F460340

General Info

Members Datasets Scaffolds Average Seq Length
532 464 203 250

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_004183|Ga0500618_004183_3158_3964
Length 268
Sequence MALREVDEGRSMMLGEAGTSRILVARPRAIITTILVLSVFAILVGLGTWQMERLHWKEGLLADIAARRAAAPVALSEIERDAERPGGDIEYRRVSLSGTFDHKGERHFFATFEGRTGFYVYTPLTLADGRVLFVNRGFVPYEMKEPATRRAGEVEGLQTLTGYAREKLAAKPSSLVPDNDLSKNIFFWKDLAAMTASDGLDPTNVLPFFVDADETVKMAGGWPRGGVTQFDLPNNHLQYALTWYGLAGALVAVVIASVVRRRRVGTEQ

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
4 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
5 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
6 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
7 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
8 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
9 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
10 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
11 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
12 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
13 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
14 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
15 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
16 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
17 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
18 2516143018 Ensifer sp. BR816 Isolate Nodule
19 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
20 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
21 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
22 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
23 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
24 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
25 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
26 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
27 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
28 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
29 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
30 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
31 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
32 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
33 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
34 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
35 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
36 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
37 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
38 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
39 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
40 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
41 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
42 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
43 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
44 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
45 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
46 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
47 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
48 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
49 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
50 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
51 2643221557 Ensifer sp. Root558 Isolate Unclassified
52 2643221607 Rhizobium sp. Root73 Isolate Unclassified
53 2643221610 Ensifer sp. Root74 Isolate Unclassified
54 2643221618 Ensifer sp. Root231 Isolate Unclassified
55 2643221626 Ensifer sp. Root31 Isolate Unclassified
56 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
57 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
58 2643221655 Ensifer sp. Root1252 Isolate Unclassified
59 2643221659 Ensifer sp. Root127 Isolate Unclassified
60 2643221668 Ensifer sp. Root423 Isolate Unclassified
61 2643221675 Ensifer sp. Root1298 Isolate Unclassified
62 2643221680 Ensifer sp. Root1312 Isolate Unclassified
63 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
64 2643221688 Rhizobium sp. Root482 Isolate Unclassified
65 2643221693 Rhizobium sp. Root491 Isolate Unclassified
66 2643221698 Ensifer sp. Root142 Isolate Unclassified
67 2643221712 Ensifer sp. Root258 Isolate Unclassified
68 2643221718 Rhizobium sp. Root268 Isolate Unclassified
69 2643221723 Ensifer sp. Root278 Isolate Unclassified
70 2643221726 Ensifer sp. Root954 Isolate Unclassified
71 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
72 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
73 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
74 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
75 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
76 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
77 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
78 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
79 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
80 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
81 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
82 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
83 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
84 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
85 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
86 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
87 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
88 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
89 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
90 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
91 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
92 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
93 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
94 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
95 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
96 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
97 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
98 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
99 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
100 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
101 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
102 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
103 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
104 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
105 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
106 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
107 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
108 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
109 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
110 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
111 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
112 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
113 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
114 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
115 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
116 2844163670 Ensifer sp. 1H6 Isolate Unclassified
117 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
118 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
119 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
120 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
121 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
122 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
123 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
124 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
125 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
126 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
127 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
128 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
129 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
130 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
131 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
132 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
133 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
134 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
135 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
136 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
137 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
138 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
139 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
140 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
141 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
142 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
143 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
144 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
145 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
146 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
147 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
148 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
149 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
150 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
151 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
152 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
153 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
154 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
155 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
156 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
157 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
158 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
159 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
160 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
161 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
162 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
163 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
164 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
165 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
166 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
167 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
168 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
169 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
170 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
171 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
172 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
173 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
174 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
175 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
176 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
177 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
178 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
179 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
180 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
181 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
182 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
183 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
184 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
185 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
186 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
187 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
188 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
189 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
190 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
191 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
192 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
193 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
194 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
195 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
196 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
197 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
198 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
199 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
200 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
201 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
202 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
203 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
204 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
205 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
206 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
207 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
208 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
209 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
210 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
211 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
212 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
213 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
214 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
215 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
216 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
217 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
218 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
219 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
220 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
221 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
222 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
223 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
224 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
225 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
226 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
227 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
228 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
229 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
230 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
231 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
232 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
233 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
234 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
235 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
236 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
237 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
238 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
239 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
240 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
241 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
242 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
243 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
244 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
245 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
246 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
247 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
248 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
249 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
250 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
251 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
252 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
253 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
254 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
255 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
256 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
257 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
258 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
259 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
260 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
261 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
262 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
263 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
264 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
265 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
266 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
267 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
268 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
269 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
270 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
271 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
272 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
273 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
274 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
275 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
276 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
277 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
278 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
279 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
280 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
281 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
282 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
283 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
284 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
285 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
286 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
287 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
288 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
289 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
290 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
291 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
292 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
293 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
294 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
295 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
296 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
297 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
298 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
299 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
300 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
301 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
302 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
303 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
304 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
305 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
306 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
307 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
308 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
309 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
310 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
311 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
312 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
313 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
314 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
315 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
316 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
317 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
318 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
319 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
320 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
321 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
322 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
323 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
324 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
325 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
326 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
327 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
328 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
329 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
330 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
331 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
332 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
333 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
334 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
335 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
336 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
337 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
338 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
339 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
340 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
341 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
342 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
343 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
344 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
345 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
346 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
347 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
348 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
349 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
350 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
351 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
352 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
353 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
354 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
355 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
356 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
357 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
358 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
359 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
360 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
361 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
362 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
363 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
364 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
365 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
367 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
368 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
369 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
373 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
374 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
375 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
376 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
378 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
379 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
380 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
381 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
382 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
383 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
384 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
385 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
386 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
387 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
388 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
389 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
390 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
391 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
392 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
393 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
394 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
395 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
396 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
397 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
398 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
399 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
400 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
401 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
402 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
403 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
404 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
405 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
406 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
407 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
408 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
409 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
410 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
411 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
412 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
413 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
414 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
415 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
416 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
417 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
418 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
419 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
420 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
421 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
422 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
423 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
424 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
437 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
438 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
439 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
440 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
441 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
442 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
443 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
444 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
445 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
446 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
447 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
448 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
449 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
450 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
451 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
452 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
453 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
454 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
455 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
456 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
457 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
458 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
459 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
460 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
461 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
462 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
463 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
464 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 38.16
Metatranscriptomes 0
Isolates 61.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.75
Bulb 0
Endosphere 13.72
Nodule 48.87
Rhizoplane 1.69
Rhizosphere 19.36
Stem 0
Stem Tuber 0
Unclassified 15.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1002383 3300002773 Bacteria 7193
2 JGI25159J45721_1000001 3300002987 Bacteria 303489
3 JGI25159J45721_1000114 3300002987 Bacteria 38646
4 JGI25151J46595_10007498 3300003187 Bacteria 5338
5 JGI25151J46595_10048144 3300003187 Bacteria 1476
6 JGI25151J46595_10082203 3300003187 Bacteria 928
7 rootH2_10214499 3300003320 Bacteria 1106
8 JGI25160J50197_1000002 3300003354 Bacteria 561707
9 JGI25161J50226_1000968 3300003374 Bacteria 10178
10 Ga0055526_1000699 3300003771 Bacteria 25422
11 Ga0055526_1009144 3300003771 Bacteria 4817
12 Ga0055524_1000974 3300003775 Bacteria 17947
13 Ga0055524_1011601 3300003775 Bacteria 3435
14 Ga0055530_10016836 3300003791 Bacteria 2314
15 Ga0055531_10000882 3300003794 Bacteria 24537
16 Ga0058692_1001560 3300003856 Bacteria 8280
17 Ga0055543_1000010 3300004625 Bacteria 198371
18 Ga0065165_1000004 3300005262 Bacteria 377081
19 Ga0070670_100020702 3300005331 Bacteria 5658
20 Ga0070669_100219899 3300005353 Bacteria 1501
21 Ga0070665_100037637 3300005548 Bacteria 4864
22 Ga0070665_100071715 3300005548 Bacteria 3470
23 Ga0070665_100332961 3300005548 Bacteria 1523
24 Ga0081455_10095681 3300005937 Bacteria 2396
25 Ga0081540_1064266 3300005983 Bacteria 1732
26 Ga0075365_10051196 3300006038 Bacteria 2727
27 Ga0075368_10001501 3300006042 Bacteria 7468
28 Ga0075364_10000081 3300006051 Bacteria 37644
29 Ga0075364_10150999 3300006051 Bacteria 1566
30 Ga0075364_10314955 3300006051 Bacteria 1065
31 Ga0075362_10043152 3300006177 Bacteria 1996
32 Ga0075369_10044253 3300006186 Bacteria 1912
33 Ga0075369_10072593 3300006186 Bacteria 1517
34 Ga0075366_10012526 3300006195 Bacteria 4812
35 Ga0075366_10141221 3300006195 Bacteria 1456
36 Ga0079104_1000010 3300006946 Bacteria 366021
37 Ga0079104_1002603 3300006946 Bacteria 9457
38 Ga0079104_1007721 3300006946 Bacteria 3852
39 Ga0099826_10001318 3300006948 Bacteria 14680
40 Ga0099826_10004914 3300006948 Bacteria 9465
41 Ga0105243_10192838 3300009148 Bacteria 1781
42 Ga0105239_10088324 3300010375 Bacteria 3418
43 Ga0157373_10015667 3300013100 Bacteria 5538
44 Ga0157371_10000200 3300013102 Bacteria 87804
45 Ga0157370_10000030 3300013104 Bacteria 145571
46 Ga0171463_1001 3300013249 Bacteria 1406070
47 Ga0183363_1167 3300015690 Bacteria 15135
48 Ga0214544_1000008 3300021320 Bacteria 326027
49 Ga0214542_1000010 3300021321 Bacteria 262816
50 Ga0214542_1018203 3300021321 Bacteria 6036
51 Ga0214543_1000003 3300021327 Bacteria 692327
52 Ga0214543_1000004 3300021327 Bacteria 527190
53 Ga0228711_1000001 3300022739 Bacteria 357377
54 Ga0228710_1000001 3300022740 Bacteria 314328
55 Ga0209130_1000008 3300025284 Bacteria 581232
56 Ga0209130_1042505 3300025284 Bacteria 869
57 Ga0209676_1006528 3300025292 Bacteria 5731
58 Ga0209676_1010131 3300025292 Bacteria 3971
59 Ga0209025_1000118 3300025294 Bacteria 214009
60 Ga0209025_1000575 3300025294 Bacteria 66684
61 Ga0209025_1000887 3300025294 Bacteria 46715
62 Ga0209564_1000104 3300025295 Bacteria 219017
63 Ga0209564_1016615 3300025295 Bacteria 2915
64 Ga0209758_1000191 3300025297 Bacteria 136984
65 Ga0209758_1081510 3300025297 Bacteria 977
66 Ga0209050_1002861 3300025298 Bacteria 13669
67 Ga0209256_1000461 3300025299 Bacteria 61432
68 Ga0209256_1000465 3300025299 Bacteria 61255
69 Ga0207426_1000016 3300025302 Bacteria 581232
70 Ga0209051_1006571 3300025303 Bacteria 6525
71 Ga0209257_1005245 3300025304 Bacteria 9253
72 Ga0209257_1043200 3300025304 Bacteria 1323
73 Ga0207681_10150361 3300025923 Bacteria 1744
74 Ga0207709_10230590 3300025935 Bacteria 1341
75 Ga0209281_1000078 3300027111 Bacteria 261622
76 Ga0209281_1000155 3300027111 Bacteria 164423
77 Ga0209281_1000215 3300027111 Bacteria 126639
78 Ga0209371_1003203 3300027312 Bacteria 8247
79 Ga0209282_1000025 3300027666 Bacteria 168676
80 Ga0209282_1000293 3300027666 Bacteria 24666
81 Ga0209282_1046264 3300027666 Bacteria 2539
82 Ga0209813_10000636 3300027866 Bacteria 8137
83 Ga0268266_10022338 3300028379 Bacteria 5393
84 Ga0268266_10047187 3300028379 Bacteria 3689
85 Ga0268266_10275076 3300028379 Bacteria 1564
86 Ga0268266_10873248 3300028379 Bacteria 869
87 Ga0307515_10002427 3300028794 Bacteria 40656
88 Ga0307515_10328084 3300028794 Bacteria 1191
89 Ga0268256_1006082 3300030500 Bacteria 4564
90 Ga0307513_10003495 3300031456 Bacteria 21265
91 Ga0307513_10051759 3300031456 Bacteria 4427
92 Ga0307410_10139646 3300031852 Bacteria 1791
93 Ga0315914_1000020 3300031967 Bacteria 121647
94 Ga0307416_100944963 3300032002 Bacteria 964
95 Ga0315913_1000013 3300033430 Bacteria 121559
96 Ga0315915_1000015 3300033464 Bacteria 168491
97 Ga0395899_0000030 3300037312 Bacteria 329063
98 Ga0395900_0000023 3300037418 Bacteria 336048
99 Ga0395898_0000038 3300037466 Bacteria 329063
100 Ga0395905_0000021 3300037471 Bacteria 329054
101 Ga0395901_0000018 3300038443 Bacteria 336048
102 Ga0439465_0063783 3300041413 Bacteria 1224
103 Ga0439449_0009404 3300042007 Bacteria 3706
104 Ga0439462_0023891 3300042015 Bacteria 1603
105 Ga0495638_0003268 3300046460 Bacteria 12793
106 Ga0495638_0015723 3300046460 Bacteria 5073
107 Ga0495638_0064288 3300046460 Bacteria 2260
108 Ga0495638_0111196 3300046460 Bacteria 1627
109 Ga0495585_0118536 3300046492 Bacteria 1402
110 Ga0495583_0010857 3300046506 Bacteria 5271
111 Ga0495606_0006905 3300046507 Bacteria 10332
112 Ga0495632_0043485 3300046519 Bacteria 2245
113 Ga0495648_0067410 3300046524 Bacteria 2093
114 Ga0495652_0099884 3300046529 Bacteria 2356
115 Ga0495654_0000043 3300046530 Bacteria 161913
116 Ga0495622_0086454 3300046557 Bacteria 1442
117 Ga0495625_0054863 3300046660 Bacteria 2845
118 Ga0495635_0177117 3300046663 Bacteria 1450
119 Ga0495588_0006962 3300046674 Bacteria 5127
120 Ga0495670_0061453 3300046691 Bacteria 1889
121 Ga0495660_0050825 3300046810 Bacteria 2257
122 Ga0495604_0049673 3300047317 Bacteria 3257
123 Ga0495672_0026675 3300047320 Bacteria 3682
124 Ga0495676_0198101 3300047321 Bacteria 1397
125 Ga0495686_0001564 3300047472 Bacteria 24387
126 Ga0495686_0017696 3300047472 Bacteria 4796
127 Ga0495602_0211199 3300048088 Bacteria 1473
128 Ga0496113_0197033 3300048916 Bacteria 1600
129 Ga0496116_0012627 3300048919 Bacteria 6881
130 Ga0496117_0000002 3300048920 Bacteria 2483758
131 Ga0496117_0014997 3300048920 Bacteria 6638
132 Ga0496117_0106703 3300048920 Bacteria 1757
133 Ga0496118_0000483 3300048921 Bacteria 66119
134 Ga0496119_0218131 3300048922 Bacteria 977
135 Ga0496120_0000971 3300048923 Bacteria 39060
136 Ga0496120_0097635 3300048923 Bacteria 1558
137 Ga0496121_0007648 3300048924 Bacteria 12982
138 Ga0496121_0008329 3300048924 Bacteria 12248
139 Ga0496121_0038824 3300048924 Bacteria 4208
140 Ga0496122_0000001 3300048925 Bacteria 1827766
141 Ga0496122_0000009 3300048925 Bacteria 584024
142 Ga0496122_0000758 3300048925 Bacteria 62582
143 Ga0496123_0000001 3300048926 Bacteria 1831497
144 Ga0496123_0000020 3300048926 Bacteria 388748
145 Ga0496123_0000499 3300048926 Bacteria 68150
146 Ga0496124_0011809 3300048927 Bacteria 8701
147 Ga0496124_0033964 3300048927 Bacteria 4482
148 Ga0496124_0183277 3300048927 Bacteria 1609
149 Ga0496125_0000254 3300048928 Bacteria 109882
150 Ga0496125_0009173 3300048928 Bacteria 10224
151 Ga0496125_0181017 3300048928 Bacteria 1404
152 Ga0496126_0002880 3300048929 Bacteria 22450
153 Ga0496126_0123263 3300048929 Bacteria 2245
154 Ga0501031_0038373 3300049568 Bacteria 3126
155 Ga0501032_0000060 3300049569 Bacteria 95279
156 Ga0501033_0001975 3300049570 Bacteria 17865
157 Ga0501033_0317083 3300049570 Bacteria 1095
158 Ga0501034_0000262 3300049571 Bacteria 95293
159 Ga0501034_0370617 3300049571 Bacteria 1358
160 Ga0501036_0000514 3300049572 Bacteria 27770
161 Ga0501036_0203709 3300049572 Bacteria 1664
162 Ga0501037_0002944 3300049573 Bacteria 12350
163 Ga0501037_0148298 3300049573 Bacteria 1677
164 Ga0501038_0000051 3300049574 Bacteria 95293
165 Ga0501038_0196042 3300049574 Bacteria 1623
166 Ga0501039_0000051 3300049575 Bacteria 95293
167 Ga0501039_0214409 3300049575 Bacteria 1514
168 Ga0501041_0308575 3300049577 Bacteria 997
169 Ga0501043_0000844 3300049579 Bacteria 27234
170 Ga0501047_0154106 3300049581 Bacteria 2172
171 Ga0501035_0000119 3300049822 Bacteria 95271
172 Ga0501044_0010269 3300049823 Bacteria 10171
173 Ga0501044_0193037 3300049823 Bacteria 1998
174 Ga0501044_0409423 3300049823 Bacteria 1267
175 nmdc:mga03683_6790_c1 3300050489 Bacteria 3939
176 nmdc:mga00v17_194_c1 3300050491 Bacteria 36724
177 nmdc:mga00v17_92_c1 3300050491 Bacteria 53037
178 nmdc:mga0yw44_226_c1 3300050492 Bacteria 19284
179 nmdc:mga0yw44_29970_c1 3300050492 Bacteria 3147
180 nmdc:mga0k408_63149_c1 3300050493 Bacteria 2154
181 nmdc:mga0k408_9382_c1 3300050493 Bacteria 5274
182 nmdc:mga06z11_34113_c1 3300050494 Bacteria 2496
183 nmdc:mga0sz30_461_c1 3300050516 Bacteria 15397
184 Ga0495601_0206907 3300053077 Bacteria 1282
185 Ga0500643_080545 3300053087 Bacteria 895
186 Ga0500560_066414 3300053107 Bacteria 1183
187 Ga0500594_0087474 3300053118 Bacteria 941
188 Ga0500618_000007 3300053125 Bacteria 226268
189 Ga0500618_004183 3300053125 Bacteria 4700
190 Ga0500618_015985 3300053125 Bacteria 1885
191 Ga0500618_016828 3300053125 Bacteria 1824
192 Ga0500621_092654 3300053126 Bacteria 1200
193 Ga0500561_0000108 3300053137 Bacteria 16003
194 Ga0500568_0001297 3300053139 Bacteria 16411
195 Ga0500568_0093879 3300053139 Bacteria 1130
196 Ga0500573_0008390 3300053140 Bacteria 5688
197 Ga0500573_0047401 3300053140 Bacteria 2476
198 Ga0500590_037757 3300053148 Bacteria 2494
199 Ga0500616_0000758 3300053153 Bacteria 37186
200 Ga0500622_0002839 3300053156 Bacteria 12151
201 Ga0500627_0088492 3300053158 Bacteria 1385
202 Ga0500636_0168531 3300053177 Bacteria 1186
203 Ga0500636_0232053 3300053177 Bacteria 954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028794 Ga0307515_10002427 Ga0307515_1000242736 226
2 3300031456 Ga0307513_10003495 Ga0307513_1000349523 226
3 3300021320 Ga0214544_1000008 Ga0214544_1000008167 229
4 3300021321 Ga0214542_1000010 Ga0214542_1000010123 229
5 3300021327 Ga0214543_1000004 Ga0214543_1000004145 229
6 3300053126 Ga0500621_092654 Ga0500621_092654_242_943 229
7 3300053139 Ga0500568_0093879 Ga0500568_0093879_183_884 229
8 3300053153 Ga0500616_0000758 Ga0500616_0000758_8503_9264 229
9 3300053156 Ga0500622_0002839 Ga0500622_0002839_1840_2541 229
10 3300053087 Ga0500643_080545 Ga0500643_080545_105_866 230
11 iso_pu_bacteria 2558860983 2561467239 230
12 iso_pu_bacteria 2643221688 2644493649 230
13 iso_pu_bacteria 2839993093 2839994453 231
14 iso_pu_bacteria 2891048133 2891050723 235
15 3300046460 Ga0495638_0003268 Ga0495638_0003268_7773_8528 236
16 3300046557 Ga0495622_0086454 Ga0495622_0086454_396_1121 236
17 3300047320 Ga0495672_0026675 Ga0495672_0026675_1687_2442 236
18 3300047321 Ga0495676_0198101 Ga0495676_0198101_79_804 236
19 3300053139 Ga0500568_0001297 Ga0500568_0001297_3099_3854 236
20 iso_pu_bacteria 2537561587 2537874430 236
21 iso_pu_bacteria 2554235003 2554246801 236
22 iso_pu_bacteria 2558860242 2559294028 236
23 iso_pu_bacteria 2643221693 2644519057 236
24 iso_pu_bacteria 2808606387 2808986199 236
25 iso_pu_bacteria 650716007 650739219 236
26 3300010375 Ga0105239_10088324 Ga0105239_100883245 237
27 3300025284 Ga0209130_1042505 Ga0209130_10425052 237
28 3300046460 Ga0495638_0015723 Ga0495638_0015723_1216_1941 237
29 3300046460 Ga0495638_0111196 Ga0495638_0111196_136_861 237
30 3300049823 Ga0501044_0193037 Ga0501044_0193037_740_1477 237
31 iso_pu_bacteria 8054558443 8054560324 237
32 iso_pu_bacteria 2508501122 2509107314 238
33 iso_pu_bacteria 2509276019 2509374720 238
34 iso_pu_bacteria 2558860100 2558863712 238
35 iso_pu_bacteria 2643221637 2644206483 238
36 iso_pu_bacteria 2643221718 2644650130 238
37 iso_pu_bacteria 2850079185 2850080251 238
38 iso_pu_bacteria 2989771324 2989774160 238
39 3300006195 Ga0075366_10012526 Ga0075366_100125263 239
40 3300028794 Ga0307515_10328084 Ga0307515_103280842 239
41 3300046660 Ga0495625_0054863 Ga0495625_0054863_1058_1792 239
42 3300050491 nmdc:mga00v17_92_c1 nmdc:mga00v17_92_c1_4132_4866 239
43 3300050493 nmdc:mga0k408_63149_c1 nmdc:mga0k408_63149_c1_509_1270 239
44 iso_pu_bacteria 2582581306 2585266550 239
45 iso_pu_bacteria 2582581865 2585387566 239
46 iso_pu_bacteria 2582581866 2585394172 239
47 iso_pu_bacteria 2585427634 2585999191 239
48 iso_pu_bacteria 2643221686 2644479700 239
49 iso_pu_bacteria 3002141150 3002142963 239
50 3300005353 Ga0070669_100219899 Ga0070669_1002198992 240
51 3300005548 Ga0070665_100037637 Ga0070665_1000376372 240
52 3300005548 Ga0070665_100332961 Ga0070665_1003329612 240
53 3300006042 Ga0075368_10001501 Ga0075368_100015016 240
54 3300006051 Ga0075364_10314955 Ga0075364_103149552 240
55 3300006177 Ga0075362_10043152 Ga0075362_100431522 240
56 3300006186 Ga0075369_10044253 Ga0075369_100442532 240
57 3300009148 Ga0105243_10192838 Ga0105243_101928383 240
58 3300013100 Ga0157373_10015667 Ga0157373_100156673 240
59 3300013102 Ga0157371_10000200 Ga0157371_1000020011 240
60 3300013104 Ga0157370_10000030 Ga0157370_1000003042 240
61 3300025923 Ga0207681_10150361 Ga0207681_101503612 240
62 3300025935 Ga0207709_10230590 Ga0207709_102305902 240
63 3300027866 Ga0209813_10000636 Ga0209813_100006367 240
64 3300028379 Ga0268266_10022338 Ga0268266_100223383 240
65 3300028379 Ga0268266_10275076 Ga0268266_102750762 240
66 3300046810 Ga0495660_0050825 Ga0495660_0050825_100_855 240
67 3300048924 Ga0496121_0008329 Ga0496121_0008329_3768_4547 240
68 iso_pu_bacteria 2599185156 2599333230 240
69 iso_pu_bacteria 2643221557 2643807480 240
70 iso_pu_bacteria 2643221610 2644069891 240
71 iso_pu_bacteria 2643221618 2644109275 240
72 iso_pu_bacteria 2643221626 2644151796 240
73 iso_pu_bacteria 2643221655 2644311930 240
74 iso_pu_bacteria 2643221659 2644330203 240
75 iso_pu_bacteria 2643221668 2644380863 240
76 iso_pu_bacteria 2643221675 2644414767 240
77 iso_pu_bacteria 2643221680 2644448424 240
78 iso_pu_bacteria 2643221698 2644543043 240
79 iso_pu_bacteria 2643221712 2644617728 240
80 iso_pu_bacteria 2643221726 2644689269 240
81 iso_pu_bacteria 2844163670 2844163708 240
82 iso_pu_bacteria 2855825444 2855831981 240
83 iso_pu_bacteria 2855839649 2855840265 240
84 iso_pu_bacteria 2858800743 2858800798 240
85 iso_pu_bacteria 2915980308 2915982222 240
86 iso_pu_bacteria 2915986958 2915991633 240
87 iso_pu_bacteria 2915993759 2915998005 240
88 iso_pu_bacteria 2916000859 2916005781 240
89 iso_pu_bacteria 2916007675 2916008523 240
90 iso_pu_bacteria 2916014648 2916020334 240
91 iso_pu_bacteria 2916021584 2916023497 240
92 iso_pu_bacteria 2916028427 2916034490 240
93 iso_pu_bacteria 2916035215 2916035236 240
94 iso_pu_bacteria 2916041962 2916045536 240
95 iso_pu_bacteria 2916048683 2916051206 240
96 iso_pu_bacteria 2916055098 2916059991 240
97 iso_pu_bacteria 2916061851 2916062557 240
98 iso_pu_bacteria 2916068649 2916070232 240
99 iso_pu_bacteria 2916076590 2916081795 240
100 iso_pu_bacteria 2920822456 2920823590 240
101 iso_pu_bacteria 2921201388 2921207701 240
102 iso_pu_bacteria 2921208531 2921214489 240
103 iso_pu_bacteria 2921237296 2921240496 240
104 iso_pu_bacteria 2921244191 2921250001 240
105 iso_pu_bacteria 2921250672 2921250783 240
106 iso_pu_bacteria 2921257292 2921261130 240
107 iso_pu_bacteria 2921263974 2921269240 240
108 iso_pu_bacteria 2921282425 2921283800 240
109 iso_pu_bacteria 2921289301 2921295033 240
110 iso_pu_bacteria 2921296804 2921301685 240
111 iso_pu_bacteria 2924144063 2924147038 240
112 iso_pu_bacteria 2924150972 2924158128 240
113 iso_pu_bacteria 2924158325 2924160391 240
114 iso_pu_bacteria 2924165586 2924166192 240
115 iso_pu_bacteria 2924172951 2924178664 240
116 iso_pu_bacteria 2924179722 2924180272 240
117 iso_pu_bacteria 2924186466 2924191679 240
118 iso_pu_bacteria 2924193448 2924198523 240
119 iso_pu_bacteria 2924200457 2924204505 240
120 iso_pu_bacteria 2924207177 2924207540 240
121 iso_pu_bacteria 2924214083 2924220032 240
122 iso_pu_bacteria 2924221636 2924222795 240
123 iso_pu_bacteria 2924228884 2924231337 240
124 iso_pu_bacteria 2941499720 2941500508 240
125 3300025297 Ga0209758_1000191 Ga0209758_10001919 241
126 iso_pu_bacteria 2585427633 2585994708 241
127 iso_pu_bacteria 3003930520 3003932297 241
128 3300021321 Ga0214542_1018203 Ga0214542_10182037 242
129 3300021327 Ga0214543_1000003 Ga0214543_1000003249 242
130 3300048924 Ga0496121_0007648 Ga0496121_0007648_3104_3856 242
131 3300049571 Ga0501034_0370617 Ga0501034_0370617_105_845 242
132 iso_pu_bacteria 2599185210 2599603649 242
133 iso_pu_bacteria 2600255279 2601608996 242
134 iso_pu_bacteria 2600255308 2601745771 242
135 iso_pu_bacteria 2643221607 2644046911 242
136 iso_pu_bacteria 2643221636 2644203650 242
137 iso_pu_bacteria 2838675328 2838677052 242
138 iso_pu_bacteria 2838714209 2838715939 242
139 iso_pu_bacteria 2838719591 2838720259 242
140 iso_pu_bacteria 2841846520 2841847192 242
141 iso_pu_bacteria 2841859092 2841860274 242
142 iso_pu_bacteria 2842124991 2842126778 242
143 iso_pu_bacteria 2842130223 2842131945 242
144 iso_pu_bacteria 2842152218 2842152885 242
145 iso_pu_bacteria 2842170452 2842172184 242
146 iso_pu_bacteria 2842175837 2842176504 242
147 iso_pu_bacteria 2842187318 2842189048 242
148 iso_pu_bacteria 2842211629 2842213361 242
149 iso_pu_bacteria 2842224351 2842225021 242
150 iso_pu_bacteria 2842515876 2842517059 242
151 iso_pu_bacteria 2891373044 2891376344 242
152 iso_pu_bacteria 2899792073 2899792340 242
153 iso_pu_bacteria 2899845264 2899846612 242
154 iso_pu_bacteria 2919114240 2919116144 242
155 iso_pu_bacteria 2926754445 2926757096 242
156 iso_pu_bacteria 2926760298 2926761318 242
157 iso_pu_bacteria 2933006813 2933007530 242
158 iso_pu_bacteria 2933011516 2933012298 242
159 iso_pu_bacteria 2933594066 2933594742 242
160 3300002987 JGI25159J45721_1000001 JGI25159J45721_100000135 243
161 3300003187 JGI25151J46595_10082203 JGI25151J46595_100822032 243
162 3300003354 JGI25160J50197_1000002 JGI25160J50197_1000002275 243
163 3300003374 JGI25161J50226_1000968 JGI25161J50226_10009684 243
164 3300003771 Ga0055526_1000699 Ga0055526_100069922 243
165 3300003775 Ga0055524_1011601 Ga0055524_10116014 243
166 3300003791 Ga0055530_10016836 Ga0055530_100168364 243
167 3300004625 Ga0055543_1000010 Ga0055543_1000010108 243
168 3300005262 Ga0065165_1000004 Ga0065165_1000004103 243
169 3300025284 Ga0209130_1000008 Ga0209130_1000008269 243
170 3300025292 Ga0209676_1010131 Ga0209676_10101313 243
171 3300025294 Ga0209025_1000887 Ga0209025_10008879 243
172 3300025295 Ga0209564_1000104 Ga0209564_100010439 243
173 3300025297 Ga0209758_1081510 Ga0209758_10815102 243
174 3300025299 Ga0209256_1000465 Ga0209256_100046558 243
175 3300025302 Ga0207426_1000016 Ga0207426_1000016292 243
176 3300025304 Ga0209257_1043200 Ga0209257_10432001 243
177 3300037312 Ga0395899_0000030 Ga0395899_0000030_297186_297938 243
178 3300037418 Ga0395900_0000023 Ga0395900_0000023_303592_304344 243
179 3300037466 Ga0395898_0000038 Ga0395898_0000038_297186_297938 243
180 3300037471 Ga0395905_0000021 Ga0395905_0000021_297186_297938 243
181 3300038443 Ga0395901_0000018 Ga0395901_0000018_303592_304344 243
182 3300048925 Ga0496122_0000009 Ga0496122_0000009_324970_325734 243
183 3300048926 Ga0496123_0000020 Ga0496123_0000020_129422_130186 243
184 3300048927 Ga0496124_0183277 Ga0496124_0183277_439_1203 243
185 3300049570 Ga0501033_0317083 Ga0501033_0317083_237_995 243
186 3300049572 Ga0501036_0203709 Ga0501036_0203709_311_1069 243
187 3300049573 Ga0501037_0148298 Ga0501037_0148298_851_1633 243
188 3300049574 Ga0501038_0196042 Ga0501038_0196042_295_1053 243
189 3300049575 Ga0501039_0214409 Ga0501039_0214409_559_1341 243
190 3300049823 Ga0501044_0409423 Ga0501044_0409423_38_820 243
191 iso_pu_bacteria 2599185352 2600191664 243
192 iso_pu_bacteria 2643221723 2644673822 243
193 iso_pu_bacteria 2838724970 2838726692 243
194 iso_pu_bacteria 2979089926 2979093400 243
195 iso_pu_bacteria 2979095461 2979099214 243
196 iso_pu_bacteria 2984509177 2984512774 243
197 iso_pu_bacteria 2984518228 2984520863 243
198 iso_pu_bacteria 2984537506 2984540157 243
199 iso_pu_bacteria 2984601300 2984602350 243
200 iso_pu_bacteria 8003570095 8003570228 243
201 3300003775 Ga0055524_1000974 Ga0055524_100097413 244
202 3300003794 Ga0055531_10000882 Ga0055531_1000088211 244
203 3300005937 Ga0081455_10095681 Ga0081455_100956812 244
204 3300006051 Ga0075364_10000081 Ga0075364_100000819 244
205 3300006946 Ga0079104_1002603 Ga0079104_10026038 244
206 3300006946 Ga0079104_1007721 Ga0079104_10077214 244
207 3300013249 Ga0171463_1001 Ga0171463_1001487 244
208 3300015690 Ga0183363_1167 Ga0183363_116710 244
209 3300022739 Ga0228711_1000001 Ga0228711_1000001291 244
210 3300022740 Ga0228710_1000001 Ga0228710_100000134 244
211 3300025292 Ga0209676_1006528 Ga0209676_10065286 244
212 3300025295 Ga0209564_1016615 Ga0209564_10166154 244
213 3300025298 Ga0209050_1002861 Ga0209050_100286116 244
214 3300025299 Ga0209256_1000461 Ga0209256_100046157 244
215 3300025303 Ga0209051_1006571 Ga0209051_10065716 244
216 3300025304 Ga0209257_1005245 Ga0209257_100524510 244
217 3300027111 Ga0209281_1000155 Ga0209281_1000155122 244
218 3300027111 Ga0209281_1000215 Ga0209281_1000215103 244
219 3300027666 Ga0209282_1000025 Ga0209282_100002542 244
220 3300031852 Ga0307410_10139646 Ga0307410_101396462 244
221 3300031967 Ga0315914_1000020 Ga0315914_100002041 244
222 3300032002 Ga0307416_100944963 Ga0307416_1009449631 244
223 3300033430 Ga0315913_1000013 Ga0315913_100001379 244
224 3300033464 Ga0315915_1000015 Ga0315915_1000015120 244
225 3300041413 Ga0439465_0063783 Ga0439465_0063783_78_845 244
226 3300046460 Ga0495638_0064288 Ga0495638_0064288_1459_2202 244
227 3300046507 Ga0495606_0006905 Ga0495606_0006905_6408_7157 244
228 3300047472 Ga0495686_0001564 Ga0495686_0001564_14261_15010 244
229 3300048924 Ga0496121_0038824 Ga0496121_0038824_3353_4102 244
230 iso_pu_bacteria 2510917026 2511173232 244
231 iso_pu_bacteria 2511231027 2511392876 244
232 iso_pu_bacteria 2511231052 2511500789 244
233 iso_pu_bacteria 2512047086 2512532203 244
234 iso_pu_bacteria 2512875026 2512972459 244
235 iso_pu_bacteria 2513237086 2513584982 244
236 iso_pu_bacteria 2513237089 2513605482 244
237 iso_pu_bacteria 2513237091 2513616721 244
238 iso_pu_bacteria 2513237140 2513880864 244
239 iso_pu_bacteria 2513237143 2513903858 244
240 iso_pu_bacteria 2513237156 2513984868 244
241 iso_pu_bacteria 2513237160 2514007457 244
242 iso_pu_bacteria 2515154107 2515607918 244
243 iso_pu_bacteria 2516653046 2516892060 244
244 iso_pu_bacteria 2517487022 2517568876 244
245 iso_pu_bacteria 2524023207 2524450112 244
246 iso_pu_bacteria 2551306084 2551680134 244
247 iso_pu_bacteria 2551306085 2551684230 244
248 iso_pu_bacteria 2551306086 2551694418 244
249 iso_pu_bacteria 2551306087 2551700149 244
250 iso_pu_bacteria 2551306089 2551711617 244
251 iso_pu_bacteria 2551306090 2551717661 244
252 iso_pu_bacteria 2551306091 2551728984 244
253 iso_pu_bacteria 2551306093 2551745664 244
254 iso_pu_bacteria 2585427608 2585901409 244
255 iso_pu_bacteria 2802428858 2802717517 244
256 iso_pu_bacteria 2802428859 2802723554 244
257 iso_pu_bacteria 2802428860 2802730996 244
258 iso_pu_bacteria 2802428861 2802736002 244
259 iso_pu_bacteria 2802428862 2802743789 244
260 iso_pu_bacteria 2802428863 2802752994 244
261 iso_pu_bacteria 2842871566 2842873659 244
262 iso_pu_bacteria 2919171160 2919171847 244
263 iso_pu_bacteria 2928521798 2928526232 244
264 iso_pu_bacteria 2936996657 2936999259 244
265 iso_pu_bacteria 2937002841 2937003275 244
266 iso_pu_bacteria 2937009748 2937010579 244
267 iso_pu_bacteria 2937016420 2937016854 244
268 iso_pu_bacteria 2937023124 2937028106 244
269 iso_pu_bacteria 2937029754 2937030040 244
270 iso_pu_bacteria 2937036028 2937037966 244
271 iso_pu_bacteria 2937042894 2937049265 244
272 iso_pu_bacteria 2937049772 2937055358 244
273 iso_pu_bacteria 2937056579 2937057064 244
274 iso_pu_bacteria 2937063883 2937066594 244
275 iso_pu_bacteria 2937071275 2937075183 244
276 iso_pu_bacteria 2937078374 2937080117 244
277 iso_pu_bacteria 2937084907 2937091767 244
278 iso_pu_bacteria 2937091812 2937097698 244
279 iso_pu_bacteria 2937098957 2937103140 244
280 iso_pu_bacteria 2937106411 2937112608 244
281 iso_pu_bacteria 2937113482 2937119677 244
282 iso_pu_bacteria 2937119839 2937120959 244
283 iso_pu_bacteria 2937126314 2937130266 244
284 iso_pu_bacteria 2954011201 2954014871 244
285 iso_pu_bacteria 2957375807 2957379044 244
286 iso_pu_bacteria 2957382221 2957385250 244
287 iso_pu_bacteria 2957388812 2957389314 244
288 iso_pu_bacteria 2957395598 2957396997 244
289 iso_pu_bacteria 2957402308 2957402787 244
290 iso_pu_bacteria 2957408893 2957415100 244
291 iso_pu_bacteria 2957415311 2957417274 244
292 iso_pu_bacteria 2957422303 2957429987 244
293 iso_pu_bacteria 2957430029 2957436510 244
294 iso_pu_bacteria 2957437181 2957439462 244
295 iso_pu_bacteria 2957443900 2957450023 244
296 iso_pu_bacteria 2957450854 2957453305 244
297 iso_pu_bacteria 2957457609 2957462037 244
298 iso_pu_bacteria 2957464669 2957466334 244
299 iso_pu_bacteria 2957471148 2957477424 244
300 iso_pu_bacteria 2957478035 2957483844 244
301 iso_pu_bacteria 2957484790 2957489754 244
302 iso_pu_bacteria 2957491536 2957494293 244
303 iso_pu_bacteria 2957498199 2957501432 244
304 iso_pu_bacteria 2957505466 2957512125 244
305 iso_pu_bacteria 2960584000 2960589182 244
306 iso_pu_bacteria 2960591022 2960593795 244
307 iso_pu_bacteria 2960597568 2960600756 244
308 iso_pu_bacteria 2960603979 2960610746 244
309 iso_pu_bacteria 2960610863 2960613913 244
310 iso_pu_bacteria 2960617483 2960617523 244
311 iso_pu_bacteria 2960624210 2960628684 244
312 iso_pu_bacteria 2960631154 2960632896 244
313 iso_pu_bacteria 2960637947 2960643475 244
314 iso_pu_bacteria 2960645483 2960651503 244
315 iso_pu_bacteria 2960652885 2960653417 244
316 iso_pu_bacteria 2960660292 2960663322 244
317 iso_pu_bacteria 2960667422 2960668545 244
318 iso_pu_bacteria 2960674078 2960677632 244
319 iso_pu_bacteria 2960680706 2960685668 244
320 iso_pu_bacteria 2960687367 2960690482 244
321 iso_pu_bacteria 2960693952 2960696199 244
322 iso_pu_bacteria 2964607997 2964608603 244
323 iso_pu_bacteria 2964615318 2964617927 244
324 iso_pu_bacteria 2964621998 2964622813 244
325 iso_pu_bacteria 2964628898 2964633413 244
326 iso_pu_bacteria 2964636051 2964642001 244
327 iso_pu_bacteria 2964643177 2964644342 244
328 iso_pu_bacteria 2964649959 2964652921 244
329 iso_pu_bacteria 2964656573 2964658130 244
330 iso_pu_bacteria 2964663802 2964666154 244
331 iso_pu_bacteria 2964670856 2964673465 244
332 iso_pu_bacteria 2964678106 2964684664 244
333 iso_pu_bacteria 2964685014 2964686225 244
334 iso_pu_bacteria 2964691889 2964692766 244
335 iso_pu_bacteria 2964698721 2964701994 244
336 iso_pu_bacteria 2964705432 2964710453 244
337 iso_pu_bacteria 2964712639 2964713520 244
338 iso_pu_bacteria 2964719344 2964726527 244
339 iso_pu_bacteria 2967664464 2967669336 244
340 iso_pu_bacteria 2967671571 2967676556 244
341 iso_pu_bacteria 2967678726 2967678742 244
342 iso_pu_bacteria 2967686174 2967686242 244
343 iso_pu_bacteria 2967693043 2967693063 244
344 iso_pu_bacteria 2967699805 2967703727 244
345 iso_pu_bacteria 2967706974 2967710592 244
346 iso_pu_bacteria 2967714385 2967717578 244
347 iso_pu_bacteria 2967721400 2967724676 244
348 iso_pu_bacteria 2967728569 2967729787 244
349 iso_pu_bacteria 2967735183 2967741080 244
350 iso_pu_bacteria 2967742019 2967742705 244
351 iso_pu_bacteria 2967748971 2967751892 244
352 iso_pu_bacteria 2967755722 2967756582 244
353 iso_pu_bacteria 2967762386 2967765228 244
354 iso_pu_bacteria 2967769361 2967773237 244
355 iso_pu_bacteria 2967775926 2967780748 244
356 iso_pu_bacteria 2970019648 2970026140 244
357 iso_pu_bacteria 2970026789 2970032604 244
358 iso_pu_bacteria 2970033650 2970039259 244
359 iso_pu_bacteria 2970040964 2970047274 244
360 iso_pu_bacteria 2970047711 2970053397 244
361 iso_pu_bacteria 2970054988 2970059330 244
362 iso_pu_bacteria 2970061556 2970064488 244
363 iso_pu_bacteria 2970068827 2970074839 244
364 iso_pu_bacteria 2970076120 2970076545 244
365 iso_pu_bacteria 2970082768 2970083321 244
366 iso_pu_bacteria 2970088815 2970093585 244
367 iso_pu_bacteria 2970095765 2970100869 244
368 iso_pu_bacteria 2970102677 2970108384 244
369 iso_pu_bacteria 2970109326 2970112423 244
370 iso_pu_bacteria 2970116247 2970118149 244
371 iso_pu_bacteria 2970122695 2970123701 244
372 iso_pu_bacteria 2970129317 2970129337 244
373 iso_pu_bacteria 2970136068 2970139604 244
374 iso_pu_bacteria 2970143518 2970149224 244
375 iso_pu_bacteria 2970149975 2970151360 244
376 iso_pu_bacteria 2970156795 2970157046 244
377 iso_pu_bacteria 2970164137 2970167323 244
378 iso_pu_bacteria 2970170962 2970175917 244
379 iso_pu_bacteria 2970177841 2970182556 244
380 iso_pu_bacteria 2970184632 2970187317 244
381 iso_pu_bacteria 2970191845 2970197295 244
382 iso_pu_bacteria 2977516862 2977521611 244
383 iso_pu_bacteria 2977523885 2977526048 244
384 iso_pu_bacteria 2977530762 2977537526 244
385 iso_pu_bacteria 2977537788 2977537809 244
386 iso_pu_bacteria 2977544691 2977544758 244
387 iso_pu_bacteria 2977551784 2977551804 244
388 iso_pu_bacteria 2977558990 2977563018 244
389 iso_pu_bacteria 2977565890 2977568254 244
390 iso_pu_bacteria 2977572785 2977574774 244
391 iso_pu_bacteria 2977579622 2977581676 244
392 iso_pu_bacteria 648276728 648737681 244
393 iso_pu_bacteria 8003992118 8003992682 244
394 iso_pu_bacteria 8003999396 8004000007 244
395 3300003187 JGI25151J46595_10007498 JGI25151J46595_100074986 245
396 3300003187 JGI25151J46595_10048144 JGI25151J46595_100481442 245
397 3300003856 Ga0058692_1001560 Ga0058692_10015604 245
398 3300006051 Ga0075364_10150999 Ga0075364_101509992 245
399 3300006186 Ga0075369_10072593 Ga0075369_100725932 245
400 3300006948 Ga0099826_10001318 Ga0099826_100013189 245
401 3300006948 Ga0099826_10004914 Ga0099826_100049149 245
402 3300025294 Ga0209025_1000118 Ga0209025_1000118103 245
403 3300025294 Ga0209025_1000575 Ga0209025_100057537 245
404 3300027312 Ga0209371_1003203 Ga0209371_100320310 245
405 3300027666 Ga0209282_1000293 Ga0209282_100029313 245
406 3300027666 Ga0209282_1046264 Ga0209282_10462642 245
407 3300028379 Ga0268266_10873248 Ga0268266_108732481 245
408 3300030500 Ga0268256_1006082 Ga0268256_10060823 245
409 3300046674 Ga0495588_0006962 Ga0495588_0006962_4100_4876 245
410 3300046691 Ga0495670_0061453 Ga0495670_0061453_212_994 245
411 3300048916 Ga0496113_0197033 Ga0496113_0197033_566_1342 245
412 3300048919 Ga0496116_0012627 Ga0496116_0012627_4794_5570 245
413 3300048920 Ga0496117_0000002 Ga0496117_0000002_1790154_1790930 245
414 3300048920 Ga0496117_0014997 Ga0496117_0014997_2542_3330 245
415 3300048920 Ga0496117_0106703 Ga0496117_0106703_954_1730 245
416 3300048921 Ga0496118_0000483 Ga0496118_0000483_18448_19224 245
417 3300048922 Ga0496119_0218131 Ga0496119_0218131_180_956 245
418 3300048923 Ga0496120_0000971 Ga0496120_0000971_24700_25476 245
419 3300048923 Ga0496120_0097635 Ga0496120_0097635_726_1502 245
420 3300048925 Ga0496122_0000001 Ga0496122_0000001_1160944_1161720 245
421 3300048925 Ga0496122_0000758 Ga0496122_0000758_25709_26497 245
422 3300048926 Ga0496123_0000001 Ga0496123_0000001_1164675_1165451 245
423 3300048926 Ga0496123_0000499 Ga0496123_0000499_31277_32065 245
424 3300048927 Ga0496124_0011809 Ga0496124_0011809_1070_1846 245
425 3300048927 Ga0496124_0033964 Ga0496124_0033964_2736_3512 245
426 3300048928 Ga0496125_0000254 Ga0496125_0000254_3110_3898 245
427 3300048928 Ga0496125_0009173 Ga0496125_0009173_4542_5318 245
428 3300048928 Ga0496125_0181017 Ga0496125_0181017_204_980 245
429 3300048929 Ga0496126_0002880 Ga0496126_0002880_20604_21368 245
430 3300050489 nmdc:mga03683_6790_c1 nmdc:mga03683_6790_c1_1027_1803 245
431 3300050491 nmdc:mga00v17_194_c1 nmdc:mga00v17_194_c1_25440_26216 245
432 3300050492 nmdc:mga0yw44_226_c1 nmdc:mga0yw44_226_c1_3969_4745 245
433 3300050493 nmdc:mga0k408_9382_c1 nmdc:mga0k408_9382_c1_3166_3942 245
434 3300050494 nmdc:mga06z11_34113_c1 nmdc:mga06z11_34113_c1_443_1219 245
435 3300050516 nmdc:mga0sz30_461_c1 nmdc:mga0sz30_461_c1_5387_6163 245
436 3300053107 Ga0500560_066414 Ga0500560_066414_304_1080 245
437 3300053118 Ga0500594_0087474 Ga0500594_0087474_17_793 245
438 3300053137 Ga0500561_0000108 Ga0500561_0000108_13330_14106 245
439 iso_pu_bacteria 2516143018 2516208664 245
440 iso_pu_bacteria 2765235802 2765469095 245
441 iso_pu_bacteria 2767802442 2770194902 245
442 iso_pu_bacteria 2775506902 2776272315 245
443 iso_pu_bacteria 2775506904 2776284254 245
444 iso_pu_bacteria 2840764183 2840764988 245
445 iso_pu_bacteria 2894652903 2894655178 245
446 iso_pu_bacteria 2904578770 2904578894 245
447 iso_pu_bacteria 2913295892 2913297789 245
448 iso_pu_bacteria 2919119836 2919122279 245
449 3300005548 Ga0070665_100071715 Ga0070665_1000717154 246
450 3300005983 Ga0081540_1064266 Ga0081540_10642662 246
451 3300006038 Ga0075365_10051196 Ga0075365_100511962 246
452 3300006946 Ga0079104_1000010 Ga0079104_1000010384 246
453 3300027111 Ga0209281_1000078 Ga0209281_1000078261 246
454 3300028379 Ga0268266_10047187 Ga0268266_100471874 246
455 3300048929 Ga0496126_0123263 Ga0496126_0123263_1042_1812 246
456 3300050492 nmdc:mga0yw44_29970_c1 nmdc:mga0yw44_29970_c1_1399_2157 246
457 3300053125 Ga0500618_004183 Ga0500618_004183_3158_3964 246
458 3300053140 Ga0500573_0008390 Ga0500573_0008390_4252_5019 246
459 3300053140 Ga0500573_0047401 Ga0500573_0047401_444_1208 246
460 3300053158 Ga0500627_0088492 Ga0500627_0088492_315_1076 246
461 iso_pu_bacteria 2513237146 2513927543 246
462 iso_pu_bacteria 2582581299 2585229188 246
463 iso_pu_bacteria 2599185170 2599418974 246
464 iso_pu_bacteria 2615840624 2616295891 246
465 iso_pu_bacteria 2791355082 2792583949 246
466 iso_pu_bacteria 2802429268 2804751112 246
467 iso_pu_bacteria 2821123053 2821123847 246
468 iso_pu_bacteria 2838035591 2838037339 246
469 iso_pu_bacteria 2838074704 2838076196 246
470 iso_pu_bacteria 2838661181 2838663475 246
471 iso_pu_bacteria 2838736955 2838739124 246
472 iso_pu_bacteria 2841840854 2841843022 246
473 iso_pu_bacteria 2842140634 2842142804 246
474 iso_pu_bacteria 2847417321 2847417882 246
475 iso_pu_bacteria 2848992105 2848992724 246
476 iso_pu_bacteria 2855872281 2855873276 246
477 iso_pu_bacteria 2857531043 2857531409 246
478 iso_pu_bacteria 2896384573 2896385324 246
479 iso_pu_bacteria 2920760137 2920763117 246
480 iso_pu_bacteria 2933016740 2933017689 246
481 iso_pu_bacteria 2989349275 2989355291 246
482 iso_pu_bacteria 8049293176 8049293694 246
483 3300003771 Ga0055526_1009144 Ga0055526_10091444 247
484 3300049568 Ga0501031_0038373 Ga0501031_0038373_1530_2306 247
485 3300049569 Ga0501032_0000060 Ga0501032_0000060_22732_23508 247
486 3300049570 Ga0501033_0001975 Ga0501033_0001975_4034_4810 247
487 3300049571 Ga0501034_0000262 Ga0501034_0000262_22732_23508 247
488 3300049572 Ga0501036_0000514 Ga0501036_0000514_4324_5100 247
489 3300049573 Ga0501037_0002944 Ga0501037_0002944_7446_8222 247
490 3300049574 Ga0501038_0000051 Ga0501038_0000051_71786_72562 247
491 3300049575 Ga0501039_0000051 Ga0501039_0000051_22732_23508 247
492 3300049577 Ga0501041_0308575 Ga0501041_0308575_175_951 247
493 3300049579 Ga0501043_0000844 Ga0501043_0000844_3727_4503 247
494 3300049581 Ga0501047_0154106 Ga0501047_0154106_268_1044 247
495 3300049822 Ga0501035_0000119 Ga0501035_0000119_71779_72555 247
496 3300049823 Ga0501044_0010269 Ga0501044_0010269_210_986 247
497 iso_pu_bacteria 2524023209 2524457720 247
498 3300002987 JGI25159J45721_1000114 JGI25159J45721_100011443 248
499 3300003320 rootH2_10214499 rootH2_102144991 248
500 3300031456 Ga0307513_10051759 Ga0307513_100517594 248
501 3300046530 Ga0495654_0000043 Ga0495654_0000043_108516_109304 248
502 3300053125 Ga0500618_015985 Ga0500618_015985_312_1100 248
503 3300053125 Ga0500618_016828 Ga0500618_016828_568_1368 248
504 3300053177 Ga0500636_0168531 Ga0500636_0168531_81_848 248
505 iso_pu_bacteria 2510917022 2511133934 248
506 iso_pu_bacteria 2818991461 2819684504 248
507 3300005331 Ga0070670_100020702 Ga0070670_1000207024 249
508 3300046524 Ga0495648_0067410 Ga0495648_0067410_394_1158 249
509 3300046663 Ga0495635_0177117 Ga0495635_0177117_302_1066 249
510 3300047472 Ga0495686_0017696 Ga0495686_0017696_2759_3523 249
511 3300048088 Ga0495602_0211199 Ga0495602_0211199_678_1442 249
512 3300053125 Ga0500618_000007 Ga0500618_000007_222393_223184 249
513 3300053148 Ga0500590_037757 Ga0500590_037757_1061_1825 249
514 3300053177 Ga0500636_0232053 Ga0500636_0232053_109_873 249
515 iso_pu_bacteria 2842922631 2842923537 249
516 3300002773 JGI25152J39213_1002383 JGI25152J39213_10023837 250
517 3300006195 Ga0075366_10141221 Ga0075366_101412212 250
518 3300042007 Ga0439449_0009404 Ga0439449_0009404_2571_3356 250
519 3300042015 Ga0439462_0023891 Ga0439462_0023891_38_823 250
520 3300046492 Ga0495585_0118536 Ga0495585_0118536_97_876 250
521 3300046506 Ga0495583_0010857 Ga0495583_0010857_3960_4739 250
522 3300046519 Ga0495632_0043485 Ga0495632_0043485_932_1711 250
523 3300046529 Ga0495652_0099884 Ga0495652_0099884_52_819 250
524 3300047317 Ga0495604_0049673 Ga0495604_0049673_1599_2366 250
525 3300053077 Ga0495601_0206907 Ga0495601_0206907_297_1064 250
526 iso_pu_bacteria 2585427594 2585844418 250
527 iso_pu_bacteria 2657244999 2657682094 250
528 iso_pu_bacteria 2690316117 2692317048 250
529 iso_pu_bacteria 2791355091 2792622250 250
530 iso_pu_bacteria 2791355092 2792628185 250
531 iso_pu_bacteria 2791355094 2792638561 250
532 iso_pu_bacteria 643692032 643824739 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02104

SURF1

SURF1 family

37

248

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w5z-assembly1.cif.gz_h cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model 0.7193 29 229
8b6h-assembly1.cif.gz_Dw cryo-em structure of cytochrome c oxidase dimer (complex iv) from respiratory supercomplex of tetrahymena thermophila 0.6668 20 239
2k75-assembly1.cif.gz_A solution nmr structure of the ob domain of ta0387 from thermoplasma acidophilum. northeast structural genomics consortium target tar80b. 0.6388 55 154
8gym-assembly1.cif.gz_d cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.6253 15 240
7w5z-assembly1.cif.gz_d cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model 0.6168 15 240
ID Description Score Start End Superfamily
2k75A01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6388 55 154 2.40.50.140
af_I1LWQ0_108_335_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.6246 89 118 3.60.15.10
af_Q6NY74_284_408_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6137 57 148 2.40.50.140
af_Q9C926_114_248_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6105 57 118 2.40.50.140
af_F4J921_85_182_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.608 80 117 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A0Q6SZ16-F1-model_v4 SURF1-like protein 0.9745 11 246 GO:0005886
AF-A0A2M8UMD6-F1-model_v4 deleted 0.9743 26 243
AF-A0A095UAS4-F1-model_v4 SURF1-like protein 0.9708 17 250 GO:0005886
AF-A0A2A4R874-F1-model_v4 SURF1-like protein 0.9676 18 242 GO:0005886
AF-A0A0F2PVH5-F1-model_v4 SURF1-like protein 0.9664 19 241 GO:0005886

Feature Viewer

pLDDT pTM Quality
90.98 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map