684671 Ga0114129_116846712 130
219 3300009147 Ga0114129_11687242 Ga0114129_116872421 130
220 3300009148 Ga0105243_10379088 Ga0105243_103790882 130
221 3300009148 Ga0105243_11191632 Ga0105243_111916322 130
222 3300009174 Ga0105241_10096797 Ga0105241_100967972 130
223 3300009176 Ga0105242_10155632 Ga0105242_101556321 130
224 3300009176 Ga0105242_10520256 Ga0105242_105202562 130
225 3300009176 Ga0105242_10632897 Ga0105242_106328972 130
226 3300009551 Ga0105238_11227710 Ga0105238_112277101 130
227 3300009553 Ga0105249_10116457 Ga0105249_101164573 130
228 3300009553 Ga0105249_10512621 Ga0105249_105126212 130
229 3300009553 Ga0105249_10760271 Ga0105249_107602712 130
230 3300009553 Ga0105249_12235691 Ga0105249_122356912 130
231 3300009553 Ga0105249_13400426 Ga0105249_134004261 130
232 3300013105 Ga0157369_10279877 Ga0157369_102798772 130
233 3300013297 Ga0157378_10455153 Ga0157378_104551532 130
234 3300013306 Ga0163162_11315190 Ga0163162_113151902 130
235 3300013306 Ga0163162_11339418 Ga0163162_113394181 130
236 3300013308 Ga0157375_10037412 Ga0157375_100374126 130
237 3300013308 Ga0157375_10367711 Ga0157375_103677113 130
238 3300013308 Ga0157375_10497625 Ga0157375_104976252 130
239 3300014325 Ga0163163_10131955 Ga0163163_101319553 130
240 3300014325 Ga0163163_11131908 Ga0163163_111319082 130
241 3300014325 Ga0163163_12880754 Ga0163163_128807541 130
242 3300014326 Ga0157380_10963869 Ga0157380_109638691 130
243 3300014326 Ga0157380_12470345 Ga0157380_124703452 130
244 3300014326 Ga0157380_12751764 Ga0157380_127517641 130
245 3300014745 Ga0157377_10657843 Ga0157377_106578431 130
246 3300017792 Ga0163161_10259788 Ga0163161_102597883 130
247 3300020070 Ga0206356_10280488 Ga0206356_102804882 130
248 3300022467 Ga0224712_10078995 Ga0224712_100789952 130
249 3300025315 Ga0207697_10354283 Ga0207697_103542832 130
250 3300025885 Ga0207653_10138597 Ga0207653_101385972 130
251 3300025898 Ga0207692_10212724 Ga0207692_102127242 130
252 3300025901 Ga0207688_10022213 Ga0207688_100222134 130
253 3300025903 Ga0207680_10073099 Ga0207680_100730993 130
254 3300025903 Ga0207680_10310372 Ga0207680_103103722 130
255 3300025903 Ga0207680_10723624 Ga0207680_107236242 130
256 3300025906 Ga0207699_10000084 Ga0207699_1000008443 130
257 3300025906 Ga0207699_10228473 Ga0207699_102284732 130
258 3300025906 Ga0207699_10884597 Ga0207699_108845972 130
259 3300025907 Ga0207645_10013115 Ga0207645_100131155 130
260 3300025907 Ga0207645_10904726 Ga0207645_109047262 130
261 3300025907 Ga0207645_11066913 Ga0207645_110669132 130
262 3300025909 Ga0207705_10019852 Ga0207705_100198523 130
263 3300025913 Ga0207695_10117274 Ga0207695_101172742 130
264 3300025917 Ga0207660_10631401 Ga0207660_106314012 130
265 3300025921 Ga0207652_10397720 Ga0207652_103977202 130
266 3300025922 Ga0207646_10521441 Ga0207646_105214412 130
267 3300025923 Ga0207681_10000056 Ga0207681_1000005681 130
268 3300025923 Ga0207681_10050655 Ga0207681_100506554 130
269 3300025923 Ga0207681_11224867 Ga0207681_112248672 130
270 3300025924 Ga0207694_10743660 Ga0207694_107436601 130
271 3300025925 Ga0207650_10152892 Ga0207650_101528922 130
272 3300025925 Ga0207650_10315765 Ga0207650_103157652 130
273 3300025926 Ga0207659_10276960 Ga0207659_102769602 130
274 3300025926 Ga0207659_11310176 Ga0207659_113101761 130
275 3300025928 Ga0207700_10140695 Ga0207700_101406952 130
276 3300025928 Ga0207700_11001870 Ga0207700_110018701 130
277 3300025928 Ga0207700_11031704 Ga0207700_110317041 130
278 3300025933 Ga0207706_10228635 Ga0207706_102286352 130
279 3300025933 Ga0207706_10855485 Ga0207706_108554852 130
280 3300025935 Ga0207709_10415395 Ga0207709_104153952 130
281 3300025935 Ga0207709_10851898 Ga0207709_108518982 130
282 3300025936 Ga0207670_10192965 Ga0207670_101929652 130
283 3300025936 Ga0207670_10639848 Ga0207670_106398481 130
284 3300025937 Ga0207669_10006694 Ga0207669_100066942 130
285 3300025938 Ga0207704_10316650 Ga0207704_103166502 130
286 3300025938 Ga0207704_10495668 Ga0207704_104956681 130
287 3300025938 Ga0207704_10654450 Ga0207704_106544501 130
288 3300025938 Ga0207704_11191794 Ga0207704_111917941 130
289 3300025939 Ga0207665_10014606 Ga0207665_100146063 130
290 3300025940 Ga0207691_10012366 Ga0207691_100123665 130
291 3300025940 Ga0207691_10801599 Ga0207691_108015991 130
292 3300025941 Ga0207711_11067443 Ga0207711_110674431 130
293 3300025942 Ga0207689_10057239 Ga0207689_100572394 130
294 3300025942 Ga0207689_10092815 Ga0207689_100928153 130
295 3300025942 Ga0207689_11002748 Ga0207689_110027482 130
296 3300025949 Ga0207667_11514451 Ga0207667_115144511 130
297 3300025960 Ga0207651_10099523 Ga0207651_100995233 130
298 3300025960 Ga0207651_10418676 Ga0207651_104186762 130
299 3300025961 Ga0207712_10250909 Ga0207712_102509092 130
300 3300025961 Ga0207712_10363984 Ga0207712_103639842 130
301 3300025961 Ga0207712_10565236 Ga0207712_105652362 130
302 3300025961 Ga0207712_12003210 Ga0207712_120032101 130
303 3300025986 Ga0207658_10903684 Ga0207658_109036841 130
304 3300026023 Ga0207677_11652512 Ga0207677_116525122 130
305 3300026035 Ga0207703_10494871 Ga0207703_104948712 130
306 3300026067 Ga0207678_10088138 Ga0207678_100881387 130
307 3300026067 Ga0207678_10304998 Ga0207678_103049982 130
308 3300026075 Ga0207708_10007629 Ga0207708_100076297 130
309 3300026075 Ga0207708_10103163 Ga0207708_101031632 130
310 3300026075 Ga0207708_10445239 Ga0207708_104452392 130
311 3300026075 Ga0207708_11096905 Ga0207708_110969052 130
312 3300026078 Ga0207702_11741863 Ga0207702_117418631 130
313 3300026088 Ga0207641_10757831 Ga0207641_107578312 130
314 3300026089 Ga0207648_10170150 Ga0207648_101701502 130
315 3300026095 Ga0207676_10105833 Ga0207676_101058332 130
316 3300026095 Ga0207676_10641639 Ga0207676_106416392 130
317 3300026116 Ga0207674_10488762 Ga0207674_104887622 130
318 3300026116 Ga0207674_10883406 Ga0207674_108834062 130
319 3300026118 Ga0207675_100043836 Ga0207675_1000438362 130
320 3300026118 Ga0207675_100063773 Ga0207675_1000637734 130
321 3300026118 Ga0207675_100982722 Ga0207675_1009827221 130
322 3300026121 Ga0207683_11711497 Ga0207683_117114971 130
323 3300026121 Ga0207683_11822542 Ga0207683_118225422 130
324 3300026142 Ga0207698_12543170 Ga0207698_125431701 130
325 3300027866 Ga0209813_10028285 Ga0209813_100282853 130
326 3300027866 Ga0209813_10115076 Ga0209813_101150762 130
327 3300027866 Ga0209813_10184074 Ga0209813_101840742 130
328 3300027907 Ga0207428_10168769 Ga0207428_101687692 130
329 3300027907 Ga0207428_10294840 Ga0207428_102948402 130
330 3300028379 Ga0268266_10001178 Ga0268266_1000117829 130
331 3300028380 Ga0268265_10000230 Ga0268265_1000023051 130
332 3300028380 Ga0268265_10284570 Ga0268265_102845703 130
333 3300028380 Ga0268265_10587260 Ga0268265_105872602 130
334 3300028381 Ga0268264_10102310 Ga0268264_101023101 130
335 3300028381 Ga0268264_10255483 Ga0268264_102554832 130
336 3300028381 Ga0268264_11144258 Ga0268264_111442582 130
337 3300028381 Ga0268264_11193180 Ga0268264_111931802 130
338 3300028381 Ga0268264_11535887 Ga0268264_115358872 130
339 3300028381 Ga0268264_12041901 Ga0268264_120419011 130
340 3300030521 Ga0307511_10021467 Ga0307511_100214673 130
341 3300031665 Ga0316575_10013931 Ga0316575_100139313 130
342 3300031727 Ga0316576_10061175 Ga0316576_100611752 130
343 3300031727 Ga0316576_10091432 Ga0316576_100914323 130
344 3300031727 Ga0316576_10094456 Ga0316576_100944562 130
345 3300031727 Ga0316576_10104774 Ga0316576_101047743 130
346 3300031727 Ga0316576_10213457 Ga0316576_102134572 130
347 3300031728 Ga0316578_10017974 Ga0316578_100179743 130
348 3300031728 Ga0316578_10026254 Ga0316578_100262542 130
349 3300031733 Ga0316577_10059560 Ga0316577_100595603 130
350 3300031733 Ga0316577_10243189 Ga0316577_102431892 130
351 3300031733 Ga0316577_10311415 Ga0316577_103114152 130
352 3300032002 Ga0307416_102041733 Ga0307416_1020417332 130
353 3300032133 Ga0316583_10003154 Ga0316583_100031547 130
354 3300032133 Ga0316583_10004720 Ga0316583_100047203 130
355 3300032133 Ga0316583_10029653 Ga0316583_100296533 130
356 3300032133 Ga0316583_10131006 Ga0316583_101310061 130
357 3300032137 Ga0316585_10001279 Ga0316585_100012794 130
358 3300032139 Ga0316580_10141064 Ga0316580_101410641 130
359 3300032168 Ga0316593_10032088 Ga0316593_100320882 130
360 3300032168 Ga0316593_10056123 Ga0316593_100561232 130
361 3300032168 Ga0316593_10149565 Ga0316593_101495652 130
362 3300035085 Ga0373929_0000001 Ga0373929_0000001_389840_390235 130
363 3300035111 Ga0373923_0451656 Ga0373923_0451656_158_556 130
364 3300035115 Ga0373941_0287476 Ga0373941_0287476_37_429 130
365 3300035119 Ga0373956_0119716 Ga0373956_0119716_17_421 130
366 3300035170 Ga0373943_0262970 Ga0373943_0262970_368_772 130
367 3300035172 Ga0373955_0711254 Ga0373955_0711254_55_459 130
368 3300035398 Ga0316574_0020417 Ga0316574_0020417_3359_3751 130
369 3300035398 Ga0316574_0081022 Ga0316574_0081022_419_811 130
370 3300035398 Ga0316574_0483000 Ga0316574_0483000_317_709 130
371 3300035398 Ga0316574_0537124 Ga0316574_0537124_268_660 130
372 3300035692 Ga0373935_0277291 Ga0373935_0277291_669_1067 130
373 3300035724 Ga0373933_0768769 Ga0373933_0768769_135_530 130
374 3300036401 Ga0373937_0006813 Ga0373937_0006813_3816_4220 130
375 3300036647 Ga0316582_0038604 Ga0316582_0038604_594_986 130
376 3300036647 Ga0316582_0092199 Ga0316582_0092199_1387_1779 130
377 3300036647 Ga0316582_0257144 Ga0316582_0257144_753_1163 130
378 3300036712 Ga0316584_0093223 Ga0316584_0093223_1226_1639 130
379 3300036712 Ga0316584_0165820 Ga0316584_0165820_1005_1397 130
380 3300039062 Ga0400483_015074 Ga0400483_015074_646_1038 130
381 3300041443 Ga0451789_0711377 Ga0451789_0711377_454_846 130
382 3300041453 Ga0451797_1350670 Ga0451797_1350670_388_780 130
383 3300041456 Ga0451795_0324929 Ga0451795_0324929_181_573 130
384 3300041460 Ga0451802_0479589 Ga0451802_0479589_308_700 130
385 3300041460 Ga0451802_1679855 Ga0451802_1679855_188_580 130
386 3300041486 Ga0451807_0377212 Ga0451807_0377212_1427_1822 130
387 3300041486 Ga0451807_2063280 Ga0451807_2063280_476_868 130
388 3300041498 Ga0451841_0760955 Ga0451841_0760955_59_451 130
389 3300041997 Ga0439431_0050350 Ga0439431_0050350_590_982 130
390 3300041999 Ga0439433_0065882 Ga0439433_0065882_208_600 130
391 3300042002 Ga0439442_037960 Ga0439442_037960_531_923 130
392 3300042004 Ga0439445_0165698 Ga0439445_0165698_147_539 130
393 3300042007 Ga0439449_0093936 Ga0439449_0093936_521_913 130
394 3300042876 Ga0451577_0056839 Ga0451577_0056839_3027_3422 130
395 3300042876 Ga0451577_0082175 Ga0451577_0082175_1169_1567 130
396 3300044673 Ga0453683_0113285 Ga0453683_0113285_728_1120 130
397 3300044673 Ga0453683_0833824 Ga0453683_0833824_36_428 130
398 3300044712 Ga0453684_0101505 Ga0453684_0101505_1462_1857 130
399 3300044712 Ga0453684_0549334 Ga0453684_0549334_591_989 130
400 3300044712 Ga0453684_1622476 Ga0453684_1622476_156_548 130
401 3300044901 Ga0466960_0025774 Ga0466960_0025774_1652_2056 130
402 3300045051 Ga0451576_0041983 Ga0451576_0041983_1742_2134 130
403 3300045051 Ga0451576_1159845 Ga0451576_1159845_80_478 130
404 3300045976 Ga0466967_2217173 Ga0466967_2217173_23_415 130
405 3300046459 Ga0495629_0001085 Ga0495629_0001085_20678_21076 130
406 3300046459 Ga0495629_0018969 Ga0495629_0018969_3952_4350 130
407 3300046460 Ga0495638_0006310 Ga0495638_0006310_7243_7638 130
408 3300046460 Ga0495638_0255107 Ga0495638_0255107_404_796 130
409 3300046473 Ga0495582_0007932 Ga0495582_0007932_289_687 130
410 3300046475 Ga0495639_0002890 Ga0495639_0002890_2118_2516 130
411 3300046475 Ga0495639_0016731 Ga0495639_0016731_398_796 130
412 3300046476 Ga0495662_0038269 Ga0495662_0038269_675_1073 130
413 3300046499 Ga0495594_0004579 Ga0495594_0004579_3586_3984 130
414 3300046499 Ga0495594_0540581 Ga0495594_0540581_75_473 130
415 3300046500 Ga0495596_0176640 Ga0495596_0176640_259_651 130
416 3300046517 Ga0495630_1296817 Ga0495630_1296817_83_481 130
417 3300046523 Ga0495644_0386885 Ga0495644_0386885_106_498 130
418 3300046525 Ga0495663_0142217 Ga0495663_0142217_312_704 130
419 3300046533 Ga0495640_0663727 Ga0495640_0663727_182_580 130
420 3300046536 Ga0495587_0127747 Ga0495587_0127747_727_1122 130
421 3300046537 Ga0495598_0059278 Ga0495598_0059278_147_539 130
422 3300046539 Ga0495621_0067321 Ga0495621_0067321_500_892 130
423 3300046557 Ga0495622_0221978 Ga0495622_0221978_347_745 130
424 3300046558 Ga0495633_0114400 Ga0495633_0114400_40_432 130
425 3300046615 Ga0495656_0217655 Ga0495656_0217655_106_498 130
426 3300046616 Ga0495668_0296147 Ga0495668_0296147_336_728 130
427 3300046642 Ga0495634_0860124 Ga0495634_0860124_14_412 130
428 3300046663 Ga0495635_0001421 Ga0495635_0001421_13080_13478 130
429 3300046683 Ga0495658_0000401 Ga0495658_0000401_20077_20475 130
430 3300046684 Ga0495669_0678074 Ga0495669_0678074_55_447 130
431 3300046809 Ga0495600_0901904 Ga0495600_0901904_27_431 130
432 3300047315 Ga0495581_0000586 Ga0495581_0000586_14809_15207 130
433 3300047315 Ga0495581_0053939 Ga0495581_0053939_402_800 130
434 3300047318 Ga0495636_0421282 Ga0495636_0421282_151_573 130
435 3300047320 Ga0495672_0205463 Ga0495672_0205463_94_486 130
436 3300047321 Ga0495676_0130421 Ga0495676_0130421_669_1067 130
437 3300047322 Ga0495680_0003220 Ga0495680_0003220_2858_3256 130
438 3300048088 Ga0495602_0325974 Ga0495602_0325974_471_866 130
439 3300048089 Ga0495614_0095409 Ga0495614_0095409_749_1147 130
440 3300048906 Ga0496103_0235257 Ga0496103_0235257_276_668 130
441 3300048907 Ga0496104_1056706 Ga0496104_1056706_87_482 130
442 3300048912 Ga0496109_0749565 Ga0496109_0749565_202_594 130
443 3300049127 Ga0501306_013195 Ga0501306_013195_456_848 130
444 3300049527 Ga0501311_041273 Ga0501311_041273_252_644 130
445 3300049532 Ga0501316_044664 Ga0501316_044664_32_424 130
446 3300049540 Ga0501324_019133 Ga0501324_019133_206_598 130
447 3300049569 Ga0501032_0390246 Ga0501032_0390246_413_805 130
448 3300049573 Ga0501037_0370105 Ga0501037_0370105_126_524 130
449 3300049574 Ga0501038_0005479 Ga0501038_0005479_8398_8796 130
450 3300049575 Ga0501039_0434341 Ga0501039_0434341_424_822 130
451 3300049575 Ga0501039_0879123 Ga0501039_0879123_105_497 130
452 3300049576 Ga0501040_0722678 Ga0501040_0722678_57_449 130
453 3300049578 Ga0501042_0228606 Ga0501042_0228606_372_764 130
454 3300049579 Ga0501043_0014065 Ga0501043_0014065_1200_1598 130
455 3300049581 Ga0501047_0002850 Ga0501047_0002850_7957_8355 130
456 3300049581 Ga0501047_1249521 Ga0501047_1249521_74_478 130
457 3300049582 Ga0501048_0255283 Ga0501048_0255283_240_632 130
458 3300049583 Ga0501067_0002959 Ga0501067_0002959_7821_8219 130
459 3300049584 Ga0501068_0000298 Ga0501068_0000298_19430_19828 130
460 3300049585 Ga0501069_0011603 Ga0501069_0011603_265_663 130
461 3300049586 Ga0501070_0115439 Ga0501070_0115439_520_918 130
462 3300049587 Ga0501071_0495094 Ga0501071_0495094_271_663 130
463 3300049588 Ga0501072_0000013 Ga0501072_0000013_33025_33423 130
464 3300049589 Ga0501073_0001560 Ga0501073_0001560_2259_2657 130
465 3300049589 Ga0501073_0264198 Ga0501073_0264198_717_1121 130
466 3300049589 Ga0501073_0315907 Ga0501073_0315907_653_1045 130
467 3300049590 Ga0501074_0001093 Ga0501074_0001093_8528_8926 130
468 3300049592 Ga0501076_0005208 Ga0501076_0005208_583_981 130
469 3300049592 Ga0501076_1148669 Ga0501076_1148669_180_572 130
470 3300049593 Ga0501077_0042009 Ga0501077_0042009_1150_1548 130
471 3300049667 Ga0501230_168431 Ga0501230_168431_55_447 130
472 3300049741 Ga0501079_0000583 Ga0501079_0000583_11866_12264 130
473 3300049741 Ga0501079_0426994 Ga0501079_0426994_534_926 130
474 3300049742 Ga0501080_0084855 Ga0501080_0084855_2007_2405 130
475 3300049742 Ga0501080_0439657 Ga0501080_0439657_290_688 130
476 3300049742 Ga0501080_1713744 Ga0501080_1713744_94_486 130
477 3300049743 Ga0501081_0932991 Ga0501081_0932991_80_472 130
478 3300049744 Ga0501083_0002132 Ga0501083_0002132_9032_9424 130
479 3300049744 Ga0501083_0004309 Ga0501083_0004309_8275_8673 130
480 3300049744 Ga0501083_0006433 Ga0501083_0006433_4244_4648 130
481 3300049760 Ga0501263_021577 Ga0501263_021577_17_421 130
482 3300049823 Ga0501044_0061437 Ga0501044_0061437_1252_1650 130
483 3300049824 Ga0501045_0180083 Ga0501045_0180083_106_498 130
484 3300050491 nmdc:mga00v17_289450_c1 nmdc:mga00v17_289450_c1_157_549 130
485 3300050493 nmdc:mga0k408_16714_c2 nmdc:mga0k408_16714_c2_1701_2093 130
486 3300050494 nmdc:mga06z11_15279_c1 nmdc:mga06z11_15279_c1_2534_2926 130
487 3300050495 nmdc:mga04h51_248068_c1 nmdc:mga04h51_248068_c1_173_565 130
488 3300050495 nmdc:mga04h51_39600_c1 nmdc:mga04h51_39600_c1_695_1087 130
489 3300050496 nmdc:mga07m45_151571_c1 nmdc:mga07m45_151571_c1_493_891 130
490 3300050507 nmdc:mga05p37_116790_c1 nmdc:mga05p37_116790_c1_2399_2791 130
491 3300050507 nmdc:mga05p37_1221939_c1 nmdc:mga05p37_1221939_c1_344_739 130
492 3300050507 nmdc:mga05p37_1629851_c1 nmdc:mga05p37_1629851_c1_113_508 130
493 3300050507 nmdc:mga05p37_367163_c1 nmdc:mga05p37_367163_c1_100_492 130
494 3300050507 nmdc:mga05p37_45244_c1 nmdc:mga05p37_45244_c1_3470_3862 130
495 3300050507 nmdc:mga05p37_7671_c1 nmdc:mga05p37_7671_c1_7109_7501 130
496 3300050507 nmdc:mga05p37_89941_c1 nmdc:mga05p37_89941_c1_1299_1694 130
497 3300050510 nmdc:mga06r32_361101_c1 nmdc:mga06r32_361101_c1_585_980 130
498 3300050510 nmdc:mga06r32_49737_c2 nmdc:mga06r32_49737_c2_626_1018 130
499 3300050510 nmdc:mga06r32_532091_c1 nmdc:mga06r32_532091_c1_13_405 130
500 3300050510 nmdc:mga06r32_648054_c1 nmdc:mga06r32_648054_c1_457_855 130
501 3300050511 nmdc:mga08y16_154847_c1 nmdc:mga08y16_154847_c1_1708_2112 130
502 3300050511 nmdc:mga08y16_1757066_c1 nmdc:mga08y16_1757066_c1_147_545 130
503 3300050511 nmdc:mga08y16_483482_c1 nmdc:mga08y16_483482_c1_323_721 130
504 3300050512 nmdc:mga0n895_105622_c1 nmdc:mga0n895_105622_c1_2086_2478 130
505 3300050512 nmdc:mga0n895_246885_c1 nmdc:mga0n895_246885_c1_902_1294 130
506 3300050512 nmdc:mga0n895_442043_c1 nmdc:mga0n895_442043_c1_749_1141 130
507 3300050512 nmdc:mga0n895_83882_c1 nmdc:mga0n895_83882_c1_2611_3003 130
508 3300050513 nmdc:mga0rr50_223925_c1 nmdc:mga0rr50_223925_c1_797_1189 130
509 3300050513 nmdc:mga0rr50_253929_c1 nmdc:mga0rr50_253929_c1_605_1000 130
510 3300050513 nmdc:mga0rr50_43944_c1 nmdc:mga0rr50_43944_c1_1076_1468 130
511 3300050513 nmdc:mga0rr50_67190_c1 nmdc:mga0rr50_67190_c1_103_495 130
512 3300050513 nmdc:mga0rr50_697722_c1 nmdc:mga0rr50_697722_c1_370_768 130
513 3300050514 nmdc:mga08x19_449669_c1 nmdc:mga08x19_449669_c1_130_522 130
514 3300050515 nmdc:mga0a205_174267_c1 nmdc:mga0a205_174267_c1_836_1228 130
515 3300050515 nmdc:mga0a205_194006_c1 nmdc:mga0a205_194006_c1_683_1078 130
516 3300050515 nmdc:mga0a205_556941_c1 nmdc:mga0a205_556941_c1_352_747 130
517 3300050515 nmdc:mga0a205_601841_c1 nmdc:mga0a205_601841_c1_384_779 130
518 3300053085 Ga0495619_0006248 Ga0495619_0006248_995_1393 130
519 3300053085 Ga0495619_0710808 Ga0495619_0710808_116_511 130
520 3300053085 Ga0495619_0753490 Ga0495619_0753490_100_498 130
521 3300053116 Ga0500592_028656 Ga0500592_028656_338_733 130
522 3300053139 Ga0500568_0004595 Ga0500568_0004595_4628_5020 130
523 3300054114 Ga0501084_0000136 Ga0501084_0000136_32984_33382 130
524 3300054114 Ga0501084_0035628 Ga0501084_0035628_2219_2623 130
525 3300054114 Ga0501084_1445030 Ga0501084_1445030_18_410 130
526 3300059490 Ga0587066_160779 Ga0587066_160779_37_432 130
527 3300060346 Ga0587111_0023103 Ga0587111_0023103_640_1035 130
528 3300060353 Ga0501082_0000651 Ga0501082_0000651_28931_29329 130
529 3300060353 Ga0501082_0053520 Ga0501082_0053520_1993_2397 130
530 3300061734 Ga0530510_0011015 Ga0530510_0011015_1891_2289 130
531 3300061734 Ga0530510_0108011 Ga0530510_0108011_1514_1906 130
532 3300061734 Ga0530510_0234601 Ga0530510_0234601_837_1229 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00380

Ribosomal_S9

Ribosomal protein S9/S16

11

122

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_BI real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9741 6 102
4v48-assembly1.cif.gz_BI real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9454 6 102
6osi-assembly1.cif.gz_QI unmodified trna(pro) bound to thermus thermophilus 70s (near cognate) 0.9342 4 108
6osi-assembly1.cif.gz_QI unmodified trna(pro) bound to thermus thermophilus 70s (near cognate) 0.9257 4 108
8d8l-assembly1.cif.gz_I yeast mitochondrial small subunit assembly intermediate (state 3) 0.9192 5 113
ID Description Score Start End Superfamily
af_Q7XAM9_269_415_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8025 5 130 3.30.230.10
af_O94150_208_336_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7995 5 130 3.30.230.10
af_Q54CK4_214_339_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7985 6 130 3.30.230.10
af_Q8IHZ4_170_300_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7955 5 130 3.30.230.10
af_O14006_146_271_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7955 7 130 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A6P0EFT4-F1-model_v4 deleted 0.9962 1 104
AF-A0A2E8BEA7-F1-model_v4 30S ribosomal protein S9 0.9953 7 105 GO:0003723
GO:0003735
GO:0005737
GO:0006412
GO:0015935
AF-A0A7C8MVV8-F1-model_v4 Small ribosomal subunit protein uS9m (37S ribosomal protein S9, mitochondrial) 0.9949 5 100 GO:0003723
GO:0003735
GO:0005763
GO:0006412
AF-A0A6P0EFT4-F1-model_v4 deleted 0.9867 1 104
AF-A0A2H5NLP5-F1-model_v4 deleted 0.9819 5 106

Feature Viewer

pLDDT pTM Quality
88.87 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map