F460338
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 532 | 293 | 532 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300050515|nmdc:mga0a205_474124_c1|nmdc:mga0a205_474124_c1_77_472 |
| Length | 122 |
| Sequence | LAATIEYYGTGKRKNAVARVLLRPGQGEIKINDRDIETYFPSAVLRTVVRSPLLVTETAERFNMAGQAGAVRHGISRALLEYNTELRMKLKEAGFLTRDSRIKERKKYGQKGARKRFQFSKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 155 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 156 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 157 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 160 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 161 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 162 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 164 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 175 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 177 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 178 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 179 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 185 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 186 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 187 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 188 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 189 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 190 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 191 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 192 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 193 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 194 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 195 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 196 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 197 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 198 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 199 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 200 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 266 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 271 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 275 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 276 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 277 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 278 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 279 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 288 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 289 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.93 |
| Metatranscriptomes | 2.07 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.76 |
| Nodule | 0 |
| Rhizoplane | 1.88 |
| Rhizosphere | 93.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10071135 | 3300002239 | Bacteria | 623 |
| 2 | JGI24742J22300_10016149 | 3300002244 | Bacteria | 1259 |
| 3 | rootL2_10015203 | 3300003322 | Bacteria | 2099 |
| 4 | Ga0065714_10137061 | 3300005288 | Bacteria | 1201 |
| 5 | Ga0065712_10003855 | 3300005290 | Bacteria | 5392 |
| 6 | Ga0065715_10143316 | 3300005293 | Bacteria | 1822 |
| 7 | Ga0065707_10008765 | 3300005295 | Bacteria | 2558 |
| 8 | Ga0065707_10097393 | 3300005295 | Bacteria | 3178 |
| 9 | Ga0070676_10023072 | 3300005328 | Bacteria | 3495 |
| 10 | Ga0070676_10167156 | 3300005328 | Bacteria | 1420 |
| 11 | Ga0070690_100066053 | 3300005330 | Bacteria | 2340 |
| 12 | Ga0070690_100237886 | 3300005330 | Bacteria | 1283 |
| 13 | Ga0070690_100365598 | 3300005330 | Bacteria | 1051 |
| 14 | Ga0070670_100011000 | 3300005331 | Bacteria | 7730 |
| 15 | Ga0068869_100122584 | 3300005334 | Bacteria | 1990 |
| 16 | Ga0068869_100188931 | 3300005334 | Bacteria | 1619 |
| 17 | Ga0068869_100264147 | 3300005334 | Bacteria | 1379 |
| 18 | Ga0068869_100501258 | 3300005334 | Bacteria | 1014 |
| 19 | Ga0070666_10022827 | 3300005335 | Bacteria | 4066 |
| 20 | Ga0070666_10127318 | 3300005335 | Bacteria | 1768 |
| 21 | Ga0070680_100492119 | 3300005336 | Bacteria | 1049 |
| 22 | Ga0070682_100085309 | 3300005337 | Bacteria | 2054 |
| 23 | Ga0070689_100879759 | 3300005340 | Bacteria | 792 |
| 24 | Ga0070687_100278628 | 3300005343 | Bacteria | 1051 |
| 25 | Ga0070687_101269176 | 3300005343 | Bacteria | 546 |
| 26 | Ga0070692_10209495 | 3300005345 | Bacteria | 1146 |
| 27 | Ga0070668_100509239 | 3300005347 | Bacteria | 1043 |
| 28 | Ga0070669_100000164 | 3300005353 | Bacteria | 58203 |
| 29 | Ga0070669_100065955 | 3300005353 | Bacteria | 2667 |
| 30 | Ga0070669_100682001 | 3300005353 | Bacteria | 866 |
| 31 | Ga0070669_101295211 | 3300005353 | Bacteria | 631 |
| 32 | Ga0070675_100319443 | 3300005354 | Bacteria | 1371 |
| 33 | Ga0070675_100356665 | 3300005354 | Bacteria | 1298 |
| 34 | Ga0070674_101148759 | 3300005356 | Bacteria | 687 |
| 35 | Ga0070673_100044423 | 3300005364 | Bacteria | 3440 |
| 36 | Ga0070673_100238814 | 3300005364 | Bacteria | 1579 |
| 37 | Ga0070688_100353334 | 3300005365 | Bacteria | 1076 |
| 38 | Ga0070688_100654026 | 3300005365 | Bacteria | 810 |
| 39 | Ga0070688_100664474 | 3300005365 | Bacteria | 804 |
| 40 | Ga0070688_101044665 | 3300005365 | Bacteria | 651 |
| 41 | Ga0070659_101669334 | 3300005366 | Bacteria | 569 |
| 42 | Ga0070667_102097513 | 3300005367 | Bacteria | 532 |
| 43 | Ga0070703_10169917 | 3300005406 | Bacteria | 834 |
| 44 | Ga0070709_10000083 | 3300005434 | Bacteria | 70658 |
| 45 | Ga0070709_10272640 | 3300005434 | Bacteria | 1227 |
| 46 | Ga0070709_11224656 | 3300005434 | Unclassified | 604 |
| 47 | Ga0070713_101524428 | 3300005436 | Bacteria | 649 |
| 48 | Ga0070710_10232429 | 3300005437 | Bacteria | 1178 |
| 49 | Ga0070701_10087987 | 3300005438 | Bacteria | 1696 |
| 50 | Ga0070700_100119768 | 3300005441 | Bacteria | 1762 |
| 51 | Ga0070700_100347971 | 3300005441 | Bacteria | 1098 |
| 52 | Ga0070700_100486101 | 3300005441 | Bacteria | 947 |
| 53 | Ga0070694_100001347 | 3300005444 | Bacteria | 14324 |
| 54 | Ga0070708_101104893 | 3300005445 | Bacteria | 743 |
| 55 | Ga0070708_101469618 | 3300005445 | Bacteria | 635 |
| 56 | Ga0070708_101867310 | 3300005445 | Bacteria | 557 |
| 57 | Ga0070663_100582943 | 3300005455 | Bacteria | 938 |
| 58 | Ga0070663_100642522 | 3300005455 | Bacteria | 896 |
| 59 | Ga0070663_100682182 | 3300005455 | Unclassified | 872 |
| 60 | Ga0070662_100043656 | 3300005457 | Bacteria | 3208 |
| 61 | Ga0070681_10266198 | 3300005458 | Bacteria | 1625 |
| 62 | Ga0068867_100319593 | 3300005459 | Bacteria | 1286 |
| 63 | Ga0068867_101437055 | 3300005459 | Bacteria | 640 |
| 64 | Ga0070685_10002620 | 3300005466 | Bacteria | 9214 |
| 65 | Ga0070685_10500286 | 3300005466 | Bacteria | 860 |
| 66 | Ga0070685_11084095 | 3300005466 | Bacteria | 604 |
| 67 | Ga0070706_100253590 | 3300005467 | Bacteria | 1642 |
| 68 | Ga0070706_100686934 | 3300005467 | Bacteria | 950 |
| 69 | Ga0070698_100041601 | 3300005471 | Bacteria | 4717 |
| 70 | Ga0070699_100000291 | 3300005518 | Bacteria | 48229 |
| 71 | Ga0070699_100069114 | 3300005518 | Bacteria | 3069 |
| 72 | Ga0070699_101261717 | 3300005518 | Bacteria | 678 |
| 73 | Ga0070679_100061330 | 3300005530 | Bacteria | 3748 |
| 74 | Ga0070684_100454525 | 3300005535 | Bacteria | 1184 |
| 75 | Ga0070697_100004085 | 3300005536 | Bacteria | 11195 |
| 76 | Ga0070697_100049641 | 3300005536 | Bacteria | 3406 |
| 77 | Ga0070672_100169632 | 3300005543 | Bacteria | 1814 |
| 78 | Ga0070672_100511948 | 3300005543 | Bacteria | 1039 |
| 79 | Ga0070686_100078006 | 3300005544 | Bacteria | 2186 |
| 80 | Ga0070695_100117342 | 3300005545 | Bacteria | 1816 |
| 81 | Ga0070693_100716578 | 3300005547 | Bacteria | 734 |
| 82 | Ga0070665_100000280 | 3300005548 | Bacteria | 83526 |
| 83 | Ga0070704_100030445 | 3300005549 | Bacteria | 3617 |
| 84 | Ga0070704_100141791 | 3300005549 | Bacteria | 1877 |
| 85 | Ga0070704_100158377 | 3300005549 | Bacteria | 1788 |
| 86 | Ga0070704_100380185 | 3300005549 | Bacteria | 1199 |
| 87 | Ga0070704_100832523 | 3300005549 | Bacteria | 826 |
| 88 | Ga0068855_100605004 | 3300005563 | Bacteria | 1182 |
| 89 | Ga0068857_100313554 | 3300005577 | Bacteria | 1447 |
| 90 | Ga0068857_100331733 | 3300005577 | Bacteria | 1406 |
| 91 | Ga0068854_100250909 | 3300005578 | Bacteria | 1413 |
| 92 | Ga0070702_101497065 | 3300005615 | Bacteria | 555 |
| 93 | Ga0068859_100002086 | 3300005617 | Bacteria | 20362 |
| 94 | Ga0068859_100002935 | 3300005617 | Bacteria | 17320 |
| 95 | Ga0068859_100640559 | 3300005617 | Bacteria | 1155 |
| 96 | Ga0068864_100192204 | 3300005618 | Bacteria | 1872 |
| 97 | Ga0068866_10279762 | 3300005718 | Bacteria | 1033 |
| 98 | Ga0068861_100020307 | 3300005719 | Bacteria | 4756 |
| 99 | Ga0068861_100389986 | 3300005719 | Bacteria | 1233 |
| 100 | Ga0068861_100426016 | 3300005719 | Bacteria | 1183 |
| 101 | Ga0068863_100581767 | 3300005841 | Bacteria | 1107 |
| 102 | Ga0068863_100938365 | 3300005841 | Bacteria | 866 |
| 103 | Ga0068858_100260529 | 3300005842 | Bacteria | 1648 |
| 104 | Ga0068860_100729509 | 3300005843 | Bacteria | 1002 |
| 105 | Ga0068860_100872934 | 3300005843 | Bacteria | 915 |
| 106 | Ga0068860_102532044 | 3300005843 | Bacteria | 533 |
| 107 | Ga0068862_100001494 | 3300005844 | Bacteria | 21448 |
| 108 | Ga0068862_100175623 | 3300005844 | Unclassified | 1920 |
| 109 | Ga0081455_10102296 | 3300005937 | Bacteria | 2297 |
| 110 | Ga0081455_10145173 | 3300005937 | Bacteria | 1837 |
| 111 | Ga0081539_10000558 | 3300005985 | Bacteria | 77001 |
| 112 | Ga0070717_10172670 | 3300006028 | Bacteria | 1881 |
| 113 | Ga0070717_10371355 | 3300006028 | Bacteria | 1281 |
| 114 | Ga0075368_10020789 | 3300006042 | Bacteria | 2487 |
| 115 | Ga0075368_10034245 | 3300006042 | Bacteria | 1978 |
| 116 | Ga0075363_100150966 | 3300006048 | Bacteria | 1311 |
| 117 | Ga0075364_10450390 | 3300006051 | Bacteria | 879 |
| 118 | Ga0070715_10515768 | 3300006163 | Bacteria | 687 |
| 119 | Ga0070716_100012129 | 3300006173 | Bacteria | 4360 |
| 120 | Ga0070712_100765704 | 3300006175 | Bacteria | 827 |
| 121 | Ga0075367_10240034 | 3300006178 | Bacteria | 1135 |
| 122 | Ga0075427_10115501 | 3300006194 | Bacteria | 508 |
| 123 | Ga0075366_10051128 | 3300006195 | Bacteria | 2455 |
| 124 | Ga0075370_10044896 | 3300006353 | Bacteria | 2498 |
| 125 | Ga0068871_100390955 | 3300006358 | Bacteria | 1237 |
| 126 | Ga0068871_100541759 | 3300006358 | Bacteria | 1053 |
| 127 | Ga0068871_101112681 | 3300006358 | Bacteria | 739 |
| 128 | Ga0075428_100006266 | 3300006844 | Bacteria | 13226 |
| 129 | Ga0075428_100018361 | 3300006844 | Bacteria | 7733 |
| 130 | Ga0075428_100413861 | 3300006844 | Bacteria | 1444 |
| 131 | Ga0075431_100027553 | 3300006847 | Bacteria | 5832 |
| 132 | Ga0075431_100330565 | 3300006847 | Bacteria | 1535 |
| 133 | Ga0075431_100575504 | 3300006847 | Bacteria | 1112 |
| 134 | Ga0075431_100699802 | 3300006847 | Bacteria | 991 |
| 135 | Ga0075433_10024087 | 3300006852 | Bacteria | 5133 |
| 136 | Ga0075433_10076205 | 3300006852 | Bacteria | 2953 |
| 137 | Ga0075433_10366838 | 3300006852 | Bacteria | 1272 |
| 138 | Ga0075433_10821858 | 3300006852 | Bacteria | 812 |
| 139 | Ga0075434_100057271 | 3300006871 | Bacteria | 3873 |
| 140 | Ga0075434_100134374 | 3300006871 | Bacteria | 2493 |
| 141 | Ga0075434_100287013 | 3300006871 | Bacteria | 1665 |
| 142 | Ga0075434_100318467 | 3300006871 | Bacteria | 1576 |
| 143 | Ga0075434_100530671 | 3300006871 | Bacteria | 1197 |
| 144 | Ga0075434_101569744 | 3300006871 | Bacteria | 667 |
| 145 | Ga0068865_100323411 | 3300006881 | Bacteria | 1241 |
| 146 | Ga0068865_100732029 | 3300006881 | Bacteria | 848 |
| 147 | Ga0068865_101121506 | 3300006881 | Bacteria | 694 |
| 148 | Ga0075436_100019506 | 3300006914 | Bacteria | 4647 |
| 149 | Ga0097620_100002086 | 3300006931 | Bacteria | 20362 |
| 150 | Ga0097620_100002935 | 3300006931 | Bacteria | 17320 |
| 151 | Ga0097620_100640571 | 3300006931 | Bacteria | 1155 |
| 152 | Ga0075435_100032075 | 3300007076 | Bacteria | 4147 |
| 153 | Ga0075435_100066042 | 3300007076 | Bacteria | 2942 |
| 154 | Ga0075435_100421965 | 3300007076 | Bacteria | 1149 |
| 155 | Ga0105240_10102383 | 3300009093 | Bacteria | 3480 |
| 156 | Ga0111539_10053096 | 3300009094 | Bacteria | 4824 |
| 157 | Ga0111539_10165868 | 3300009094 | Bacteria | 2582 |
| 158 | Ga0111539_10166749 | 3300009094 | Bacteria | 2575 |
| 159 | Ga0111539_10421578 | 3300009094 | Bacteria | 1554 |
| 160 | Ga0105245_10043090 | 3300009098 | Bacteria | 4026 |
| 161 | Ga0114129_10028282 | 3300009147 | Bacteria | 7943 |
| 162 | Ga0114129_10037893 | 3300009147 | Bacteria | 6803 |
| 163 | Ga0114129_10241081 | 3300009147 | Bacteria | 2430 |
| 164 | Ga0114129_10378323 | 3300009147 | Bacteria | 1870 |
| 165 | Ga0114129_10869930 | 3300009147 | Bacteria | 1144 |
| 166 | Ga0114129_10981291 | 3300009147 | Bacteria | 1065 |
| 167 | Ga0114129_11684671 | 3300009147 | Bacteria | 774 |
| 168 | Ga0114129_11687242 | 3300009147 | Bacteria | 773 |
| 169 | Ga0105243_10379088 | 3300009148 | Bacteria | 1308 |
| 170 | Ga0105243_11191632 | 3300009148 | Bacteria | 774 |
| 171 | Ga0105241_10096797 | 3300009174 | Bacteria | 2339 |
| 172 | Ga0105242_10155632 | 3300009176 | Bacteria | 1996 |
| 173 | Ga0105242_10520256 | 3300009176 | Bacteria | 1135 |
| 174 | Ga0105242_10632897 | 3300009176 | Bacteria | 1038 |
| 175 | Ga0105238_11227710 | 3300009551 | Bacteria | 774 |
| 176 | Ga0105249_10116457 | 3300009553 | Bacteria | 2533 |
| 177 | Ga0105249_10226052 | 3300009553 | Bacteria | 1844 |
| 178 | Ga0105249_10512621 | 3300009553 | Bacteria | 1246 |
| 179 | Ga0105249_10760271 | 3300009553 | Bacteria | 1031 |
| 180 | Ga0105249_12235691 | 3300009553 | Bacteria | 620 |
| 181 | Ga0105249_13400426 | 3300009553 | Bacteria | 512 |
| 182 | Ga0157369_10279877 | 3300013105 | Bacteria | 1737 |
| 183 | Ga0157378_10455153 | 3300013297 | Bacteria | 1271 |
| 184 | Ga0163162_11315190 | 3300013306 | Bacteria | 821 |
| 185 | Ga0163162_11339418 | 3300013306 | Bacteria | 814 |
| 186 | Ga0157375_10037412 | 3300013308 | Bacteria | 4650 |
| 187 | Ga0157375_10367711 | 3300013308 | Bacteria | 1604 |
| 188 | Ga0157375_10497625 | 3300013308 | Bacteria | 1383 |
| 189 | Ga0163163_10131955 | 3300014325 | Bacteria | 2538 |
| 190 | Ga0163163_11131908 | 3300014325 | Bacteria | 846 |
| 191 | Ga0163163_12880754 | 3300014325 | Unclassified | 537 |
| 192 | Ga0157380_10963869 | 3300014326 | Bacteria | 884 |
| 193 | Ga0157380_12470345 | 3300014326 | Bacteria | 585 |
| 194 | Ga0157380_12751764 | 3300014326 | Bacteria | 558 |
| 195 | Ga0157377_10657843 | 3300014745 | Bacteria | 755 |
| 196 | Ga0163161_10259788 | 3300017792 | Bacteria | 1356 |
| 197 | Ga0206356_10280488 | 3300020070 | Bacteria | 2190 |
| 198 | Ga0224712_10078995 | 3300022467 | Bacteria | 1354 |
| 199 | Ga0207697_10354283 | 3300025315 | Bacteria | 652 |
| 200 | Ga0207653_10138597 | 3300025885 | Bacteria | 888 |
| 201 | Ga0207692_10212724 | 3300025898 | Bacteria | 1142 |
| 202 | Ga0207688_10022213 | 3300025901 | Bacteria | 3470 |
| 203 | Ga0207680_10073099 | 3300025903 | Bacteria | 2131 |
| 204 | Ga0207680_10310372 | 3300025903 | Bacteria | 1101 |
| 205 | Ga0207680_10723624 | 3300025903 | Bacteria | 713 |
| 206 | Ga0207699_10000084 | 3300025906 | Bacteria | 70467 |
| 207 | Ga0207699_10228473 | 3300025906 | Bacteria | 1274 |
| 208 | Ga0207699_10884597 | 3300025906 | Unclassified | 659 |
| 209 | Ga0207645_10013115 | 3300025907 | Bacteria | 5599 |
| 210 | Ga0207645_10904726 | 3300025907 | Bacteria | 599 |
| 211 | Ga0207645_11066913 | 3300025907 | Bacteria | 546 |
| 212 | Ga0207705_10019852 | 3300025909 | Bacteria | 4807 |
| 213 | Ga0207695_10117274 | 3300025913 | Bacteria | 2635 |
| 214 | Ga0207660_10631401 | 3300025917 | Bacteria | 873 |
| 215 | Ga0207652_10397720 | 3300025921 | Bacteria | 1243 |
| 216 | Ga0207646_10521441 | 3300025922 | Bacteria | 1070 |
| 217 | Ga0207681_10000056 | 3300025923 | Bacteria | 106145 |
| 218 | Ga0207681_10050655 | 3300025923 | Bacteria | 2810 |
| 219 | Ga0207681_11224867 | 3300025923 | Bacteria | 630 |
| 220 | Ga0207694_10743660 | 3300025924 | Bacteria | 828 |
| 221 | Ga0207650_10152892 | 3300025925 | Bacteria | 1822 |
| 222 | Ga0207650_10315765 | 3300025925 | Bacteria | 1279 |
| 223 | Ga0207659_10276960 | 3300025926 | Bacteria | 1370 |
| 224 | Ga0207659_11310176 | 3300025926 | Bacteria | 622 |
| 225 | Ga0207700_10140695 | 3300025928 | Bacteria | 1982 |
| 226 | Ga0207700_11001870 | 3300025928 | Bacteria | 748 |
| 227 | Ga0207700_11031704 | 3300025928 | Unclassified | 736 |
| 228 | Ga0207706_10228635 | 3300025933 | Bacteria | 1628 |
| 229 | Ga0207706_10855485 | 3300025933 | Bacteria | 770 |
| 230 | Ga0207686_10445831 | 3300025934 | Bacteria | 995 |
| 231 | Ga0207709_10415395 | 3300025935 | Bacteria | 1032 |
| 232 | Ga0207709_10851898 | 3300025935 | Bacteria | 738 |
| 233 | Ga0207670_10192965 | 3300025936 | Bacteria | 1542 |
| 234 | Ga0207670_10639848 | 3300025936 | Bacteria | 876 |
| 235 | Ga0207669_10006694 | 3300025937 | Bacteria | 5284 |
| 236 | Ga0207704_10316650 | 3300025938 | Bacteria | 1202 |
| 237 | Ga0207704_10495668 | 3300025938 | Bacteria | 983 |
| 238 | Ga0207704_10654450 | 3300025938 | Bacteria | 866 |
| 239 | Ga0207704_11191794 | 3300025938 | Bacteria | 649 |
| 240 | Ga0207665_10014606 | 3300025939 | Bacteria | 5169 |
| 241 | Ga0207691_10012366 | 3300025940 | Bacteria | 8181 |
| 242 | Ga0207691_10801599 | 3300025940 | Unclassified | 791 |
| 243 | Ga0207711_11067443 | 3300025941 | Unclassified | 748 |
| 244 | Ga0207689_10057239 | 3300025942 | Bacteria | 3207 |
| 245 | Ga0207689_10092815 | 3300025942 | Bacteria | 2480 |
| 246 | Ga0207689_10143324 | 3300025942 | Bacteria | 1969 |
| 247 | Ga0207689_11002748 | 3300025942 | Bacteria | 704 |
| 248 | Ga0207667_11514451 | 3300025949 | Bacteria | 641 |
| 249 | Ga0207651_10099523 | 3300025960 | Bacteria | 2153 |
| 250 | Ga0207651_10418676 | 3300025960 | Bacteria | 1143 |
| 251 | Ga0207712_10250909 | 3300025961 | Bacteria | 1430 |
| 252 | Ga0207712_10363984 | 3300025961 | Bacteria | 1206 |
| 253 | Ga0207712_10565236 | 3300025961 | Bacteria | 980 |
| 254 | Ga0207712_12003210 | 3300025961 | Bacteria | 518 |
| 255 | Ga0207658_10903684 | 3300025986 | Bacteria | 804 |
| 256 | Ga0207677_11652512 | 3300026023 | Bacteria | 593 |
| 257 | Ga0207703_10494871 | 3300026035 | Bacteria | 1147 |
| 258 | Ga0207678_10088138 | 3300026067 | Bacteria | 2652 |
| 259 | Ga0207678_10304998 | 3300026067 | Bacteria | 1369 |
| 260 | Ga0207708_10007629 | 3300026075 | Bacteria | 8005 |
| 261 | Ga0207708_10103163 | 3300026075 | Bacteria | 2209 |
| 262 | Ga0207708_10445239 | 3300026075 | Bacteria | 1078 |
| 263 | Ga0207708_11096905 | 3300026075 | Bacteria | 694 |
| 264 | Ga0207702_11741863 | 3300026078 | Bacteria | 616 |
| 265 | Ga0207641_10757831 | 3300026088 | Bacteria | 959 |
| 266 | Ga0207648_10170150 | 3300026089 | Bacteria | 1926 |
| 267 | Ga0207676_10105833 | 3300026095 | Bacteria | 2343 |
| 268 | Ga0207676_10641639 | 3300026095 | Bacteria | 1024 |
| 269 | Ga0207674_10488762 | 3300026116 | Bacteria | 1190 |
| 270 | Ga0207674_10883406 | 3300026116 | Bacteria | 862 |
| 271 | Ga0207675_100043836 | 3300026118 | Bacteria | 4179 |
| 272 | Ga0207675_100063773 | 3300026118 | Bacteria | 3443 |
| 273 | Ga0207675_100982722 | 3300026118 | Bacteria | 862 |
| 274 | Ga0207683_11711497 | 3300026121 | Bacteria | 578 |
| 275 | Ga0207683_11822542 | 3300026121 | Bacteria | 557 |
| 276 | Ga0207698_12543170 | 3300026142 | Bacteria | 522 |
| 277 | Ga0209813_10028285 | 3300027866 | Bacteria | 1634 |
| 278 | Ga0209813_10115076 | 3300027866 | Bacteria | 930 |
| 279 | Ga0209813_10184074 | 3300027866 | Bacteria | 766 |
| 280 | Ga0207428_10168769 | 3300027907 | Bacteria | 1658 |
| 281 | Ga0207428_10294840 | 3300027907 | Bacteria | 1201 |
| 282 | Ga0268266_10001178 | 3300028379 | Bacteria | 32300 |
| 283 | Ga0268265_10000230 | 3300028380 | Bacteria | 63968 |
| 284 | Ga0268265_10284570 | 3300028380 | Bacteria | 1481 |
| 285 | Ga0268265_10587260 | 3300028380 | Bacteria | 1063 |
| 286 | Ga0268264_10102310 | 3300028381 | Bacteria | 2493 |
| 287 | Ga0268264_10255483 | 3300028381 | Bacteria | 1630 |
| 288 | Ga0268264_11144258 | 3300028381 | Bacteria | 787 |
| 289 | Ga0268264_11193180 | 3300028381 | Bacteria | 770 |
| 290 | Ga0268264_11535887 | 3300028381 | Bacteria | 676 |
| 291 | Ga0268264_12041901 | 3300028381 | Bacteria | 582 |
| 292 | Ga0307511_10021467 | 3300030521 | Bacteria | 6081 |
| 293 | Ga0307408_101311951 | 3300031548 | Bacteria | 679 |
| 294 | Ga0316575_10013931 | 3300031665 | Bacteria | 3013 |
| 295 | Ga0316576_10061175 | 3300031727 | Bacteria | 2759 |
| 296 | Ga0316576_10091432 | 3300031727 | Bacteria | 2267 |
| 297 | Ga0316576_10094456 | 3300031727 | Bacteria | 2230 |
| 298 | Ga0316576_10104774 | 3300031727 | Bacteria | 2117 |
| 299 | Ga0316576_10213457 | 3300031727 | Bacteria | 1452 |
| 300 | Ga0316578_10017974 | 3300031728 | Bacteria | 3862 |
| 301 | Ga0316578_10026254 | 3300031728 | Bacteria | 3283 |
| 302 | Ga0316577_10059560 | 3300031733 | Bacteria | 2131 |
| 303 | Ga0316577_10243189 | 3300031733 | Bacteria | 1018 |
| 304 | Ga0316577_10311415 | 3300031733 | Bacteria | 892 |
| 305 | Ga0307416_102041733 | 3300032002 | Bacteria | 676 |
| 306 | Ga0316583_10003154 | 3300032133 | Bacteria | 5794 |
| 307 | Ga0316583_10004720 | 3300032133 | Bacteria | 4865 |
| 308 | Ga0316583_10029653 | 3300032133 | Bacteria | 1950 |
| 309 | Ga0316583_10131006 | 3300032133 | Bacteria | 874 |
| 310 | Ga0316585_10001279 | 3300032137 | Bacteria | 6587 |
| 311 | Ga0316580_10141064 | 3300032139 | Bacteria | 739 |
| 312 | Ga0316593_10032088 | 3300032168 | Bacteria | 1714 |
| 313 | Ga0316593_10056123 | 3300032168 | Bacteria | 1339 |
| 314 | Ga0316593_10149565 | 3300032168 | Bacteria | 849 |
| 315 | Ga0373929_0000001 | 3300035085 | Bacteria | 956023 |
| 316 | Ga0373934_0008552 | 3300035086 | Bacteria | 3816 |
| 317 | Ga0373923_0451656 | 3300035111 | Bacteria | 623 |
| 318 | Ga0373941_0287476 | 3300035115 | Bacteria | 652 |
| 319 | Ga0373954_0027288 | 3300035118 | Bacteria | 2620 |
| 320 | Ga0373956_0119716 | 3300035119 | Bacteria | 1229 |
| 321 | Ga0373956_0402060 | 3300035119 | Bacteria | 653 |
| 322 | Ga0373957_0289497 | 3300035120 | Bacteria | 693 |
| 323 | Ga0373943_0262970 | 3300035170 | Bacteria | 972 |
| 324 | Ga0373955_0711254 | 3300035172 | Bacteria | 617 |
| 325 | Ga0316574_0020417 | 3300035398 | Bacteria | 3921 |
| 326 | Ga0316574_0081022 | 3300035398 | Bacteria | 2061 |
| 327 | Ga0316574_0483000 | 3300035398 | Bacteria | 774 |
| 328 | Ga0316574_0537124 | 3300035398 | Bacteria | 727 |
| 329 | Ga0373935_0277291 | 3300035692 | Bacteria | 1180 |
| 330 | Ga0373933_0010133 | 3300035724 | Bacteria | 5160 |
| 331 | Ga0373933_0768769 | 3300035724 | Bacteria | 634 |
| 332 | Ga0373937_0002505 | 3300036401 | Bacteria | 15255 |
| 333 | Ga0373937_0006813 | 3300036401 | Bacteria | 9859 |
| 334 | Ga0316582_0038604 | 3300036647 | Bacteria | 2969 |
| 335 | Ga0316582_0092199 | 3300036647 | Bacteria | 1996 |
| 336 | Ga0316582_0257144 | 3300036647 | Bacteria | 1197 |
| 337 | Ga0316584_0093223 | 3300036712 | Bacteria | 2255 |
| 338 | Ga0316584_0165820 | 3300036712 | Bacteria | 1640 |
| 339 | Ga0400483_015074 | 3300039062 | Bacteria | 1960 |
| 340 | Ga0451789_0711377 | 3300041443 | Bacteria | 1197 |
| 341 | Ga0451797_1350670 | 3300041453 | Bacteria | 1073 |
| 342 | Ga0451795_0324929 | 3300041456 | Bacteria | 657 |
| 343 | Ga0451802_0479589 | 3300041460 | Bacteria | 2023 |
| 344 | Ga0451802_1679855 | 3300041460 | Bacteria | 1053 |
| 345 | Ga0451807_0377212 | 3300041486 | Bacteria | 1876 |
| 346 | Ga0451807_2063280 | 3300041486 | Bacteria | 1527 |
| 347 | Ga0451841_0760955 | 3300041498 | Bacteria | 540 |
| 348 | Ga0439431_0050350 | 3300041997 | Bacteria | 1079 |
| 349 | Ga0439433_0065882 | 3300041999 | Bacteria | 869 |
| 350 | Ga0439442_037960 | 3300042002 | Bacteria | 1010 |
| 351 | Ga0439445_0165698 | 3300042004 | Bacteria | 646 |
| 352 | Ga0439449_0093936 | 3300042007 | Bacteria | 1108 |
| 353 | Ga0450920_012036 | 3300042122 | Bacteria | 1618 |
| 354 | Ga0450895_001666 | 3300042132 | Bacteria | 1571 |
| 355 | Ga0450896_001923 | 3300042133 | Bacteria | 2636 |
| 356 | Ga0450906_012541 | 3300042145 | Bacteria | 1570 |
| 357 | Ga0450910_033902 | 3300042147 | Bacteria | 809 |
| 358 | Ga0450908_016281 | 3300042184 | Bacteria | 1327 |
| 359 | Ga0451577_0056839 | 3300042876 | Bacteria | 3490 |
| 360 | Ga0451577_0082175 | 3300042876 | Bacteria | 2873 |
| 361 | Ga0451577_1198408 | 3300042876 | Bacteria | 677 |
| 362 | Ga0451577_1584705 | 3300042876 | Bacteria | 578 |
| 363 | Ga0453683_0113285 | 3300044673 | Bacteria | 1706 |
| 364 | Ga0453683_0833824 | 3300044673 | Bacteria | 608 |
| 365 | Ga0453683_1143828 | 3300044673 | Bacteria | 520 |
| 366 | Ga0453684_0101505 | 3300044712 | Bacteria | 3520 |
| 367 | Ga0453684_0549334 | 3300044712 | Bacteria | 1272 |
| 368 | Ga0453684_1622476 | 3300044712 | Bacteria | 663 |
| 369 | Ga0466960_0025774 | 3300044901 | Bacteria | 2664 |
| 370 | Ga0451576_0041983 | 3300045051 | Bacteria | 4830 |
| 371 | Ga0451576_1159845 | 3300045051 | Bacteria | 807 |
| 372 | Ga0466967_2217173 | 3300045976 | Bacteria | 545 |
| 373 | Ga0495629_0001085 | 3300046459 | Bacteria | 21608 |
| 374 | Ga0495629_0018969 | 3300046459 | Bacteria | 4919 |
| 375 | Ga0495638_0006310 | 3300046460 | Bacteria | 8643 |
| 376 | Ga0495638_0255107 | 3300046460 | Bacteria | 965 |
| 377 | Ga0495651_0305636 | 3300046462 | Bacteria | 1065 |
| 378 | Ga0495582_0007932 | 3300046473 | Bacteria | 5866 |
| 379 | Ga0495639_0002890 | 3300046475 | Bacteria | 7477 |
| 380 | Ga0495639_0016731 | 3300046475 | Bacteria | 3184 |
| 381 | Ga0495662_0038269 | 3300046476 | Bacteria | 2318 |
| 382 | Ga0495594_0004579 | 3300046499 | Bacteria | 7116 |
| 383 | Ga0495594_0540581 | 3300046499 | Bacteria | 661 |
| 384 | Ga0495596_0176640 | 3300046500 | Bacteria | 830 |
| 385 | Ga0495630_1296817 | 3300046517 | Bacteria | 549 |
| 386 | Ga0495644_0386885 | 3300046523 | Bacteria | 553 |
| 387 | Ga0495663_0142217 | 3300046525 | Bacteria | 815 |
| 388 | Ga0495640_0663727 | 3300046533 | Bacteria | 627 |
| 389 | Ga0495586_0063358 | 3300046535 | Bacteria | 2014 |
| 390 | Ga0495587_0127747 | 3300046536 | Bacteria | 1454 |
| 391 | Ga0495587_0292827 | 3300046536 | Bacteria | 911 |
| 392 | Ga0495598_0059278 | 3300046537 | Bacteria | 1176 |
| 393 | Ga0495621_0067321 | 3300046539 | Bacteria | 1312 |
| 394 | Ga0495645_0759853 | 3300046543 | Bacteria | 584 |
| 395 | Ga0495622_0221978 | 3300046557 | Bacteria | 837 |
| 396 | Ga0495633_0114400 | 3300046558 | Bacteria | 1251 |
| 397 | Ga0495656_0217655 | 3300046615 | Bacteria | 954 |
| 398 | Ga0495668_0296147 | 3300046616 | Bacteria | 887 |
| 399 | Ga0495634_0860124 | 3300046642 | Bacteria | 515 |
| 400 | Ga0495635_0001421 | 3300046663 | Bacteria | 15967 |
| 401 | Ga0495658_0000401 | 3300046683 | Bacteria | 24251 |
| 402 | Ga0495669_0678074 | 3300046684 | Bacteria | 501 |
| 403 | Ga0495600_0901904 | 3300046809 | Bacteria | 521 |
| 404 | Ga0495581_0000586 | 3300047315 | Bacteria | 19006 |
| 405 | Ga0495581_0053939 | 3300047315 | Bacteria | 2321 |
| 406 | Ga0495636_0421282 | 3300047318 | Bacteria | 638 |
| 407 | Ga0495672_0205463 | 3300047320 | Bacteria | 982 |
| 408 | Ga0495676_0130421 | 3300047321 | Bacteria | 1815 |
| 409 | Ga0495680_0003220 | 3300047322 | Bacteria | 16223 |
| 410 | Ga0495680_0148675 | 3300047322 | Bacteria | 1709 |
| 411 | Ga0495602_0325974 | 3300048088 | Bacteria | 1116 |
| 412 | Ga0495602_0539759 | 3300048088 | Bacteria | 810 |
| 413 | Ga0495614_0095409 | 3300048089 | Bacteria | 1296 |
| 414 | Ga0496103_0235257 | 3300048906 | Bacteria | 1179 |
| 415 | Ga0496104_1056706 | 3300048907 | Bacteria | 716 |
| 416 | Ga0496109_0749565 | 3300048912 | Bacteria | 914 |
| 417 | Ga0501306_013195 | 3300049127 | Bacteria | 1075 |
| 418 | Ga0501311_041273 | 3300049527 | Bacteria | 700 |
| 419 | Ga0501316_044664 | 3300049532 | Bacteria | 626 |
| 420 | Ga0501324_019133 | 3300049540 | Bacteria | 690 |
| 421 | Ga0501032_0390246 | 3300049569 | Bacteria | 895 |
| 422 | Ga0501033_0924096 | 3300049570 | Bacteria | 586 |
| 423 | Ga0501037_0370105 | 3300049573 | Bacteria | 986 |
| 424 | Ga0501038_0005479 | 3300049574 | Bacteria | 11789 |
| 425 | Ga0501038_0208259 | 3300049574 | Bacteria | 1566 |
| 426 | Ga0501039_0199847 | 3300049575 | Bacteria | 1572 |
| 427 | Ga0501039_0434341 | 3300049575 | Bacteria | 1031 |
| 428 | Ga0501039_0879123 | 3300049575 | Bacteria | 698 |
| 429 | Ga0501040_0147414 | 3300049576 | Bacteria | 1659 |
| 430 | Ga0501040_0722678 | 3300049576 | Bacteria | 720 |
| 431 | Ga0501041_0053510 | 3300049577 | Bacteria | 2462 |
| 432 | Ga0501042_0228606 | 3300049578 | Bacteria | 1342 |
| 433 | Ga0501042_0444645 | 3300049578 | Unclassified | 940 |
| 434 | Ga0501043_0014065 | 3300049579 | Bacteria | 6264 |
| 435 | Ga0501046_0096966 | 3300049580 | Bacteria | 2265 |
| 436 | Ga0501047_0002850 | 3300049581 | Bacteria | 16394 |
| 437 | Ga0501047_1249521 | 3300049581 | Bacteria | 556 |
| 438 | Ga0501048_0255283 | 3300049582 | Bacteria | 1245 |
| 439 | Ga0501067_0002959 | 3300049583 | Bacteria | 9375 |
| 440 | Ga0501068_0000298 | 3300049584 | Bacteria | 24810 |
| 441 | Ga0501068_0274123 | 3300049584 | Unclassified | 1077 |
| 442 | Ga0501069_0011603 | 3300049585 | Bacteria | 4670 |
| 443 | Ga0501070_0115439 | 3300049586 | Bacteria | 2218 |
| 444 | Ga0501071_0495094 | 3300049587 | Bacteria | 937 |
| 445 | Ga0501072_0000013 | 3300049588 | Bacteria | 172318 |
| 446 | Ga0501073_0001560 | 3300049589 | Bacteria | 16979 |
| 447 | Ga0501073_0264198 | 3300049589 | Bacteria | 1188 |
| 448 | Ga0501073_0315907 | 3300049589 | Bacteria | 1078 |
| 449 | Ga0501074_0001093 | 3300049590 | Bacteria | 17708 |
| 450 | Ga0501074_0902534 | 3300049590 | Bacteria | 622 |
| 451 | Ga0501075_0462092 | 3300049591 | Bacteria | 968 |
| 452 | Ga0501076_0005208 | 3300049592 | Bacteria | 9316 |
| 453 | Ga0501076_0140135 | 3300049592 | Bacteria | 1964 |
| 454 | Ga0501076_1148669 | 3300049592 | Bacteria | 639 |
| 455 | Ga0501077_0042009 | 3300049593 | Bacteria | 2909 |
| 456 | Ga0501230_168431 | 3300049667 | Bacteria | 502 |
| 457 | Ga0501079_0000583 | 3300049741 | Bacteria | 24201 |
| 458 | Ga0501079_0063163 | 3300049741 | Bacteria | 2857 |
| 459 | Ga0501079_0426994 | 3300049741 | Bacteria | 1040 |
| 460 | Ga0501080_0084855 | 3300049742 | Bacteria | 2942 |
| 461 | Ga0501080_0246537 | 3300049742 | Bacteria | 1629 |
| 462 | Ga0501080_0439657 | 3300049742 | Bacteria | 1170 |
| 463 | Ga0501080_1292158 | 3300049742 | Bacteria | 625 |
| 464 | Ga0501080_1713744 | 3300049742 | Bacteria | 530 |
| 465 | Ga0501081_0070245 | 3300049743 | Bacteria | 2440 |
| 466 | Ga0501081_0259804 | 3300049743 | Bacteria | 1269 |
| 467 | Ga0501081_0932991 | 3300049743 | Bacteria | 655 |
| 468 | Ga0501083_0002132 | 3300049744 | Bacteria | 13574 |
| 469 | Ga0501083_0004309 | 3300049744 | Bacteria | 10023 |
| 470 | Ga0501083_0006433 | 3300049744 | Bacteria | 8333 |
| 471 | Ga0501083_0280312 | 3300049744 | Bacteria | 1084 |
| 472 | Ga0501263_021577 | 3300049760 | Bacteria | 870 |
| 473 | Ga0501035_0437120 | 3300049822 | Unclassified | 1084 |
| 474 | Ga0501044_0061437 | 3300049823 | Bacteria | 3843 |
| 475 | Ga0501045_0180083 | 3300049824 | Bacteria | 1575 |
| 476 | Ga0501045_0965338 | 3300049824 | Bacteria | 625 |
| 477 | nmdc:mga00v17_289450_c1 | 3300050491 | Bacteria | 1064 |
| 478 | nmdc:mga0k408_16714_c2 | 3300050493 | Bacteria | 3730 |
| 479 | nmdc:mga0k408_292593_c1 | 3300050493 | Bacteria | 972 |
| 480 | nmdc:mga06z11_15279_c1 | 3300050494 | Bacteria | 3423 |
| 481 | nmdc:mga04h51_102557_c1 | 3300050495 | Bacteria | 1044 |
| 482 | nmdc:mga04h51_248068_c1 | 3300050495 | Bacteria | 713 |
| 483 | nmdc:mga04h51_39600_c1 | 3300050495 | Bacteria | 1532 |
| 484 | nmdc:mga07m45_151571_c1 | 3300050496 | Bacteria | 1345 |
| 485 | nmdc:mga05p37_116790_c1 | 3300050507 | Bacteria | 3279 |
| 486 | nmdc:mga05p37_1221939_c1 | 3300050507 | Bacteria | 774 |
| 487 | nmdc:mga05p37_1629851_c1 | 3300050507 | Bacteria | 634 |
| 488 | nmdc:mga05p37_367163_c1 | 3300050507 | Bacteria | 1690 |
| 489 | nmdc:mga05p37_45244_c1 | 3300050507 | Bacteria | 5415 |
| 490 | nmdc:mga05p37_720777_c1 | 3300050507 | Bacteria | 1104 |
| 491 | nmdc:mga05p37_7671_c1 | 3300050507 | Bacteria | 12731 |
| 492 | nmdc:mga05p37_89941_c1 | 3300050507 | Bacteria | 3783 |
| 493 | nmdc:mga06r32_361101_c1 | 3300050510 | Bacteria | 1436 |
| 494 | nmdc:mga06r32_49737_c2 | 3300050510 | Bacteria | 1033 |
| 495 | nmdc:mga06r32_532091_c1 | 3300050510 | Bacteria | 759 |
| 496 | nmdc:mga06r32_648054_c1 | 3300050510 | Bacteria | 1024 |
| 497 | nmdc:mga08y16_154847_c1 | 3300050511 | Bacteria | 2382 |
| 498 | nmdc:mga08y16_1757066_c1 | 3300050511 | Bacteria | 574 |
| 499 | nmdc:mga08y16_483482_c1 | 3300050511 | Bacteria | 1260 |
| 500 | nmdc:mga0n895_105622_c1 | 3300050512 | Bacteria | 2829 |
| 501 | nmdc:mga0n895_1750244_c1 | 3300050512 | Bacteria | 583 |
| 502 | nmdc:mga0n895_246885_c1 | 3300050512 | Bacteria | 1812 |
| 503 | nmdc:mga0n895_442043_c1 | 3300050512 | Bacteria | 1314 |
| 504 | nmdc:mga0n895_83882_c1 | 3300050512 | Bacteria | 3179 |
| 505 | nmdc:mga0rr50_223925_c1 | 3300050513 | Bacteria | 1554 |
| 506 | nmdc:mga0rr50_253929_c1 | 3300050513 | Bacteria | 1461 |
| 507 | nmdc:mga0rr50_43944_c1 | 3300050513 | Bacteria | 3273 |
| 508 | nmdc:mga0rr50_67190_c1 | 3300050513 | Bacteria | 2722 |
| 509 | nmdc:mga0rr50_697722_c1 | 3300050513 | Bacteria | 866 |
| 510 | nmdc:mga08x19_449669_c1 | 3300050514 | Bacteria | 907 |
| 511 | nmdc:mga0a205_174267_c1 | 3300050515 | Bacteria | 2047 |
| 512 | nmdc:mga0a205_194006_c1 | 3300050515 | Bacteria | 1922 |
| 513 | nmdc:mga0a205_474124_c1 | 3300050515 | Bacteria | 1110 |
| 514 | nmdc:mga0a205_556941_c1 | 3300050515 | Bacteria | 1001 |
| 515 | nmdc:mga0a205_601841_c1 | 3300050515 | Bacteria | 952 |
| 516 | Ga0495619_0006248 | 3300053085 | Bacteria | 7557 |
| 517 | Ga0495619_0710808 | 3300053085 | Bacteria | 683 |
| 518 | Ga0495619_0753490 | 3300053085 | Bacteria | 660 |
| 519 | Ga0500592_028656 | 3300053116 | Bacteria | 898 |
| 520 | Ga0500568_0004595 | 3300053139 | Bacteria | 7346 |
| 521 | Ga0501084_0000136 | 3300054114 | Bacteria | 55694 |
| 522 | Ga0501084_0035628 | 3300054114 | Bacteria | 4160 |
| 523 | Ga0501084_0649817 | 3300054114 | Bacteria | 890 |
| 524 | Ga0501084_1445030 | 3300054114 | Bacteria | 576 |
| 525 | Ga0587066_160779 | 3300059490 | Bacteria | 564 |
| 526 | Ga0587111_0023103 | 3300060346 | Bacteria | 1213 |
| 527 | Ga0501082_0000651 | 3300060353 | Bacteria | 30636 |
| 528 | Ga0501082_0051914 | 3300060353 | Bacteria | 3534 |
| 529 | Ga0501082_0053520 | 3300060353 | Bacteria | 3479 |
| 530 | Ga0530510_0011015 | 3300061734 | Bacteria | 6344 |
| 531 | Ga0530510_0108011 | 3300061734 | Bacteria | 2037 |
| 532 | Ga0530510_0234601 | 3300061734 | Bacteria | 1365 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_1198408 | Ga0451577_1198408_308_640 | 110 |
| 2 | 3300042876 | Ga0451577_1584705 | Ga0451577_1584705_34_366 | 110 |
| 3 | 3300009094 | Ga0111539_10165868 | Ga0111539_101658682 | 112 |
| 4 | 3300009147 | Ga0114129_10981291 | Ga0114129_109812912 | 112 |
| 5 | 3300009553 | Ga0105249_10226052 | Ga0105249_102260523 | 112 |
| 6 | 3300035086 | Ga0373934_0008552 | Ga0373934_0008552_3296_3634 | 112 |
| 7 | 3300035118 | Ga0373954_0027288 | Ga0373954_0027288_818_1156 | 112 |
| 8 | 3300035119 | Ga0373956_0402060 | Ga0373956_0402060_219_557 | 112 |
| 9 | 3300035120 | Ga0373957_0289497 | Ga0373957_0289497_227_565 | 112 |
| 10 | 3300035724 | Ga0373933_0010133 | Ga0373933_0010133_591_929 | 112 |
| 11 | 3300036401 | Ga0373937_0002505 | Ga0373937_0002505_7254_7592 | 112 |
| 12 | 3300042122 | Ga0450920_012036 | Ga0450920_012036_1070_1408 | 112 |
| 13 | 3300042132 | Ga0450895_001666 | Ga0450895_001666_157_495 | 112 |
| 14 | 3300042133 | Ga0450896_001923 | Ga0450896_001923_26_364 | 112 |
| 15 | 3300042145 | Ga0450906_012541 | Ga0450906_012541_646_984 | 112 |
| 16 | 3300042147 | Ga0450910_033902 | Ga0450910_033902_442_780 | 112 |
| 17 | 3300042184 | Ga0450908_016281 | Ga0450908_016281_901_1239 | 112 |
| 18 | 3300044673 | Ga0453683_1143828 | Ga0453683_1143828_163_501 | 112 |
| 19 | 3300046462 | Ga0495651_0305636 | Ga0495651_0305636_706_1044 | 112 |
| 20 | 3300046536 | Ga0495587_0292827 | Ga0495587_0292827_352_690 | 112 |
| 21 | 3300047322 | Ga0495680_0148675 | Ga0495680_0148675_1206_1544 | 112 |
| 22 | 3300048088 | Ga0495602_0539759 | Ga0495602_0539759_64_402 | 112 |
| 23 | 3300049742 | Ga0501080_1292158 | Ga0501080_1292158_243_581 | 112 |
| 24 | 3300049743 | Ga0501081_0259804 | Ga0501081_0259804_805_1143 | 112 |
| 25 | 3300050507 | nmdc:mga05p37_720777_c1 | nmdc:mga05p37_720777_c1_438_776 | 112 |
| 26 | 3300046535 | Ga0495586_0063358 | Ga0495586_0063358_170_520 | 114 |
| 27 | 3300025934 | Ga0207686_10445831 | Ga0207686_104458312 | 115 |
| 28 | 3300050515 | nmdc:mga0a205_474124_c1 | nmdc:mga0a205_474124_c1_77_472 | 121 |
| 29 | 3300049570 | Ga0501033_0924096 | Ga0501033_0924096_173_559 | 128 |
| 30 | 3300049574 | Ga0501038_0208259 | Ga0501038_0208259_1165_1551 | 128 |
| 31 | 3300049575 | Ga0501039_0199847 | Ga0501039_0199847_477_863 | 128 |
| 32 | 3300049576 | Ga0501040_0147414 | Ga0501040_0147414_839_1225 | 128 |
| 33 | 3300049577 | Ga0501041_0053510 | Ga0501041_0053510_1529_1915 | 128 |
| 34 | 3300049578 | Ga0501042_0444645 | Ga0501042_0444645_485_871 | 128 |
| 35 | 3300049580 | Ga0501046_0096966 | Ga0501046_0096966_946_1332 | 128 |
| 36 | 3300049584 | Ga0501068_0274123 | Ga0501068_0274123_75_461 | 128 |
| 37 | 3300049590 | Ga0501074_0902534 | Ga0501074_0902534_128_514 | 128 |
| 38 | 3300049591 | Ga0501075_0462092 | Ga0501075_0462092_378_764 | 128 |
| 39 | 3300049592 | Ga0501076_0140135 | Ga0501076_0140135_601_987 | 128 |
| 40 | 3300049741 | Ga0501079_0063163 | Ga0501079_0063163_2079_2465 | 128 |
| 41 | 3300049742 | Ga0501080_0246537 | Ga0501080_0246537_413_799 | 128 |
| 42 | 3300049743 | Ga0501081_0070245 | Ga0501081_0070245_1920_2306 | 128 |
| 43 | 3300049744 | Ga0501083_0280312 | Ga0501083_0280312_525_911 | 128 |
| 44 | 3300049822 | Ga0501035_0437120 | Ga0501035_0437120_37_423 | 128 |
| 45 | 3300049824 | Ga0501045_0965338 | Ga0501045_0965338_154_540 | 128 |
| 46 | 3300054114 | Ga0501084_0649817 | Ga0501084_0649817_403_789 | 128 |
| 47 | 3300060353 | Ga0501082_0051914 | Ga0501082_0051914_1634_2020 | 128 |
| 48 | 3300005334 | Ga0068869_100501258 | Ga0068869_1005012582 | 129 |
| 49 | 3300006871 | Ga0075434_100318467 | Ga0075434_1003184673 | 129 |
| 50 | 3300025942 | Ga0207689_10143324 | Ga0207689_101433243 | 129 |
| 51 | 3300031548 | Ga0307408_101311951 | Ga0307408_1013119512 | 129 |
| 52 | 3300046543 | Ga0495645_0759853 | Ga0495645_0759853_110_502 | 129 |
| 53 | 3300050493 | nmdc:mga0k408_292593_c1 | nmdc:mga0k408_292593_c1_339_728 | 129 |
| 54 | 3300050495 | nmdc:mga04h51_102557_c1 | nmdc:mga04h51_102557_c1_173_562 | 129 |
| 55 | 3300050512 | nmdc:mga0n895_1750244_c1 | nmdc:mga0n895_1750244_c1_49_441 | 129 |
| 56 | 3300002239 | JGI24034J26672_10071135 | JGI24034J26672_100711352 | 130 |
| 57 | 3300002244 | JGI24742J22300_10016149 | JGI24742J22300_100161492 | 130 |
| 58 | 3300003322 | rootL2_10015203 | rootL2_100152031 | 130 |
| 59 | 3300005288 | Ga0065714_10137061 | Ga0065714_101370611 | 130 |
| 60 | 3300005290 | Ga0065712_10003855 | Ga0065712_100038559 | 130 |
| 61 | 3300005293 | Ga0065715_10143316 | Ga0065715_101433162 | 130 |
| 62 | 3300005295 | Ga0065707_10008765 | Ga0065707_100087653 | 130 |
| 63 | 3300005295 | Ga0065707_10097393 | Ga0065707_100973934 | 130 |
| 64 | 3300005328 | Ga0070676_10023072 | Ga0070676_100230725 | 130 |
| 65 | 3300005328 | Ga0070676_10167156 | Ga0070676_101671561 | 130 |
| 66 | 3300005330 | Ga0070690_100066053 | Ga0070690_1000660533 | 130 |
| 67 | 3300005330 | Ga0070690_100237886 | Ga0070690_1002378861 | 130 |
| 68 | 3300005330 | Ga0070690_100365598 | Ga0070690_1003655982 | 130 |
| 69 | 3300005331 | Ga0070670_100011000 | Ga0070670_1000110003 | 130 |
| 70 | 3300005334 | Ga0068869_100122584 | Ga0068869_1001225842 | 130 |
| 71 | 3300005334 | Ga0068869_100188931 | Ga0068869_1001889312 | 130 |
| 72 | 3300005334 | Ga0068869_100264147 | Ga0068869_1002641472 | 130 |
| 73 | 3300005335 | Ga0070666_10022827 | Ga0070666_100228275 | 130 |
| 74 | 3300005335 | Ga0070666_10127318 | Ga0070666_101273182 | 130 |
| 75 | 3300005336 | Ga0070680_100492119 | Ga0070680_1004921192 | 130 |
| 76 | 3300005337 | Ga0070682_100085309 | Ga0070682_1000853092 | 130 |
| 77 | 3300005340 | Ga0070689_100879759 | Ga0070689_1008797592 | 130 |
| 78 | 3300005343 | Ga0070687_100278628 | Ga0070687_1002786282 | 130 |
| 79 | 3300005343 | Ga0070687_101269176 | Ga0070687_1012691761 | 130 |
| 80 | 3300005345 | Ga0070692_10209495 | Ga0070692_102094952 | 130 |
| 81 | 3300005347 | Ga0070668_100509239 | Ga0070668_1005092392 | 130 |
| 82 | 3300005353 | Ga0070669_100000164 | Ga0070669_10000016442 | 130 |
| 83 | 3300005353 | Ga0070669_100065955 | Ga0070669_1000659554 | 130 |
| 84 | 3300005353 | Ga0070669_100682001 | Ga0070669_1006820012 | 130 |
| 85 | 3300005353 | Ga0070669_101295211 | Ga0070669_1012952111 | 130 |
| 86 | 3300005354 | Ga0070675_100319443 | Ga0070675_1003194432 | 130 |
| 87 | 3300005354 | Ga0070675_100356665 | Ga0070675_1003566652 | 130 |
| 88 | 3300005356 | Ga0070674_101148759 | Ga0070674_1011487591 | 130 |
| 89 | 3300005364 | Ga0070673_100044423 | Ga0070673_1000444232 | 130 |
| 90 | 3300005364 | Ga0070673_100238814 | Ga0070673_1002388142 | 130 |
| 91 | 3300005365 | Ga0070688_100353334 | Ga0070688_1003533342 | 130 |
| 92 | 3300005365 | Ga0070688_100654026 | Ga0070688_1006540262 | 130 |
| 93 | 3300005365 | Ga0070688_100664474 | Ga0070688_1006644742 | 130 |
| 94 | 3300005365 | Ga0070688_101044665 | Ga0070688_1010446652 | 130 |
| 95 | 3300005366 | Ga0070659_101669334 | Ga0070659_1016693341 | 130 |
| 96 | 3300005367 | Ga0070667_102097513 | Ga0070667_1020975131 | 130 |
| 97 | 3300005406 | Ga0070703_10169917 | Ga0070703_101699172 | 130 |
| 98 | 3300005434 | Ga0070709_10000083 | Ga0070709_100000838 | 130 |
| 99 | 3300005434 | Ga0070709_10272640 | Ga0070709_102726402 | 130 |
| 100 | 3300005434 | Ga0070709_11224656 | Ga0070709_112246561 | 130 |
| 101 | 3300005436 | Ga0070713_101524428 | Ga0070713_1015244281 | 130 |
| 102 | 3300005437 | Ga0070710_10232429 | Ga0070710_102324291 | 130 |
| 103 | 3300005438 | Ga0070701_10087987 | Ga0070701_100879872 | 130 |
| 104 | 3300005441 | Ga0070700_100119768 | Ga0070700_1001197683 | 130 |
| 105 | 3300005441 | Ga0070700_100347971 | Ga0070700_1003479712 | 130 |
| 106 | 3300005441 | Ga0070700_100486101 | Ga0070700_1004861012 | 130 |
| 107 | 3300005444 | Ga0070694_100001347 | Ga0070694_10000134720 | 130 |
| 108 | 3300005445 | Ga0070708_101104893 | Ga0070708_1011048932 | 130 |
| 109 | 3300005445 | Ga0070708_101469618 | Ga0070708_1014696181 | 130 |
| 110 | 3300005445 | Ga0070708_101867310 | Ga0070708_1018673101 | 130 |
| 111 | 3300005455 | Ga0070663_100582943 | Ga0070663_1005829432 | 130 |
| 112 | 3300005455 | Ga0070663_100642522 | Ga0070663_1006425222 | 130 |
| 113 | 3300005455 | Ga0070663_100682182 | Ga0070663_1006821822 | 130 |
| 114 | 3300005457 | Ga0070662_100043656 | Ga0070662_1000436562 | 130 |
| 115 | 3300005458 | Ga0070681_10266198 | Ga0070681_102661982 | 130 |
| 116 | 3300005459 | Ga0068867_100319593 | Ga0068867_1003195932 | 130 |
| 117 | 3300005459 | Ga0068867_101437055 | Ga0068867_1014370551 | 130 |
| 118 | 3300005466 | Ga0070685_10002620 | Ga0070685_1000262010 | 130 |
| 119 | 3300005466 | Ga0070685_10500286 | Ga0070685_105002862 | 130 |
| 120 | 3300005466 | Ga0070685_11084095 | Ga0070685_110840952 | 130 |
| 121 | 3300005467 | Ga0070706_100253590 | Ga0070706_1002535902 | 130 |
| 122 | 3300005467 | Ga0070706_100686934 | Ga0070706_1006869341 | 130 |
| 123 | 3300005471 | Ga0070698_100041601 | Ga0070698_1000416014 | 130 |
| 124 | 3300005518 | Ga0070699_100000291 | Ga0070699_10000029130 | 130 |
| 125 | 3300005518 | Ga0070699_100069114 | Ga0070699_1000691144 | 130 |
| 126 | 3300005518 | Ga0070699_101261717 | Ga0070699_1012617172 | 130 |
| 127 | 3300005530 | Ga0070679_100061330 | Ga0070679_1000613301 | 130 |
| 128 | 3300005535 | Ga0070684_100454525 | Ga0070684_1004545251 | 130 |
| 129 | 3300005536 | Ga0070697_100004085 | Ga0070697_1000040853 | 130 |
| 130 | 3300005536 | Ga0070697_100049641 | Ga0070697_1000496413 | 130 |
| 131 | 3300005543 | Ga0070672_100169632 | Ga0070672_1001696322 | 130 |
| 132 | 3300005543 | Ga0070672_100511948 | Ga0070672_1005119482 | 130 |
| 133 | 3300005544 | Ga0070686_100078006 | Ga0070686_1000780062 | 130 |
| 134 | 3300005545 | Ga0070695_100117342 | Ga0070695_1001173422 | 130 |
| 135 | 3300005547 | Ga0070693_100716578 | Ga0070693_1007165781 | 130 |
| 136 | 3300005548 | Ga0070665_100000280 | Ga0070665_10000028058 | 130 |
| 137 | 3300005549 | Ga0070704_100030445 | Ga0070704_1000304453 | 130 |
| 138 | 3300005549 | Ga0070704_100141791 | Ga0070704_1001417912 | 130 |
| 139 | 3300005549 | Ga0070704_100158377 | Ga0070704_1001583773 | 130 |
| 140 | 3300005549 | Ga0070704_100380185 | Ga0070704_1003801852 | 130 |
| 141 | 3300005549 | Ga0070704_100832523 | Ga0070704_1008325232 | 130 |
| 142 | 3300005563 | Ga0068855_100605004 | Ga0068855_1006050042 | 130 |
| 143 | 3300005577 | Ga0068857_100313554 | Ga0068857_1003135542 | 130 |
| 144 | 3300005577 | Ga0068857_100331733 | Ga0068857_1003317332 | 130 |
| 145 | 3300005578 | Ga0068854_100250909 | Ga0068854_1002509094 | 130 |
| 146 | 3300005615 | Ga0070702_101497065 | Ga0070702_1014970651 | 130 |
| 147 | 3300005617 | Ga0068859_100002086 | Ga0068859_10000208619 | 130 |
| 148 | 3300005617 | Ga0068859_100002935 | Ga0068859_10000293510 | 130 |
| 149 | 3300005617 | Ga0068859_100640559 | Ga0068859_1006405592 | 130 |
| 150 | 3300005618 | Ga0068864_100192204 | Ga0068864_1001922045 | 130 |
| 151 | 3300005718 | Ga0068866_10279762 | Ga0068866_102797622 | 130 |
| 152 | 3300005719 | Ga0068861_100020307 | Ga0068861_1000203072 | 130 |
| 153 | 3300005719 | Ga0068861_100389986 | Ga0068861_1003899862 | 130 |
| 154 | 3300005719 | Ga0068861_100426016 | Ga0068861_1004260162 | 130 |
| 155 | 3300005841 | Ga0068863_100581767 | Ga0068863_1005817673 | 130 |
| 156 | 3300005841 | Ga0068863_100938365 | Ga0068863_1009383652 | 130 |
| 157 | 3300005842 | Ga0068858_100260529 | Ga0068858_1002605293 | 130 |
| 158 | 3300005843 | Ga0068860_100729509 | Ga0068860_1007295092 | 130 |
| 159 | 3300005843 | Ga0068860_100872934 | Ga0068860_1008729341 | 130 |
| 160 | 3300005843 | Ga0068860_102532044 | Ga0068860_1025320442 | 130 |
| 161 | 3300005844 | Ga0068862_100001494 | Ga0068862_10000149417 | 130 |
| 162 | 3300005844 | Ga0068862_100175623 | Ga0068862_1001756232 | 130 |
| 163 | 3300005937 | Ga0081455_10102296 | Ga0081455_101022961 | 130 |
| 164 | 3300005937 | Ga0081455_10145173 | Ga0081455_101451732 | 130 |
| 165 | 3300005985 | Ga0081539_10000558 | Ga0081539_1000055869 | 130 |
| 166 | 3300006028 | Ga0070717_10172670 | Ga0070717_101726703 | 130 |
| 167 | 3300006028 | Ga0070717_10371355 | Ga0070717_103713552 | 130 |
| 168 | 3300006042 | Ga0075368_10020789 | Ga0075368_100207892 | 130 |
| 169 | 3300006042 | Ga0075368_10034245 | Ga0075368_100342452 | 130 |
| 170 | 3300006048 | Ga0075363_100150966 | Ga0075363_1001509663 | 130 |
| 171 | 3300006051 | Ga0075364_10450390 | Ga0075364_104503902 | 130 |
| 172 | 3300006163 | Ga0070715_10515768 | Ga0070715_105157682 | 130 |
| 173 | 3300006173 | Ga0070716_100012129 | Ga0070716_1000121295 | 130 |
| 174 | 3300006175 | Ga0070712_100765704 | Ga0070712_1007657042 | 130 |
| 175 | 3300006178 | Ga0075367_10240034 | Ga0075367_102400342 | 130 |
| 176 | 3300006194 | Ga0075427_10115501 | Ga0075427_101155011 | 130 |
| 177 | 3300006195 | Ga0075366_10051128 | Ga0075366_100511284 | 130 |
| 178 | 3300006353 | Ga0075370_10044896 | Ga0075370_100448963 | 130 |
| 179 | 3300006358 | Ga0068871_100390955 | Ga0068871_1003909552 | 130 |
| 180 | 3300006358 | Ga0068871_100541759 | Ga0068871_1005417592 | 130 |
| 181 | 3300006358 | Ga0068871_101112681 | Ga0068871_1011126811 | 130 |
| 182 | 3300006844 | Ga0075428_100006266 | Ga0075428_1000062667 | 130 |
| 183 | 3300006844 | Ga0075428_100018361 | Ga0075428_1000183616 | 130 |
| 184 | 3300006844 | Ga0075428_100413861 | Ga0075428_1004138612 | 130 |
| 185 | 3300006847 | Ga0075431_100027553 | Ga0075431_1000275538 | 130 |
| 186 | 3300006847 | Ga0075431_100330565 | Ga0075431_1003305652 | 130 |
| 187 | 3300006847 | Ga0075431_100575504 | Ga0075431_1005755041 | 130 |
| 188 | 3300006847 | Ga0075431_100699802 | Ga0075431_1006998022 | 130 |
| 189 | 3300006852 | Ga0075433_10024087 | Ga0075433_100240875 | 130 |
| 190 | 3300006852 | Ga0075433_10076205 | Ga0075433_100762054 | 130 |
| 191 | 3300006852 | Ga0075433_10366838 | Ga0075433_103668382 | 130 |
| 192 | 3300006852 | Ga0075433_10821858 | Ga0075433_108218582 | 130 |
| 193 | 3300006871 | Ga0075434_100057271 | Ga0075434_1000572715 | 130 |
| 194 | 3300006871 | Ga0075434_100134374 | Ga0075434_1001343743 | 130 |
| 195 | 3300006871 | Ga0075434_100287013 | Ga0075434_1002870132 | 130 |
| 196 | 3300006871 | Ga0075434_100530671 | Ga0075434_1005306712 | 130 |
| 197 | 3300006871 | Ga0075434_101569744 | Ga0075434_1015697442 | 130 |
| 198 | 3300006881 | Ga0068865_100323411 | Ga0068865_1003234112 | 130 |
| 199 | 3300006881 | Ga0068865_100732029 | Ga0068865_1007320291 | 130 |
| 200 | 3300006881 | Ga0068865_101121506 | Ga0068865_1011215061 | 130 |
| 201 | 3300006914 | Ga0075436_100019506 | Ga0075436_1000195066 | 130 |
| 202 | 3300006931 | Ga0097620_100002086 | Ga0097620_1000020862 | 130 |
| 203 | 3300006931 | Ga0097620_100002935 | Ga0097620_10000293510 | 130 |
| 204 | 3300006931 | Ga0097620_100640571 | Ga0097620_1006405712 | 130 |
| 205 | 3300007076 | Ga0075435_100032075 | Ga0075435_1000320753 | 130 |
| 206 | 3300007076 | Ga0075435_100066042 | Ga0075435_1000660424 | 130 |
| 207 | 3300007076 | Ga0075435_100421965 | Ga0075435_1004219652 | 130 |
| 208 | 3300009093 | Ga0105240_10102383 | Ga0105240_101023832 | 130 |
| 209 | 3300009094 | Ga0111539_10053096 | Ga0111539_100530965 | 130 |
| 210 | 3300009094 | Ga0111539_10166749 | Ga0111539_101667493 | 130 |
| 211 | 3300009094 | Ga0111539_10421578 | Ga0111539_104215782 | 130 |
| 212 | 3300009098 | Ga0105245_10043090 | Ga0105245_100430903 | 130 |
| 213 | 3300009147 | Ga0114129_10028282 | Ga0114129_100282827 | 130 |
| 214 | 3300009147 | Ga0114129_10037893 | Ga0114129_100378937 | 130 |
| 215 | 3300009147 | Ga0114129_10241081 | Ga0114129_102410812 | 130 |
| 216 | 3300009147 | Ga0114129_10378323 | Ga0114129_103783232 | 130 |
| 217 | 3300009147 | Ga0114129_10869930 | Ga0114129_108699302 | 130 |
| 218 | 3300009147 | Ga0114129_11684671 | Ga0114129_116846712 | 130 |
| 219 | 3300009147 | Ga0114129_11687242 | Ga0114129_116872421 | 130 |
| 220 | 3300009148 | Ga0105243_10379088 | Ga0105243_103790882 | 130 |
| 221 | 3300009148 | Ga0105243_11191632 | Ga0105243_111916322 | 130 |
| 222 | 3300009174 | Ga0105241_10096797 | Ga0105241_100967972 | 130 |
| 223 | 3300009176 | Ga0105242_10155632 | Ga0105242_101556321 | 130 |
| 224 | 3300009176 | Ga0105242_10520256 | Ga0105242_105202562 | 130 |
| 225 | 3300009176 | Ga0105242_10632897 | Ga0105242_106328972 | 130 |
| 226 | 3300009551 | Ga0105238_11227710 | Ga0105238_112277101 | 130 |
| 227 | 3300009553 | Ga0105249_10116457 | Ga0105249_101164573 | 130 |
| 228 | 3300009553 | Ga0105249_10512621 | Ga0105249_105126212 | 130 |
| 229 | 3300009553 | Ga0105249_10760271 | Ga0105249_107602712 | 130 |
| 230 | 3300009553 | Ga0105249_12235691 | Ga0105249_122356912 | 130 |
| 231 | 3300009553 | Ga0105249_13400426 | Ga0105249_134004261 | 130 |
| 232 | 3300013105 | Ga0157369_10279877 | Ga0157369_102798772 | 130 |
| 233 | 3300013297 | Ga0157378_10455153 | Ga0157378_104551532 | 130 |
| 234 | 3300013306 | Ga0163162_11315190 | Ga0163162_113151902 | 130 |
| 235 | 3300013306 | Ga0163162_11339418 | Ga0163162_113394181 | 130 |
| 236 | 3300013308 | Ga0157375_10037412 | Ga0157375_100374126 | 130 |
| 237 | 3300013308 | Ga0157375_10367711 | Ga0157375_103677113 | 130 |
| 238 | 3300013308 | Ga0157375_10497625 | Ga0157375_104976252 | 130 |
| 239 | 3300014325 | Ga0163163_10131955 | Ga0163163_101319553 | 130 |
| 240 | 3300014325 | Ga0163163_11131908 | Ga0163163_111319082 | 130 |
| 241 | 3300014325 | Ga0163163_12880754 | Ga0163163_128807541 | 130 |
| 242 | 3300014326 | Ga0157380_10963869 | Ga0157380_109638691 | 130 |
| 243 | 3300014326 | Ga0157380_12470345 | Ga0157380_124703452 | 130 |
| 244 | 3300014326 | Ga0157380_12751764 | Ga0157380_127517641 | 130 |
| 245 | 3300014745 | Ga0157377_10657843 | Ga0157377_106578431 | 130 |
| 246 | 3300017792 | Ga0163161_10259788 | Ga0163161_102597883 | 130 |
| 247 | 3300020070 | Ga0206356_10280488 | Ga0206356_102804882 | 130 |
| 248 | 3300022467 | Ga0224712_10078995 | Ga0224712_100789952 | 130 |
| 249 | 3300025315 | Ga0207697_10354283 | Ga0207697_103542832 | 130 |
| 250 | 3300025885 | Ga0207653_10138597 | Ga0207653_101385972 | 130 |
| 251 | 3300025898 | Ga0207692_10212724 | Ga0207692_102127242 | 130 |
| 252 | 3300025901 | Ga0207688_10022213 | Ga0207688_100222134 | 130 |
| 253 | 3300025903 | Ga0207680_10073099 | Ga0207680_100730993 | 130 |
| 254 | 3300025903 | Ga0207680_10310372 | Ga0207680_103103722 | 130 |
| 255 | 3300025903 | Ga0207680_10723624 | Ga0207680_107236242 | 130 |
| 256 | 3300025906 | Ga0207699_10000084 | Ga0207699_1000008443 | 130 |
| 257 | 3300025906 | Ga0207699_10228473 | Ga0207699_102284732 | 130 |
| 258 | 3300025906 | Ga0207699_10884597 | Ga0207699_108845972 | 130 |
| 259 | 3300025907 | Ga0207645_10013115 | Ga0207645_100131155 | 130 |
| 260 | 3300025907 | Ga0207645_10904726 | Ga0207645_109047262 | 130 |
| 261 | 3300025907 | Ga0207645_11066913 | Ga0207645_110669132 | 130 |
| 262 | 3300025909 | Ga0207705_10019852 | Ga0207705_100198523 | 130 |
| 263 | 3300025913 | Ga0207695_10117274 | Ga0207695_101172742 | 130 |
| 264 | 3300025917 | Ga0207660_10631401 | Ga0207660_106314012 | 130 |
| 265 | 3300025921 | Ga0207652_10397720 | Ga0207652_103977202 | 130 |
| 266 | 3300025922 | Ga0207646_10521441 | Ga0207646_105214412 | 130 |
| 267 | 3300025923 | Ga0207681_10000056 | Ga0207681_1000005681 | 130 |
| 268 | 3300025923 | Ga0207681_10050655 | Ga0207681_100506554 | 130 |
| 269 | 3300025923 | Ga0207681_11224867 | Ga0207681_112248672 | 130 |
| 270 | 3300025924 | Ga0207694_10743660 | Ga0207694_107436601 | 130 |
| 271 | 3300025925 | Ga0207650_10152892 | Ga0207650_101528922 | 130 |
| 272 | 3300025925 | Ga0207650_10315765 | Ga0207650_103157652 | 130 |
| 273 | 3300025926 | Ga0207659_10276960 | Ga0207659_102769602 | 130 |
| 274 | 3300025926 | Ga0207659_11310176 | Ga0207659_113101761 | 130 |
| 275 | 3300025928 | Ga0207700_10140695 | Ga0207700_101406952 | 130 |
| 276 | 3300025928 | Ga0207700_11001870 | Ga0207700_110018701 | 130 |
| 277 | 3300025928 | Ga0207700_11031704 | Ga0207700_110317041 | 130 |
| 278 | 3300025933 | Ga0207706_10228635 | Ga0207706_102286352 | 130 |
| 279 | 3300025933 | Ga0207706_10855485 | Ga0207706_108554852 | 130 |
| 280 | 3300025935 | Ga0207709_10415395 | Ga0207709_104153952 | 130 |
| 281 | 3300025935 | Ga0207709_10851898 | Ga0207709_108518982 | 130 |
| 282 | 3300025936 | Ga0207670_10192965 | Ga0207670_101929652 | 130 |
| 283 | 3300025936 | Ga0207670_10639848 | Ga0207670_106398481 | 130 |
| 284 | 3300025937 | Ga0207669_10006694 | Ga0207669_100066942 | 130 |
| 285 | 3300025938 | Ga0207704_10316650 | Ga0207704_103166502 | 130 |
| 286 | 3300025938 | Ga0207704_10495668 | Ga0207704_104956681 | 130 |
| 287 | 3300025938 | Ga0207704_10654450 | Ga0207704_106544501 | 130 |
| 288 | 3300025938 | Ga0207704_11191794 | Ga0207704_111917941 | 130 |
| 289 | 3300025939 | Ga0207665_10014606 | Ga0207665_100146063 | 130 |
| 290 | 3300025940 | Ga0207691_10012366 | Ga0207691_100123665 | 130 |
| 291 | 3300025940 | Ga0207691_10801599 | Ga0207691_108015991 | 130 |
| 292 | 3300025941 | Ga0207711_11067443 | Ga0207711_110674431 | 130 |
| 293 | 3300025942 | Ga0207689_10057239 | Ga0207689_100572394 | 130 |
| 294 | 3300025942 | Ga0207689_10092815 | Ga0207689_100928153 | 130 |
| 295 | 3300025942 | Ga0207689_11002748 | Ga0207689_110027482 | 130 |
| 296 | 3300025949 | Ga0207667_11514451 | Ga0207667_115144511 | 130 |
| 297 | 3300025960 | Ga0207651_10099523 | Ga0207651_100995233 | 130 |
| 298 | 3300025960 | Ga0207651_10418676 | Ga0207651_104186762 | 130 |
| 299 | 3300025961 | Ga0207712_10250909 | Ga0207712_102509092 | 130 |
| 300 | 3300025961 | Ga0207712_10363984 | Ga0207712_103639842 | 130 |
| 301 | 3300025961 | Ga0207712_10565236 | Ga0207712_105652362 | 130 |
| 302 | 3300025961 | Ga0207712_12003210 | Ga0207712_120032101 | 130 |
| 303 | 3300025986 | Ga0207658_10903684 | Ga0207658_109036841 | 130 |
| 304 | 3300026023 | Ga0207677_11652512 | Ga0207677_116525122 | 130 |
| 305 | 3300026035 | Ga0207703_10494871 | Ga0207703_104948712 | 130 |
| 306 | 3300026067 | Ga0207678_10088138 | Ga0207678_100881387 | 130 |
| 307 | 3300026067 | Ga0207678_10304998 | Ga0207678_103049982 | 130 |
| 308 | 3300026075 | Ga0207708_10007629 | Ga0207708_100076297 | 130 |
| 309 | 3300026075 | Ga0207708_10103163 | Ga0207708_101031632 | 130 |
| 310 | 3300026075 | Ga0207708_10445239 | Ga0207708_104452392 | 130 |
| 311 | 3300026075 | Ga0207708_11096905 | Ga0207708_110969052 | 130 |
| 312 | 3300026078 | Ga0207702_11741863 | Ga0207702_117418631 | 130 |
| 313 | 3300026088 | Ga0207641_10757831 | Ga0207641_107578312 | 130 |
| 314 | 3300026089 | Ga0207648_10170150 | Ga0207648_101701502 | 130 |
| 315 | 3300026095 | Ga0207676_10105833 | Ga0207676_101058332 | 130 |
| 316 | 3300026095 | Ga0207676_10641639 | Ga0207676_106416392 | 130 |
| 317 | 3300026116 | Ga0207674_10488762 | Ga0207674_104887622 | 130 |
| 318 | 3300026116 | Ga0207674_10883406 | Ga0207674_108834062 | 130 |
| 319 | 3300026118 | Ga0207675_100043836 | Ga0207675_1000438362 | 130 |
| 320 | 3300026118 | Ga0207675_100063773 | Ga0207675_1000637734 | 130 |
| 321 | 3300026118 | Ga0207675_100982722 | Ga0207675_1009827221 | 130 |
| 322 | 3300026121 | Ga0207683_11711497 | Ga0207683_117114971 | 130 |
| 323 | 3300026121 | Ga0207683_11822542 | Ga0207683_118225422 | 130 |
| 324 | 3300026142 | Ga0207698_12543170 | Ga0207698_125431701 | 130 |
| 325 | 3300027866 | Ga0209813_10028285 | Ga0209813_100282853 | 130 |
| 326 | 3300027866 | Ga0209813_10115076 | Ga0209813_101150762 | 130 |
| 327 | 3300027866 | Ga0209813_10184074 | Ga0209813_101840742 | 130 |
| 328 | 3300027907 | Ga0207428_10168769 | Ga0207428_101687692 | 130 |
| 329 | 3300027907 | Ga0207428_10294840 | Ga0207428_102948402 | 130 |
| 330 | 3300028379 | Ga0268266_10001178 | Ga0268266_1000117829 | 130 |
| 331 | 3300028380 | Ga0268265_10000230 | Ga0268265_1000023051 | 130 |
| 332 | 3300028380 | Ga0268265_10284570 | Ga0268265_102845703 | 130 |
| 333 | 3300028380 | Ga0268265_10587260 | Ga0268265_105872602 | 130 |
| 334 | 3300028381 | Ga0268264_10102310 | Ga0268264_101023101 | 130 |
| 335 | 3300028381 | Ga0268264_10255483 | Ga0268264_102554832 | 130 |
| 336 | 3300028381 | Ga0268264_11144258 | Ga0268264_111442582 | 130 |
| 337 | 3300028381 | Ga0268264_11193180 | Ga0268264_111931802 | 130 |
| 338 | 3300028381 | Ga0268264_11535887 | Ga0268264_115358872 | 130 |
| 339 | 3300028381 | Ga0268264_12041901 | Ga0268264_120419011 | 130 |
| 340 | 3300030521 | Ga0307511_10021467 | Ga0307511_100214673 | 130 |
| 341 | 3300031665 | Ga0316575_10013931 | Ga0316575_100139313 | 130 |
| 342 | 3300031727 | Ga0316576_10061175 | Ga0316576_100611752 | 130 |
| 343 | 3300031727 | Ga0316576_10091432 | Ga0316576_100914323 | 130 |
| 344 | 3300031727 | Ga0316576_10094456 | Ga0316576_100944562 | 130 |
| 345 | 3300031727 | Ga0316576_10104774 | Ga0316576_101047743 | 130 |
| 346 | 3300031727 | Ga0316576_10213457 | Ga0316576_102134572 | 130 |
| 347 | 3300031728 | Ga0316578_10017974 | Ga0316578_100179743 | 130 |
| 348 | 3300031728 | Ga0316578_10026254 | Ga0316578_100262542 | 130 |
| 349 | 3300031733 | Ga0316577_10059560 | Ga0316577_100595603 | 130 |
| 350 | 3300031733 | Ga0316577_10243189 | Ga0316577_102431892 | 130 |
| 351 | 3300031733 | Ga0316577_10311415 | Ga0316577_103114152 | 130 |
| 352 | 3300032002 | Ga0307416_102041733 | Ga0307416_1020417332 | 130 |
| 353 | 3300032133 | Ga0316583_10003154 | Ga0316583_100031547 | 130 |
| 354 | 3300032133 | Ga0316583_10004720 | Ga0316583_100047203 | 130 |
| 355 | 3300032133 | Ga0316583_10029653 | Ga0316583_100296533 | 130 |
| 356 | 3300032133 | Ga0316583_10131006 | Ga0316583_101310061 | 130 |
| 357 | 3300032137 | Ga0316585_10001279 | Ga0316585_100012794 | 130 |
| 358 | 3300032139 | Ga0316580_10141064 | Ga0316580_101410641 | 130 |
| 359 | 3300032168 | Ga0316593_10032088 | Ga0316593_100320882 | 130 |
| 360 | 3300032168 | Ga0316593_10056123 | Ga0316593_100561232 | 130 |
| 361 | 3300032168 | Ga0316593_10149565 | Ga0316593_101495652 | 130 |
| 362 | 3300035085 | Ga0373929_0000001 | Ga0373929_0000001_389840_390235 | 130 |
| 363 | 3300035111 | Ga0373923_0451656 | Ga0373923_0451656_158_556 | 130 |
| 364 | 3300035115 | Ga0373941_0287476 | Ga0373941_0287476_37_429 | 130 |
| 365 | 3300035119 | Ga0373956_0119716 | Ga0373956_0119716_17_421 | 130 |
| 366 | 3300035170 | Ga0373943_0262970 | Ga0373943_0262970_368_772 | 130 |
| 367 | 3300035172 | Ga0373955_0711254 | Ga0373955_0711254_55_459 | 130 |
| 368 | 3300035398 | Ga0316574_0020417 | Ga0316574_0020417_3359_3751 | 130 |
| 369 | 3300035398 | Ga0316574_0081022 | Ga0316574_0081022_419_811 | 130 |
| 370 | 3300035398 | Ga0316574_0483000 | Ga0316574_0483000_317_709 | 130 |
| 371 | 3300035398 | Ga0316574_0537124 | Ga0316574_0537124_268_660 | 130 |
| 372 | 3300035692 | Ga0373935_0277291 | Ga0373935_0277291_669_1067 | 130 |
| 373 | 3300035724 | Ga0373933_0768769 | Ga0373933_0768769_135_530 | 130 |
| 374 | 3300036401 | Ga0373937_0006813 | Ga0373937_0006813_3816_4220 | 130 |
| 375 | 3300036647 | Ga0316582_0038604 | Ga0316582_0038604_594_986 | 130 |
| 376 | 3300036647 | Ga0316582_0092199 | Ga0316582_0092199_1387_1779 | 130 |
| 377 | 3300036647 | Ga0316582_0257144 | Ga0316582_0257144_753_1163 | 130 |
| 378 | 3300036712 | Ga0316584_0093223 | Ga0316584_0093223_1226_1639 | 130 |
| 379 | 3300036712 | Ga0316584_0165820 | Ga0316584_0165820_1005_1397 | 130 |
| 380 | 3300039062 | Ga0400483_015074 | Ga0400483_015074_646_1038 | 130 |
| 381 | 3300041443 | Ga0451789_0711377 | Ga0451789_0711377_454_846 | 130 |
| 382 | 3300041453 | Ga0451797_1350670 | Ga0451797_1350670_388_780 | 130 |
| 383 | 3300041456 | Ga0451795_0324929 | Ga0451795_0324929_181_573 | 130 |
| 384 | 3300041460 | Ga0451802_0479589 | Ga0451802_0479589_308_700 | 130 |
| 385 | 3300041460 | Ga0451802_1679855 | Ga0451802_1679855_188_580 | 130 |
| 386 | 3300041486 | Ga0451807_0377212 | Ga0451807_0377212_1427_1822 | 130 |
| 387 | 3300041486 | Ga0451807_2063280 | Ga0451807_2063280_476_868 | 130 |
| 388 | 3300041498 | Ga0451841_0760955 | Ga0451841_0760955_59_451 | 130 |
| 389 | 3300041997 | Ga0439431_0050350 | Ga0439431_0050350_590_982 | 130 |
| 390 | 3300041999 | Ga0439433_0065882 | Ga0439433_0065882_208_600 | 130 |
| 391 | 3300042002 | Ga0439442_037960 | Ga0439442_037960_531_923 | 130 |
| 392 | 3300042004 | Ga0439445_0165698 | Ga0439445_0165698_147_539 | 130 |
| 393 | 3300042007 | Ga0439449_0093936 | Ga0439449_0093936_521_913 | 130 |
| 394 | 3300042876 | Ga0451577_0056839 | Ga0451577_0056839_3027_3422 | 130 |
| 395 | 3300042876 | Ga0451577_0082175 | Ga0451577_0082175_1169_1567 | 130 |
| 396 | 3300044673 | Ga0453683_0113285 | Ga0453683_0113285_728_1120 | 130 |
| 397 | 3300044673 | Ga0453683_0833824 | Ga0453683_0833824_36_428 | 130 |
| 398 | 3300044712 | Ga0453684_0101505 | Ga0453684_0101505_1462_1857 | 130 |
| 399 | 3300044712 | Ga0453684_0549334 | Ga0453684_0549334_591_989 | 130 |
| 400 | 3300044712 | Ga0453684_1622476 | Ga0453684_1622476_156_548 | 130 |
| 401 | 3300044901 | Ga0466960_0025774 | Ga0466960_0025774_1652_2056 | 130 |
| 402 | 3300045051 | Ga0451576_0041983 | Ga0451576_0041983_1742_2134 | 130 |
| 403 | 3300045051 | Ga0451576_1159845 | Ga0451576_1159845_80_478 | 130 |
| 404 | 3300045976 | Ga0466967_2217173 | Ga0466967_2217173_23_415 | 130 |
| 405 | 3300046459 | Ga0495629_0001085 | Ga0495629_0001085_20678_21076 | 130 |
| 406 | 3300046459 | Ga0495629_0018969 | Ga0495629_0018969_3952_4350 | 130 |
| 407 | 3300046460 | Ga0495638_0006310 | Ga0495638_0006310_7243_7638 | 130 |
| 408 | 3300046460 | Ga0495638_0255107 | Ga0495638_0255107_404_796 | 130 |
| 409 | 3300046473 | Ga0495582_0007932 | Ga0495582_0007932_289_687 | 130 |
| 410 | 3300046475 | Ga0495639_0002890 | Ga0495639_0002890_2118_2516 | 130 |
| 411 | 3300046475 | Ga0495639_0016731 | Ga0495639_0016731_398_796 | 130 |
| 412 | 3300046476 | Ga0495662_0038269 | Ga0495662_0038269_675_1073 | 130 |
| 413 | 3300046499 | Ga0495594_0004579 | Ga0495594_0004579_3586_3984 | 130 |
| 414 | 3300046499 | Ga0495594_0540581 | Ga0495594_0540581_75_473 | 130 |
| 415 | 3300046500 | Ga0495596_0176640 | Ga0495596_0176640_259_651 | 130 |
| 416 | 3300046517 | Ga0495630_1296817 | Ga0495630_1296817_83_481 | 130 |
| 417 | 3300046523 | Ga0495644_0386885 | Ga0495644_0386885_106_498 | 130 |
| 418 | 3300046525 | Ga0495663_0142217 | Ga0495663_0142217_312_704 | 130 |
| 419 | 3300046533 | Ga0495640_0663727 | Ga0495640_0663727_182_580 | 130 |
| 420 | 3300046536 | Ga0495587_0127747 | Ga0495587_0127747_727_1122 | 130 |
| 421 | 3300046537 | Ga0495598_0059278 | Ga0495598_0059278_147_539 | 130 |
| 422 | 3300046539 | Ga0495621_0067321 | Ga0495621_0067321_500_892 | 130 |
| 423 | 3300046557 | Ga0495622_0221978 | Ga0495622_0221978_347_745 | 130 |
| 424 | 3300046558 | Ga0495633_0114400 | Ga0495633_0114400_40_432 | 130 |
| 425 | 3300046615 | Ga0495656_0217655 | Ga0495656_0217655_106_498 | 130 |
| 426 | 3300046616 | Ga0495668_0296147 | Ga0495668_0296147_336_728 | 130 |
| 427 | 3300046642 | Ga0495634_0860124 | Ga0495634_0860124_14_412 | 130 |
| 428 | 3300046663 | Ga0495635_0001421 | Ga0495635_0001421_13080_13478 | 130 |
| 429 | 3300046683 | Ga0495658_0000401 | Ga0495658_0000401_20077_20475 | 130 |
| 430 | 3300046684 | Ga0495669_0678074 | Ga0495669_0678074_55_447 | 130 |
| 431 | 3300046809 | Ga0495600_0901904 | Ga0495600_0901904_27_431 | 130 |
| 432 | 3300047315 | Ga0495581_0000586 | Ga0495581_0000586_14809_15207 | 130 |
| 433 | 3300047315 | Ga0495581_0053939 | Ga0495581_0053939_402_800 | 130 |
| 434 | 3300047318 | Ga0495636_0421282 | Ga0495636_0421282_151_573 | 130 |
| 435 | 3300047320 | Ga0495672_0205463 | Ga0495672_0205463_94_486 | 130 |
| 436 | 3300047321 | Ga0495676_0130421 | Ga0495676_0130421_669_1067 | 130 |
| 437 | 3300047322 | Ga0495680_0003220 | Ga0495680_0003220_2858_3256 | 130 |
| 438 | 3300048088 | Ga0495602_0325974 | Ga0495602_0325974_471_866 | 130 |
| 439 | 3300048089 | Ga0495614_0095409 | Ga0495614_0095409_749_1147 | 130 |
| 440 | 3300048906 | Ga0496103_0235257 | Ga0496103_0235257_276_668 | 130 |
| 441 | 3300048907 | Ga0496104_1056706 | Ga0496104_1056706_87_482 | 130 |
| 442 | 3300048912 | Ga0496109_0749565 | Ga0496109_0749565_202_594 | 130 |
| 443 | 3300049127 | Ga0501306_013195 | Ga0501306_013195_456_848 | 130 |
| 444 | 3300049527 | Ga0501311_041273 | Ga0501311_041273_252_644 | 130 |
| 445 | 3300049532 | Ga0501316_044664 | Ga0501316_044664_32_424 | 130 |
| 446 | 3300049540 | Ga0501324_019133 | Ga0501324_019133_206_598 | 130 |
| 447 | 3300049569 | Ga0501032_0390246 | Ga0501032_0390246_413_805 | 130 |
| 448 | 3300049573 | Ga0501037_0370105 | Ga0501037_0370105_126_524 | 130 |
| 449 | 3300049574 | Ga0501038_0005479 | Ga0501038_0005479_8398_8796 | 130 |
| 450 | 3300049575 | Ga0501039_0434341 | Ga0501039_0434341_424_822 | 130 |
| 451 | 3300049575 | Ga0501039_0879123 | Ga0501039_0879123_105_497 | 130 |
| 452 | 3300049576 | Ga0501040_0722678 | Ga0501040_0722678_57_449 | 130 |
| 453 | 3300049578 | Ga0501042_0228606 | Ga0501042_0228606_372_764 | 130 |
| 454 | 3300049579 | Ga0501043_0014065 | Ga0501043_0014065_1200_1598 | 130 |
| 455 | 3300049581 | Ga0501047_0002850 | Ga0501047_0002850_7957_8355 | 130 |
| 456 | 3300049581 | Ga0501047_1249521 | Ga0501047_1249521_74_478 | 130 |
| 457 | 3300049582 | Ga0501048_0255283 | Ga0501048_0255283_240_632 | 130 |
| 458 | 3300049583 | Ga0501067_0002959 | Ga0501067_0002959_7821_8219 | 130 |
| 459 | 3300049584 | Ga0501068_0000298 | Ga0501068_0000298_19430_19828 | 130 |
| 460 | 3300049585 | Ga0501069_0011603 | Ga0501069_0011603_265_663 | 130 |
| 461 | 3300049586 | Ga0501070_0115439 | Ga0501070_0115439_520_918 | 130 |
| 462 | 3300049587 | Ga0501071_0495094 | Ga0501071_0495094_271_663 | 130 |
| 463 | 3300049588 | Ga0501072_0000013 | Ga0501072_0000013_33025_33423 | 130 |
| 464 | 3300049589 | Ga0501073_0001560 | Ga0501073_0001560_2259_2657 | 130 |
| 465 | 3300049589 | Ga0501073_0264198 | Ga0501073_0264198_717_1121 | 130 |
| 466 | 3300049589 | Ga0501073_0315907 | Ga0501073_0315907_653_1045 | 130 |
| 467 | 3300049590 | Ga0501074_0001093 | Ga0501074_0001093_8528_8926 | 130 |
| 468 | 3300049592 | Ga0501076_0005208 | Ga0501076_0005208_583_981 | 130 |
| 469 | 3300049592 | Ga0501076_1148669 | Ga0501076_1148669_180_572 | 130 |
| 470 | 3300049593 | Ga0501077_0042009 | Ga0501077_0042009_1150_1548 | 130 |
| 471 | 3300049667 | Ga0501230_168431 | Ga0501230_168431_55_447 | 130 |
| 472 | 3300049741 | Ga0501079_0000583 | Ga0501079_0000583_11866_12264 | 130 |
| 473 | 3300049741 | Ga0501079_0426994 | Ga0501079_0426994_534_926 | 130 |
| 474 | 3300049742 | Ga0501080_0084855 | Ga0501080_0084855_2007_2405 | 130 |
| 475 | 3300049742 | Ga0501080_0439657 | Ga0501080_0439657_290_688 | 130 |
| 476 | 3300049742 | Ga0501080_1713744 | Ga0501080_1713744_94_486 | 130 |
| 477 | 3300049743 | Ga0501081_0932991 | Ga0501081_0932991_80_472 | 130 |
| 478 | 3300049744 | Ga0501083_0002132 | Ga0501083_0002132_9032_9424 | 130 |
| 479 | 3300049744 | Ga0501083_0004309 | Ga0501083_0004309_8275_8673 | 130 |
| 480 | 3300049744 | Ga0501083_0006433 | Ga0501083_0006433_4244_4648 | 130 |
| 481 | 3300049760 | Ga0501263_021577 | Ga0501263_021577_17_421 | 130 |
| 482 | 3300049823 | Ga0501044_0061437 | Ga0501044_0061437_1252_1650 | 130 |
| 483 | 3300049824 | Ga0501045_0180083 | Ga0501045_0180083_106_498 | 130 |
| 484 | 3300050491 | nmdc:mga00v17_289450_c1 | nmdc:mga00v17_289450_c1_157_549 | 130 |
| 485 | 3300050493 | nmdc:mga0k408_16714_c2 | nmdc:mga0k408_16714_c2_1701_2093 | 130 |
| 486 | 3300050494 | nmdc:mga06z11_15279_c1 | nmdc:mga06z11_15279_c1_2534_2926 | 130 |
| 487 | 3300050495 | nmdc:mga04h51_248068_c1 | nmdc:mga04h51_248068_c1_173_565 | 130 |
| 488 | 3300050495 | nmdc:mga04h51_39600_c1 | nmdc:mga04h51_39600_c1_695_1087 | 130 |
| 489 | 3300050496 | nmdc:mga07m45_151571_c1 | nmdc:mga07m45_151571_c1_493_891 | 130 |
| 490 | 3300050507 | nmdc:mga05p37_116790_c1 | nmdc:mga05p37_116790_c1_2399_2791 | 130 |
| 491 | 3300050507 | nmdc:mga05p37_1221939_c1 | nmdc:mga05p37_1221939_c1_344_739 | 130 |
| 492 | 3300050507 | nmdc:mga05p37_1629851_c1 | nmdc:mga05p37_1629851_c1_113_508 | 130 |
| 493 | 3300050507 | nmdc:mga05p37_367163_c1 | nmdc:mga05p37_367163_c1_100_492 | 130 |
| 494 | 3300050507 | nmdc:mga05p37_45244_c1 | nmdc:mga05p37_45244_c1_3470_3862 | 130 |
| 495 | 3300050507 | nmdc:mga05p37_7671_c1 | nmdc:mga05p37_7671_c1_7109_7501 | 130 |
| 496 | 3300050507 | nmdc:mga05p37_89941_c1 | nmdc:mga05p37_89941_c1_1299_1694 | 130 |
| 497 | 3300050510 | nmdc:mga06r32_361101_c1 | nmdc:mga06r32_361101_c1_585_980 | 130 |
| 498 | 3300050510 | nmdc:mga06r32_49737_c2 | nmdc:mga06r32_49737_c2_626_1018 | 130 |
| 499 | 3300050510 | nmdc:mga06r32_532091_c1 | nmdc:mga06r32_532091_c1_13_405 | 130 |
| 500 | 3300050510 | nmdc:mga06r32_648054_c1 | nmdc:mga06r32_648054_c1_457_855 | 130 |
| 501 | 3300050511 | nmdc:mga08y16_154847_c1 | nmdc:mga08y16_154847_c1_1708_2112 | 130 |
| 502 | 3300050511 | nmdc:mga08y16_1757066_c1 | nmdc:mga08y16_1757066_c1_147_545 | 130 |
| 503 | 3300050511 | nmdc:mga08y16_483482_c1 | nmdc:mga08y16_483482_c1_323_721 | 130 |
| 504 | 3300050512 | nmdc:mga0n895_105622_c1 | nmdc:mga0n895_105622_c1_2086_2478 | 130 |
| 505 | 3300050512 | nmdc:mga0n895_246885_c1 | nmdc:mga0n895_246885_c1_902_1294 | 130 |
| 506 | 3300050512 | nmdc:mga0n895_442043_c1 | nmdc:mga0n895_442043_c1_749_1141 | 130 |
| 507 | 3300050512 | nmdc:mga0n895_83882_c1 | nmdc:mga0n895_83882_c1_2611_3003 | 130 |
| 508 | 3300050513 | nmdc:mga0rr50_223925_c1 | nmdc:mga0rr50_223925_c1_797_1189 | 130 |
| 509 | 3300050513 | nmdc:mga0rr50_253929_c1 | nmdc:mga0rr50_253929_c1_605_1000 | 130 |
| 510 | 3300050513 | nmdc:mga0rr50_43944_c1 | nmdc:mga0rr50_43944_c1_1076_1468 | 130 |
| 511 | 3300050513 | nmdc:mga0rr50_67190_c1 | nmdc:mga0rr50_67190_c1_103_495 | 130 |
| 512 | 3300050513 | nmdc:mga0rr50_697722_c1 | nmdc:mga0rr50_697722_c1_370_768 | 130 |
| 513 | 3300050514 | nmdc:mga08x19_449669_c1 | nmdc:mga08x19_449669_c1_130_522 | 130 |
| 514 | 3300050515 | nmdc:mga0a205_174267_c1 | nmdc:mga0a205_174267_c1_836_1228 | 130 |
| 515 | 3300050515 | nmdc:mga0a205_194006_c1 | nmdc:mga0a205_194006_c1_683_1078 | 130 |
| 516 | 3300050515 | nmdc:mga0a205_556941_c1 | nmdc:mga0a205_556941_c1_352_747 | 130 |
| 517 | 3300050515 | nmdc:mga0a205_601841_c1 | nmdc:mga0a205_601841_c1_384_779 | 130 |
| 518 | 3300053085 | Ga0495619_0006248 | Ga0495619_0006248_995_1393 | 130 |
| 519 | 3300053085 | Ga0495619_0710808 | Ga0495619_0710808_116_511 | 130 |
| 520 | 3300053085 | Ga0495619_0753490 | Ga0495619_0753490_100_498 | 130 |
| 521 | 3300053116 | Ga0500592_028656 | Ga0500592_028656_338_733 | 130 |
| 522 | 3300053139 | Ga0500568_0004595 | Ga0500568_0004595_4628_5020 | 130 |
| 523 | 3300054114 | Ga0501084_0000136 | Ga0501084_0000136_32984_33382 | 130 |
| 524 | 3300054114 | Ga0501084_0035628 | Ga0501084_0035628_2219_2623 | 130 |
| 525 | 3300054114 | Ga0501084_1445030 | Ga0501084_1445030_18_410 | 130 |
| 526 | 3300059490 | Ga0587066_160779 | Ga0587066_160779_37_432 | 130 |
| 527 | 3300060346 | Ga0587111_0023103 | Ga0587111_0023103_640_1035 | 130 |
| 528 | 3300060353 | Ga0501082_0000651 | Ga0501082_0000651_28931_29329 | 130 |
| 529 | 3300060353 | Ga0501082_0053520 | Ga0501082_0053520_1993_2397 | 130 |
| 530 | 3300061734 | Ga0530510_0011015 | Ga0530510_0011015_1891_2289 | 130 |
| 531 | 3300061734 | Ga0530510_0108011 | Ga0530510_0108011_1514_1906 | 130 |
| 532 | 3300061734 | Ga0530510_0234601 | Ga0530510_0234601_837_1229 | 130 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v48-assembly1.cif.gz_BI | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.9741 | 6 | 102 |
| 4v48-assembly1.cif.gz_BI | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.9454 | 6 | 102 |
| 6osi-assembly1.cif.gz_QI | unmodified trna(pro) bound to thermus thermophilus 70s (near cognate) | 0.9342 | 4 | 108 |
| 6osi-assembly1.cif.gz_QI | unmodified trna(pro) bound to thermus thermophilus 70s (near cognate) | 0.9257 | 4 | 108 |
| 8d8l-assembly1.cif.gz_I | yeast mitochondrial small subunit assembly intermediate (state 3) | 0.9192 | 5 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7XAM9_269_415_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.8025 | 5 | 130 | 3.30.230.10 |
| af_O94150_208_336_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.7995 | 5 | 130 | 3.30.230.10 |
| af_Q54CK4_214_339_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.7985 | 6 | 130 | 3.30.230.10 |
| af_Q8IHZ4_170_300_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.7955 | 5 | 130 | 3.30.230.10 |
| af_O14006_146_271_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.7955 | 7 | 130 | 3.30.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P0EFT4-F1-model_v4 | deleted | 0.9962 | 1 | 104 |
|
| AF-A0A2E8BEA7-F1-model_v4 | 30S ribosomal protein S9 | 0.9953 | 7 | 105 |
GO:0003723
GO:0003735 GO:0005737 GO:0006412 GO:0015935 |
| AF-A0A7C8MVV8-F1-model_v4 | Small ribosomal subunit protein uS9m (37S ribosomal protein S9, mitochondrial) | 0.9949 | 5 | 100 |
GO:0003723
GO:0003735 GO:0005763 GO:0006412 |
| AF-A0A6P0EFT4-F1-model_v4 | deleted | 0.9867 | 1 | 104 |
|
| AF-A0A2H5NLP5-F1-model_v4 | deleted | 0.9819 | 5 | 106 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar