F460369
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 533 | 249 | 533 | 404 |
Family's Representative Sequence
| Representative Sequence | 3300005356|Ga0070674_100051344|Ga0070674_1000513442 |
| Length | 461 |
| Sequence | MSSHACAPFLDSVTSGTRECPWGRLGAGARTLRPVSRVLVIGLARSGRAAVSTLRAKGENVVAYDADGGLDSAGIDAEIRLGDWDDAFLDGVGTVVKSPGVPSEAPPVAAARARGIPIVSEIELGSRLLSSPLIGVTGTNGKTTTSALLGAMLETAGWNVEVAGNIGRPLTSLVGAVDDDAWVVCELSSFQLEDVETLRPRVAVLTNLEPDHLDRHGSFDAYARAKLRAFERQGPDDVAVVPQGFGRLPGNARRVEFAGDDELPAEPRIPGAHNRENAAAATAAARAIGIPDAAIAEALRTFPGVEHRIEEIATVDGVLYVNDSKATNAAATLRALASFPGRRKHVILGGRGKSEPYDLLAAALEDGDRAYLIGEAADDLAAALGAAGARFDRVETLERAVEQAASGAAAGDVVLLSPACASFDQFTSFEHRGEEFRRLVENLREWGPDDARTEGSSSSGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 125 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 127 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 128 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 129 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 130 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 131 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 132 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 134 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 139 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 142 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 143 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 144 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 145 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 146 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 147 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 148 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 149 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 150 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 151 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 152 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 153 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 154 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 155 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 199 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 200 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 201 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 204 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 205 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 206 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 207 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 208 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 249 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.69 |
| Rhizosphere | 95.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10001717 | 3300002075 | Bacteria | 5995 |
| 2 | JGI25406J46586_10004654 | 3300003203 | Bacteria | 6389 |
| 3 | Ga0070658_10014099 | 3300005327 | Bacteria | 6418 |
| 4 | Ga0070658_10084821 | 3300005327 | Bacteria | 2605 |
| 5 | Ga0070683_100006309 | 3300005329 | Bacteria | 9951 |
| 6 | Ga0070683_100025673 | 3300005329 | Bacteria | 5294 |
| 7 | Ga0070683_100032884 | 3300005329 | Bacteria | 4727 |
| 8 | Ga0070683_100045820 | 3300005329 | Bacteria | 4037 |
| 9 | Ga0070670_100003032 | 3300005331 | Bacteria | 13894 |
| 10 | Ga0070680_100004108 | 3300005336 | Bacteria | 10903 |
| 11 | Ga0070680_100044204 | 3300005336 | Bacteria | 3619 |
| 12 | Ga0070682_100002080 | 3300005337 | Bacteria | 11128 |
| 13 | Ga0068868_100005020 | 3300005338 | Bacteria | 9291 |
| 14 | Ga0070660_100007445 | 3300005339 | Bacteria | 7628 |
| 15 | Ga0070660_100031980 | 3300005339 | Bacteria | 3956 |
| 16 | Ga0070691_10020134 | 3300005341 | Bacteria | 3081 |
| 17 | Ga0070661_100016598 | 3300005344 | Bacteria | 5208 |
| 18 | Ga0070661_100083628 | 3300005344 | Bacteria | 2358 |
| 19 | Ga0070692_10065979 | 3300005345 | Bacteria | 1917 |
| 20 | Ga0070692_10080598 | 3300005345 | Bacteria | 1752 |
| 21 | Ga0070668_100129587 | 3300005347 | Bacteria | 2023 |
| 22 | Ga0070675_100014504 | 3300005354 | Bacteria | 6215 |
| 23 | Ga0070675_100042348 | 3300005354 | Bacteria | 3720 |
| 24 | Ga0070675_100134673 | 3300005354 | Bacteria | 2108 |
| 25 | Ga0070671_100100367 | 3300005355 | Bacteria | 2428 |
| 26 | Ga0070671_100251724 | 3300005355 | Bacteria | 1501 |
| 27 | Ga0070674_100008797 | 3300005356 | Bacteria | 6026 |
| 28 | Ga0070674_100051344 | 3300005356 | Bacteria | 2841 |
| 29 | Ga0070673_100004468 | 3300005364 | Bacteria | 8846 |
| 30 | Ga0070673_100039726 | 3300005364 | Bacteria | 3604 |
| 31 | Ga0070673_100145163 | 3300005364 | Bacteria | 2005 |
| 32 | Ga0070688_100102361 | 3300005365 | Bacteria | 1890 |
| 33 | Ga0070659_100047429 | 3300005366 | Bacteria | 3370 |
| 34 | Ga0070659_100064877 | 3300005366 | Bacteria | 2891 |
| 35 | Ga0070659_100192281 | 3300005366 | Bacteria | 1678 |
| 36 | Ga0070714_100026324 | 3300005435 | Bacteria | 4806 |
| 37 | Ga0070714_100247875 | 3300005435 | Bacteria | 1646 |
| 38 | Ga0070713_100087164 | 3300005436 | Bacteria | 2677 |
| 39 | Ga0070713_100388426 | 3300005436 | Bacteria | 1302 |
| 40 | Ga0070710_10075841 | 3300005437 | Bacteria | 1950 |
| 41 | Ga0070701_10095455 | 3300005438 | Bacteria | 1637 |
| 42 | Ga0070711_100135890 | 3300005439 | Bacteria | 1837 |
| 43 | Ga0070705_100208795 | 3300005440 | Bacteria | 1344 |
| 44 | Ga0070700_100009056 | 3300005441 | Bacteria | 5454 |
| 45 | Ga0070700_100060947 | 3300005441 | Bacteria | 2379 |
| 46 | Ga0070694_100098569 | 3300005444 | Bacteria | 2064 |
| 47 | Ga0070708_100010429 | 3300005445 | Bacteria | 7532 |
| 48 | Ga0070662_100063963 | 3300005457 | Bacteria | 2692 |
| 49 | Ga0070681_10018032 | 3300005458 | Bacteria | 7053 |
| 50 | Ga0070681_10054521 | 3300005458 | Bacteria | 3984 |
| 51 | Ga0068867_100033211 | 3300005459 | Bacteria | 3735 |
| 52 | Ga0068867_100052864 | 3300005459 | Bacteria | 2999 |
| 53 | Ga0070707_100000791 | 3300005468 | Bacteria | 31274 |
| 54 | Ga0070698_100001381 | 3300005471 | Bacteria | 26903 |
| 55 | Ga0070698_100026299 | 3300005471 | Bacteria | 6058 |
| 56 | Ga0070698_100280212 | 3300005471 | Bacteria | 1599 |
| 57 | Ga0070699_100027096 | 3300005518 | Bacteria | 4942 |
| 58 | Ga0070699_100095430 | 3300005518 | Bacteria | 2604 |
| 59 | Ga0070679_100031243 | 3300005530 | Bacteria | 5260 |
| 60 | Ga0070679_100110091 | 3300005530 | Bacteria | 2740 |
| 61 | Ga0070684_100010387 | 3300005535 | Bacteria | 7372 |
| 62 | Ga0070684_100011431 | 3300005535 | Bacteria | 7074 |
| 63 | Ga0070684_100033095 | 3300005535 | Bacteria | 4411 |
| 64 | Ga0070684_100077805 | 3300005535 | Bacteria | 2930 |
| 65 | Ga0070684_100230377 | 3300005535 | Bacteria | 1691 |
| 66 | Ga0070684_100296988 | 3300005535 | Bacteria | 1482 |
| 67 | Ga0068853_100005422 | 3300005539 | Bacteria | 9992 |
| 68 | Ga0070672_100003935 | 3300005543 | Bacteria | 9682 |
| 69 | Ga0070686_100175037 | 3300005544 | Bacteria | 1521 |
| 70 | Ga0070695_100000081 | 3300005545 | Bacteria | 39746 |
| 71 | Ga0070665_100098125 | 3300005548 | Bacteria | 2934 |
| 72 | Ga0070665_100224365 | 3300005548 | Bacteria | 1879 |
| 73 | Ga0070704_100080684 | 3300005549 | Bacteria | 2394 |
| 74 | Ga0070704_100123157 | 3300005549 | Bacteria | 1996 |
| 75 | Ga0070704_100131668 | 3300005549 | Bacteria | 1939 |
| 76 | Ga0070704_100144345 | 3300005549 | Bacteria | 1863 |
| 77 | Ga0068855_100150493 | 3300005563 | Bacteria | 2647 |
| 78 | Ga0068855_100425199 | 3300005563 | Bacteria | 1452 |
| 79 | Ga0070664_100018666 | 3300005564 | Bacteria | 5702 |
| 80 | Ga0070664_100056298 | 3300005564 | Bacteria | 3341 |
| 81 | Ga0068857_100055001 | 3300005577 | Bacteria | 3532 |
| 82 | Ga0068854_100061092 | 3300005578 | Bacteria | 2728 |
| 83 | Ga0068856_100030508 | 3300005614 | Bacteria | 5270 |
| 84 | Ga0068856_100083962 | 3300005614 | Bacteria | 3164 |
| 85 | Ga0070702_100049600 | 3300005615 | Bacteria | 2394 |
| 86 | Ga0068852_100212282 | 3300005616 | Bacteria | 1837 |
| 87 | Ga0068859_100102321 | 3300005617 | Bacteria | 2922 |
| 88 | Ga0068851_10018278 | 3300005834 | Bacteria | 3376 |
| 89 | Ga0068870_10043720 | 3300005840 | Bacteria | 2338 |
| 90 | Ga0068858_100118487 | 3300005842 | Bacteria | 2475 |
| 91 | Ga0081538_10000108 | 3300005981 | Bacteria | 82426 |
| 92 | Ga0081539_10000866 | 3300005985 | Bacteria | 57957 |
| 93 | Ga0081539_10010108 | 3300005985 | Bacteria | 7743 |
| 94 | Ga0081539_10094330 | 3300005985 | Bacteria | 1540 |
| 95 | Ga0070712_100013822 | 3300006175 | Bacteria | 5166 |
| 96 | Ga0070712_100030830 | 3300006175 | Bacteria | 3608 |
| 97 | Ga0097621_100196106 | 3300006237 | Bacteria | 1751 |
| 98 | Ga0075430_100011749 | 3300006846 | Bacteria | 7455 |
| 99 | Ga0075430_100013382 | 3300006846 | Bacteria | 6991 |
| 100 | Ga0075431_100029045 | 3300006847 | Bacteria | 5689 |
| 101 | Ga0075433_10117394 | 3300006852 | Bacteria | 2361 |
| 102 | Ga0075434_100243324 | 3300006871 | Bacteria | 1819 |
| 103 | Ga0075429_100022586 | 3300006880 | Bacteria | 5454 |
| 104 | Ga0068865_100004844 | 3300006881 | Bacteria | 8137 |
| 105 | Ga0068865_100125424 | 3300006881 | Bacteria | 1916 |
| 106 | Ga0068865_100176864 | 3300006881 | Bacteria | 1641 |
| 107 | Ga0097620_100102328 | 3300006931 | Bacteria | 2922 |
| 108 | Ga0105240_10005137 | 3300009093 | Bacteria | 19588 |
| 109 | Ga0111539_10030514 | 3300009094 | Bacteria | 6552 |
| 110 | Ga0111539_10032300 | 3300009094 | Bacteria | 6357 |
| 111 | Ga0111539_10048555 | 3300009094 | Bacteria | 5067 |
| 112 | Ga0111539_10131600 | 3300009094 | Bacteria | 2929 |
| 113 | Ga0105245_10004544 | 3300009098 | Bacteria | 12250 |
| 114 | Ga0105245_10096428 | 3300009098 | Bacteria | 2729 |
| 115 | Ga0105245_10318920 | 3300009098 | Bacteria | 1530 |
| 116 | Ga0105247_10022511 | 3300009101 | Bacteria | 3795 |
| 117 | Ga0114129_10143396 | 3300009147 | Bacteria | 3273 |
| 118 | Ga0114129_10172304 | 3300009147 | Bacteria | 2949 |
| 119 | Ga0105243_10004276 | 3300009148 | Bacteria | 11310 |
| 120 | Ga0105243_10005927 | 3300009148 | Bacteria | 9466 |
| 121 | Ga0105243_10020549 | 3300009148 | Bacteria | 5006 |
| 122 | Ga0105243_10073915 | 3300009148 | Bacteria | 2763 |
| 123 | Ga0105242_10044455 | 3300009176 | Bacteria | 3597 |
| 124 | Ga0105242_10092405 | 3300009176 | Bacteria | 2549 |
| 125 | Ga0105242_10210534 | 3300009176 | Bacteria | 1732 |
| 126 | Ga0105248_10015636 | 3300009177 | Bacteria | 8365 |
| 127 | Ga0105248_10049140 | 3300009177 | Bacteria | 4731 |
| 128 | Ga0105248_10188646 | 3300009177 | Bacteria | 2323 |
| 129 | Ga0105237_10069374 | 3300009545 | Bacteria | 3521 |
| 130 | Ga0105238_10020297 | 3300009551 | Bacteria | 6764 |
| 131 | Ga0105249_10132449 | 3300009553 | Unclassified | 2381 |
| 132 | Ga0105239_10160051 | 3300010375 | Bacteria | 2515 |
| 133 | Ga0105246_10006723 | 3300011119 | Bacteria | 7032 |
| 134 | Ga0157371_10017112 | 3300013102 | Bacteria | 5394 |
| 135 | Ga0157369_10006794 | 3300013105 | Bacteria | 13198 |
| 136 | Ga0157378_10288756 | 3300013297 | Bacteria | 1583 |
| 137 | Ga0157372_10123711 | 3300013307 | Bacteria | 2973 |
| 138 | Ga0157372_10216778 | 3300013307 | Bacteria | 2218 |
| 139 | Ga0157375_10017496 | 3300013308 | Bacteria | 6470 |
| 140 | Ga0157375_10106025 | 3300013308 | Bacteria | 2902 |
| 141 | Ga0157380_10027047 | 3300014326 | Bacteria | 4359 |
| 142 | Ga0157380_10067401 | 3300014326 | Bacteria | 2882 |
| 143 | Ga0157380_10139239 | 3300014326 | Bacteria | 2082 |
| 144 | Ga0157380_10152034 | 3300014326 | Bacteria | 2002 |
| 145 | Ga0182008_10102982 | 3300014497 | Bacteria | 1412 |
| 146 | Ga0157377_10001103 | 3300014745 | Bacteria | 11413 |
| 147 | Ga0157377_10011153 | 3300014745 | Bacteria | 4475 |
| 148 | Ga0157377_10078350 | 3300014745 | Bacteria | 1926 |
| 149 | Ga0157379_10008081 | 3300014968 | Bacteria | 9141 |
| 150 | Ga0157376_10077670 | 3300014969 | Bacteria | 2840 |
| 151 | Ga0207656_10003507 | 3300025321 | Bacteria | 5397 |
| 152 | Ga0207688_10006456 | 3300025901 | Bacteria | 6386 |
| 153 | Ga0207688_10014316 | 3300025901 | Bacteria | 4316 |
| 154 | Ga0207688_10020209 | 3300025901 | Bacteria | 3635 |
| 155 | Ga0207643_10007509 | 3300025908 | Bacteria | 5853 |
| 156 | Ga0207643_10021347 | 3300025908 | Bacteria | 3556 |
| 157 | Ga0207643_10023433 | 3300025908 | Bacteria | 3403 |
| 158 | Ga0207705_10068188 | 3300025909 | Bacteria | 2575 |
| 159 | Ga0207707_10029572 | 3300025912 | Bacteria | 4792 |
| 160 | Ga0207707_10085135 | 3300025912 | Bacteria | 2762 |
| 161 | Ga0207695_10209089 | 3300025913 | Bacteria | 1863 |
| 162 | Ga0207693_10003381 | 3300025915 | Bacteria | 13625 |
| 163 | Ga0207693_10020809 | 3300025915 | Bacteria | 5217 |
| 164 | Ga0207660_10072694 | 3300025917 | Bacteria | 2505 |
| 165 | Ga0207657_10001794 | 3300025919 | Bacteria | 23154 |
| 166 | Ga0207657_10099959 | 3300025919 | Bacteria | 2409 |
| 167 | Ga0207657_10174377 | 3300025919 | Bacteria | 1741 |
| 168 | Ga0207649_10078646 | 3300025920 | Bacteria | 2129 |
| 169 | Ga0207646_10002005 | 3300025922 | Bacteria | 24487 |
| 170 | Ga0207659_10043385 | 3300025926 | Bacteria | 3159 |
| 171 | Ga0207659_10090236 | 3300025926 | Bacteria | 2287 |
| 172 | Ga0207687_10034605 | 3300025927 | Bacteria | 3430 |
| 173 | Ga0207687_10091149 | 3300025927 | Bacteria | 2223 |
| 174 | Ga0207687_10104506 | 3300025927 | Bacteria | 2091 |
| 175 | Ga0207687_10112746 | 3300025927 | Bacteria | 2021 |
| 176 | Ga0207687_10141873 | 3300025927 | Bacteria | 1823 |
| 177 | Ga0207664_10070710 | 3300025929 | Bacteria | 2809 |
| 178 | Ga0207690_10023941 | 3300025932 | Bacteria | 3819 |
| 179 | Ga0207690_10053127 | 3300025932 | Bacteria | 2717 |
| 180 | Ga0207690_10175842 | 3300025932 | Bacteria | 1608 |
| 181 | Ga0207706_10011588 | 3300025933 | Bacteria | 8030 |
| 182 | Ga0207706_10286735 | 3300025933 | Bacteria | 1436 |
| 183 | Ga0207709_10007091 | 3300025935 | Bacteria | 6262 |
| 184 | Ga0207709_10049474 | 3300025935 | Bacteria | 2566 |
| 185 | Ga0207709_10086722 | 3300025935 | Bacteria | 2033 |
| 186 | Ga0207670_10041340 | 3300025936 | Bacteria | 3031 |
| 187 | Ga0207669_10026415 | 3300025937 | Bacteria | 3158 |
| 188 | Ga0207669_10187183 | 3300025937 | Bacteria | 1490 |
| 189 | Ga0207704_10005121 | 3300025938 | Bacteria | 6034 |
| 190 | Ga0207665_10040055 | 3300025939 | Bacteria | 3125 |
| 191 | Ga0207665_10075307 | 3300025939 | Bacteria | 2312 |
| 192 | Ga0207691_10013165 | 3300025940 | Bacteria | 7921 |
| 193 | Ga0207691_10017360 | 3300025940 | Bacteria | 6827 |
| 194 | Ga0207691_10030454 | 3300025940 | Bacteria | 5042 |
| 195 | Ga0207691_10044533 | 3300025940 | Bacteria | 4083 |
| 196 | Ga0207661_10028201 | 3300025944 | Bacteria | 4297 |
| 197 | Ga0207661_10042650 | 3300025944 | Bacteria | 3578 |
| 198 | Ga0207661_10067624 | 3300025944 | Bacteria | 2906 |
| 199 | Ga0207661_10158291 | 3300025944 | Bacteria | 1963 |
| 200 | Ga0207679_10070433 | 3300025945 | Bacteria | 2635 |
| 201 | Ga0207679_10078048 | 3300025945 | Bacteria | 2521 |
| 202 | Ga0207667_10089796 | 3300025949 | Bacteria | 3175 |
| 203 | Ga0207667_10148028 | 3300025949 | Bacteria | 2417 |
| 204 | Ga0207651_10099287 | 3300025960 | Bacteria | 2155 |
| 205 | Ga0207677_10045244 | 3300026023 | Bacteria | 2938 |
| 206 | Ga0207678_10119192 | 3300026067 | Bacteria | 2252 |
| 207 | Ga0207708_10014002 | 3300026075 | Bacteria | 5991 |
| 208 | Ga0207708_10026930 | 3300026075 | Bacteria | 4353 |
| 209 | Ga0207708_10149137 | 3300026075 | Bacteria | 1840 |
| 210 | Ga0207702_10194218 | 3300026078 | Bacteria | 1878 |
| 211 | Ga0207648_10026892 | 3300026089 | Bacteria | 5110 |
| 212 | Ga0207648_10052325 | 3300026089 | Bacteria | 3570 |
| 213 | Ga0207648_10107984 | 3300026089 | Bacteria | 2443 |
| 214 | Ga0207676_10018726 | 3300026095 | Bacteria | 5040 |
| 215 | Ga0207676_10143098 | 3300026095 | Bacteria | 2050 |
| 216 | Ga0207674_10006224 | 3300026116 | Bacteria | 14067 |
| 217 | Ga0207674_10022232 | 3300026116 | Bacteria | 6815 |
| 218 | Ga0207674_10207808 | 3300026116 | Bacteria | 1907 |
| 219 | Ga0207675_100021504 | 3300026118 | Bacteria | 6008 |
| 220 | Ga0207683_10030661 | 3300026121 | Bacteria | 4661 |
| 221 | Ga0207683_10054072 | 3300026121 | Bacteria | 3520 |
| 222 | Ga0207683_10060892 | 3300026121 | Bacteria | 3320 |
| 223 | Ga0207698_10122525 | 3300026142 | Bacteria | 2204 |
| 224 | Ga0207428_10005251 | 3300027907 | Bacteria | 12103 |
| 225 | Ga0207428_10069888 | 3300027907 | Bacteria | 2761 |
| 226 | Ga0265338_10011280 | 3300028800 | Bacteria | 10342 |
| 227 | Ga0307416_100227496 | 3300032002 | Bacteria | 1795 |
| 228 | Ga0373945_0045584 | 3300035116 | Bacteria | 1597 |
| 229 | Ga0373960_0004898 | 3300035121 | Bacteria | 3083 |
| 230 | Ga0373943_0006499 | 3300035170 | Bacteria | 5253 |
| 231 | Ga0373943_0015850 | 3300035170 | Bacteria | 3428 |
| 232 | Ga0373946_0072099 | 3300035171 | Bacteria | 1494 |
| 233 | Ga0373931_0110374 | 3300035691 | Bacteria | 1560 |
| 234 | Ga0373935_0021657 | 3300035692 | Bacteria | 3937 |
| 235 | Ga0373947_0000630 | 3300035725 | Bacteria | 20829 |
| 236 | Ga0373947_0002931 | 3300035725 | Bacteria | 10178 |
| 237 | Ga0373937_0014753 | 3300036401 | Bacteria | 6898 |
| 238 | Ga0373937_0035790 | 3300036401 | Bacteria | 4521 |
| 239 | Ga0373925_0002999 | 3300037068 | Bacteria | 13276 |
| 240 | Ga0395899_0011234 | 3300037312 | Bacteria | 6860 |
| 241 | Ga0395899_0011270 | 3300037312 | Bacteria | 6848 |
| 242 | Ga0395899_0134294 | 3300037312 | Bacteria | 1765 |
| 243 | Ga0395900_0000871 | 3300037418 | Bacteria | 39650 |
| 244 | Ga0395900_0003522 | 3300037418 | Bacteria | 16880 |
| 245 | Ga0395900_0017254 | 3300037418 | Bacteria | 7368 |
| 246 | Ga0395900_0019495 | 3300037418 | Bacteria | 6915 |
| 247 | Ga0395900_0049400 | 3300037418 | Bacteria | 4334 |
| 248 | Ga0395900_0090607 | 3300037418 | Bacteria | 3143 |
| 249 | Ga0395900_0138474 | 3300037418 | Bacteria | 2493 |
| 250 | Ga0395900_0139910 | 3300037418 | Bacteria | 2479 |
| 251 | Ga0395898_0003184 | 3300037466 | Bacteria | 18478 |
| 252 | Ga0395898_0003281 | 3300037466 | Bacteria | 18190 |
| 253 | Ga0395898_0004735 | 3300037466 | Bacteria | 14807 |
| 254 | Ga0395898_0006337 | 3300037466 | Bacteria | 12647 |
| 255 | Ga0395898_0060617 | 3300037466 | Bacteria | 3677 |
| 256 | Ga0395898_0067937 | 3300037466 | Bacteria | 3450 |
| 257 | Ga0395898_0125928 | 3300037466 | Bacteria | 2454 |
| 258 | Ga0395898_0394417 | 3300037466 | Bacteria | 1320 |
| 259 | Ga0395905_0001130 | 3300037471 | Bacteria | 33392 |
| 260 | Ga0395905_0003149 | 3300037471 | Bacteria | 17768 |
| 261 | Ga0395905_0010165 | 3300037471 | Bacteria | 9171 |
| 262 | Ga0395905_0020534 | 3300037471 | Bacteria | 6255 |
| 263 | Ga0395905_0024990 | 3300037471 | Bacteria | 5634 |
| 264 | Ga0395905_0040099 | 3300037471 | Bacteria | 4393 |
| 265 | Ga0395901_0003580 | 3300038443 | Bacteria | 15674 |
| 266 | Ga0395901_0007152 | 3300038443 | Bacteria | 11267 |
| 267 | Ga0395901_0025698 | 3300038443 | Bacteria | 6045 |
| 268 | Ga0395901_0025839 | 3300038443 | Bacteria | 6030 |
| 269 | Ga0395901_0043903 | 3300038443 | Bacteria | 4636 |
| 270 | Ga0395901_0171876 | 3300038443 | Bacteria | 2274 |
| 271 | Ga0395901_0189350 | 3300038443 | Bacteria | 2158 |
| 272 | Ga0242420_010740 | 3300038996 | Bacteria | 1527 |
| 273 | Ga0439447_016484 | 3300041407 | Bacteria | 2027 |
| 274 | Ga0439446_0000168 | 3300042156 | Bacteria | 11484 |
| 275 | Ga0439446_0029108 | 3300042156 | Bacteria | 1593 |
| 276 | Ga0439434_0011622 | 3300042435 | Bacteria | 2603 |
| 277 | Ga0466969_0001011 | 3300044656 | Bacteria | 15226 |
| 278 | Ga0466965_0008394 | 3300044683 | Bacteria | 4779 |
| 279 | Ga0466965_0100466 | 3300044683 | Bacteria | 1479 |
| 280 | Ga0466961_0073570 | 3300044693 | Bacteria | 2167 |
| 281 | Ga0466963_0005109 | 3300044694 | Bacteria | 7664 |
| 282 | Ga0466963_0008835 | 3300044694 | Bacteria | 6049 |
| 283 | Ga0466963_0009590 | 3300044694 | Bacteria | 5835 |
| 284 | Ga0466963_0010635 | 3300044694 | Bacteria | 5579 |
| 285 | Ga0466963_0012900 | 3300044694 | Bacteria | 5121 |
| 286 | Ga0466963_0040775 | 3300044694 | Bacteria | 3043 |
| 287 | Ga0466963_0059822 | 3300044694 | Bacteria | 2543 |
| 288 | Ga0466964_0000812 | 3300044706 | Bacteria | 10208 |
| 289 | Ga0466964_0002244 | 3300044706 | Bacteria | 6851 |
| 290 | Ga0466964_0064531 | 3300044706 | Bacteria | 1532 |
| 291 | Ga0466971_0013921 | 3300044719 | Bacteria | 3536 |
| 292 | Ga0466957_0034035 | 3300044842 | Bacteria | 3057 |
| 293 | Ga0466957_0088808 | 3300044842 | Bacteria | 1934 |
| 294 | Ga0466959_0006509 | 3300045049 | Bacteria | 8097 |
| 295 | Ga0466959_0016954 | 3300045049 | Bacteria | 5332 |
| 296 | Ga0466959_0059108 | 3300045049 | Bacteria | 2792 |
| 297 | Ga0466958_0001783 | 3300045836 | Bacteria | 10439 |
| 298 | Ga0466958_0002308 | 3300045836 | Bacteria | 9512 |
| 299 | Ga0466958_0025746 | 3300045836 | Bacteria | 3471 |
| 300 | Ga0466967_0001299 | 3300045976 | Bacteria | 14243 |
| 301 | Ga0466967_0008382 | 3300045976 | Bacteria | 7566 |
| 302 | Ga0466967_0010914 | 3300045976 | Bacteria | 6846 |
| 303 | Ga0466967_0018955 | 3300045976 | Bacteria | 5520 |
| 304 | Ga0466967_0040331 | 3300045976 | Bacteria | 4018 |
| 305 | Ga0466967_0041745 | 3300045976 | Bacteria | 3958 |
| 306 | Ga0466967_0045952 | 3300045976 | Bacteria | 3798 |
| 307 | Ga0466967_0058986 | 3300045976 | Bacteria | 3394 |
| 308 | Ga0466967_0059336 | 3300045976 | Bacteria | 3386 |
| 309 | Ga0466967_0059961 | 3300045976 | Bacteria | 3370 |
| 310 | Ga0466967_0226250 | 3300045976 | Bacteria | 1780 |
| 311 | Ga0495592_0000881 | 3300046454 | Bacteria | 20811 |
| 312 | Ga0495592_0010195 | 3300046454 | Bacteria | 7084 |
| 313 | Ga0495603_0033049 | 3300046455 | Bacteria | 3113 |
| 314 | Ga0495629_0001115 | 3300046459 | Bacteria | 21246 |
| 315 | Ga0495641_0002311 | 3300046461 | Bacteria | 15176 |
| 316 | Ga0495651_0000654 | 3300046462 | Bacteria | 26784 |
| 317 | Ga0495651_0023878 | 3300046462 | Bacteria | 4755 |
| 318 | Ga0495651_0032536 | 3300046462 | Bacteria | 4067 |
| 319 | Ga0495653_0001972 | 3300046463 | Bacteria | 16161 |
| 320 | Ga0495653_0007273 | 3300046463 | Bacteria | 9070 |
| 321 | Ga0495653_0022443 | 3300046463 | Bacteria | 5108 |
| 322 | Ga0495653_0085529 | 3300046463 | Bacteria | 2320 |
| 323 | Ga0495580_0017514 | 3300046472 | Bacteria | 5356 |
| 324 | Ga0495582_0000777 | 3300046473 | Bacteria | 17673 |
| 325 | Ga0495582_0033518 | 3300046473 | Bacteria | 2823 |
| 326 | Ga0495639_0000672 | 3300046475 | Bacteria | 15755 |
| 327 | Ga0495662_0002880 | 3300046476 | Bacteria | 8704 |
| 328 | Ga0495664_0006517 | 3300046477 | Bacteria | 6452 |
| 329 | Ga0495608_0020402 | 3300046511 | Bacteria | 4555 |
| 330 | Ga0495618_0001592 | 3300046514 | Bacteria | 15151 |
| 331 | Ga0495618_0003613 | 3300046514 | Bacteria | 9582 |
| 332 | Ga0495618_0083327 | 3300046514 | Bacteria | 2043 |
| 333 | Ga0495618_0135923 | 3300046514 | Bacteria | 1573 |
| 334 | Ga0495628_0002585 | 3300046516 | Bacteria | 16279 |
| 335 | Ga0495628_0006711 | 3300046516 | Bacteria | 10035 |
| 336 | Ga0495630_0001161 | 3300046517 | Bacteria | 18180 |
| 337 | Ga0495630_0047124 | 3300046517 | Bacteria | 3223 |
| 338 | Ga0495630_0063624 | 3300046517 | Bacteria | 2771 |
| 339 | Ga0495666_0000195 | 3300046526 | Bacteria | 26154 |
| 340 | Ga0495652_0000697 | 3300046529 | Bacteria | 39018 |
| 341 | Ga0495652_0015013 | 3300046529 | Bacteria | 6938 |
| 342 | Ga0495652_0040603 | 3300046529 | Bacteria | 4021 |
| 343 | Ga0495665_0006474 | 3300046531 | Bacteria | 6324 |
| 344 | Ga0495586_0001132 | 3300046535 | Bacteria | 14987 |
| 345 | Ga0495586_0017317 | 3300046535 | Bacteria | 3831 |
| 346 | Ga0495586_0064514 | 3300046535 | Unclassified | 1996 |
| 347 | Ga0495587_0000484 | 3300046536 | Bacteria | 27661 |
| 348 | Ga0495587_0017567 | 3300046536 | Bacteria | 4443 |
| 349 | Ga0495587_0032632 | 3300046536 | Bacteria | 3147 |
| 350 | Ga0495645_0000221 | 3300046543 | Bacteria | 40987 |
| 351 | Ga0495667_0013814 | 3300046559 | Bacteria | 5453 |
| 352 | Ga0495656_0080097 | 3300046615 | Bacteria | 1472 |
| 353 | Ga0495635_0001056 | 3300046663 | Bacteria | 18244 |
| 354 | Ga0495635_0118097 | 3300046663 | Bacteria | 1810 |
| 355 | Ga0495659_0052240 | 3300046664 | Bacteria | 1491 |
| 356 | Ga0495657_0009816 | 3300046675 | Bacteria | 7227 |
| 357 | Ga0495599_0000316 | 3300046678 | Bacteria | 28843 |
| 358 | Ga0495599_0001484 | 3300046678 | Bacteria | 13459 |
| 359 | Ga0495623_0000041 | 3300046679 | Bacteria | 78481 |
| 360 | Ga0495646_0000520 | 3300046680 | Bacteria | 20619 |
| 361 | Ga0495646_0052570 | 3300046680 | Bacteria | 2460 |
| 362 | Ga0495647_0000069 | 3300046681 | Bacteria | 24849 |
| 363 | Ga0495613_0011605 | 3300046689 | Bacteria | 6547 |
| 364 | Ga0495624_0001609 | 3300046690 | Bacteria | 17333 |
| 365 | Ga0495624_0042123 | 3300046690 | Bacteria | 2918 |
| 366 | Ga0495624_0051915 | 3300046690 | Bacteria | 2593 |
| 367 | Ga0495581_0001572 | 3300047315 | Bacteria | 12736 |
| 368 | Ga0495604_0000167 | 3300047317 | Bacteria | 57533 |
| 369 | Ga0495604_0021001 | 3300047317 | Bacteria | 5210 |
| 370 | Ga0495604_0201308 | 3300047317 | Bacteria | 1381 |
| 371 | Ga0495674_0002825 | 3300047319 | Bacteria | 16877 |
| 372 | Ga0495674_0041986 | 3300047319 | Bacteria | 4083 |
| 373 | Ga0495674_0095848 | 3300047319 | Bacteria | 2529 |
| 374 | Ga0495676_0004923 | 3300047321 | Bacteria | 12248 |
| 375 | Ga0495676_0061099 | 3300047321 | Bacteria | 2949 |
| 376 | Ga0495680_0010733 | 3300047322 | Bacteria | 8164 |
| 377 | Ga0495680_0044832 | 3300047322 | Bacteria | 3494 |
| 378 | Ga0495680_0061950 | 3300047322 | Bacteria | 2877 |
| 379 | Ga0495675_0000264 | 3300047444 | Bacteria | 38010 |
| 380 | Ga0495684_0005495 | 3300047471 | Bacteria | 9864 |
| 381 | Ga0495684_0005986 | 3300047471 | Bacteria | 9449 |
| 382 | Ga0495593_0000635 | 3300047673 | Bacteria | 20129 |
| 383 | Ga0495602_0007327 | 3300048088 | Bacteria | 11550 |
| 384 | Ga0495602_0050903 | 3300048088 | Bacteria | 3696 |
| 385 | Ga0495602_0109317 | 3300048088 | Bacteria | 2249 |
| 386 | Ga0495614_0001744 | 3300048089 | Bacteria | 9495 |
| 387 | Ga0496101_0088474 | 3300048904 | Bacteria | 2300 |
| 388 | Ga0496102_0004483 | 3300048905 | Bacteria | 11786 |
| 389 | Ga0496102_0123320 | 3300048905 | Bacteria | 2421 |
| 390 | Ga0496102_0155608 | 3300048905 | Bacteria | 2149 |
| 391 | Ga0496104_0000894 | 3300048907 | Bacteria | 25656 |
| 392 | Ga0496104_0056894 | 3300048907 | Bacteria | 3700 |
| 393 | Ga0496105_0002747 | 3300048908 | Bacteria | 12843 |
| 394 | Ga0496105_0030929 | 3300048908 | Bacteria | 4388 |
| 395 | Ga0496105_0080771 | 3300048908 | Bacteria | 2686 |
| 396 | Ga0496105_0184232 | 3300048908 | Bacteria | 1709 |
| 397 | Ga0496108_0118778 | 3300048911 | Bacteria | 2267 |
| 398 | Ga0496108_0174105 | 3300048911 | Bacteria | 1862 |
| 399 | Ga0496109_0003648 | 3300048912 | Bacteria | 12867 |
| 400 | Ga0496109_0035920 | 3300048912 | Bacteria | 4473 |
| 401 | Ga0496109_0057405 | 3300048912 | Bacteria | 3553 |
| 402 | Ga0496109_0104132 | 3300048912 | Bacteria | 2635 |
| 403 | Ga0496110_0318814 | 3300048913 | Bacteria | 1416 |
| 404 | Ga0496111_0021871 | 3300048914 | Bacteria | 4470 |
| 405 | Ga0496111_0048556 | 3300048914 | Bacteria | 3057 |
| 406 | Ga0496111_0048703 | 3300048914 | Bacteria | 3053 |
| 407 | Ga0496111_0107863 | 3300048914 | Bacteria | 2050 |
| 408 | Ga0496112_0142415 | 3300048915 | Bacteria | 2367 |
| 409 | Ga0496113_0067270 | 3300048916 | Bacteria | 2716 |
| 410 | Ga0496115_0002001 | 3300048918 | Bacteria | 14568 |
| 411 | Ga0496115_0006472 | 3300048918 | Bacteria | 8587 |
| 412 | Ga0501031_0003306 | 3300049568 | Bacteria | 10347 |
| 413 | Ga0501031_0008503 | 3300049568 | Bacteria | 6680 |
| 414 | Ga0501031_0009014 | 3300049568 | Bacteria | 6493 |
| 415 | Ga0501031_0014848 | 3300049568 | Bacteria | 5062 |
| 416 | Ga0501032_0023637 | 3300049569 | Bacteria | 4243 |
| 417 | Ga0501033_0009976 | 3300049570 | Bacteria | 7292 |
| 418 | Ga0501036_0006896 | 3300049572 | Bacteria | 9233 |
| 419 | Ga0501036_0078972 | 3300049572 | Bacteria | 2784 |
| 420 | Ga0501037_0020585 | 3300049573 | Bacteria | 4871 |
| 421 | Ga0501038_0000481 | 3300049574 | Bacteria | 35069 |
| 422 | Ga0501038_0026650 | 3300049574 | Bacteria | 5146 |
| 423 | Ga0501038_0192561 | 3300049574 | Bacteria | 1640 |
| 424 | Ga0501039_0004612 | 3300049575 | Bacteria | 10422 |
| 425 | Ga0501039_0006963 | 3300049575 | Bacteria | 8608 |
| 426 | Ga0501039_0024007 | 3300049575 | Bacteria | 4682 |
| 427 | Ga0501039_0029009 | 3300049575 | Bacteria | 4260 |
| 428 | Ga0501039_0065184 | 3300049575 | Bacteria | 2825 |
| 429 | Ga0501040_0000732 | 3300049576 | Bacteria | 20290 |
| 430 | Ga0501040_0002358 | 3300049576 | Bacteria | 12127 |
| 431 | Ga0501040_0005612 | 3300049576 | Bacteria | 8107 |
| 432 | Ga0501040_0006707 | 3300049576 | Bacteria | 7467 |
| 433 | Ga0501040_0013521 | 3300049576 | Bacteria | 5366 |
| 434 | Ga0501041_0003159 | 3300049577 | Bacteria | 9474 |
| 435 | Ga0501041_0011133 | 3300049577 | Bacteria | 5311 |
| 436 | Ga0501041_0011844 | 3300049577 | Bacteria | 5161 |
| 437 | Ga0501041_0012756 | 3300049577 | Bacteria | 4980 |
| 438 | Ga0501041_0044898 | 3300049577 | Bacteria | 2685 |
| 439 | Ga0501042_0000757 | 3300049578 | Bacteria | 17568 |
| 440 | Ga0501042_0001269 | 3300049578 | Bacteria | 14695 |
| 441 | Ga0501042_0005127 | 3300049578 | Bacteria | 8409 |
| 442 | Ga0501042_0021347 | 3300049578 | Bacteria | 4511 |
| 443 | Ga0501042_0055563 | 3300049578 | Bacteria | 2826 |
| 444 | Ga0501043_0021406 | 3300049579 | Bacteria | 5069 |
| 445 | Ga0501043_0049324 | 3300049579 | Bacteria | 3310 |
| 446 | Ga0501046_0003329 | 3300049580 | Bacteria | 14773 |
| 447 | Ga0501046_0004243 | 3300049580 | Bacteria | 13046 |
| 448 | Ga0501046_0007826 | 3300049580 | Bacteria | 9378 |
| 449 | Ga0501046_0109087 | 3300049580 | Bacteria | 2116 |
| 450 | Ga0501048_0004840 | 3300049582 | Bacteria | 10261 |
| 451 | Ga0501048_0014711 | 3300049582 | Bacteria | 5789 |
| 452 | Ga0501048_0015245 | 3300049582 | Bacteria | 5677 |
| 453 | Ga0501048_0034917 | 3300049582 | Bacteria | 3623 |
| 454 | Ga0501067_0038878 | 3300049583 | Bacteria | 2642 |
| 455 | Ga0501067_0118335 | 3300049583 | Bacteria | 1474 |
| 456 | Ga0501068_0010703 | 3300049584 | Bacteria | 5157 |
| 457 | Ga0501068_0126768 | 3300049584 | Bacteria | 1594 |
| 458 | Ga0501069_0021927 | 3300049585 | Bacteria | 3470 |
| 459 | Ga0501069_0025316 | 3300049585 | Bacteria | 3242 |
| 460 | Ga0501070_0026398 | 3300049586 | Bacteria | 4872 |
| 461 | Ga0501070_0045954 | 3300049586 | Bacteria | 3631 |
| 462 | Ga0501071_0000401 | 3300049587 | Bacteria | 21407 |
| 463 | Ga0501071_0001654 | 3300049587 | Bacteria | 13066 |
| 464 | Ga0501071_0002420 | 3300049587 | Bacteria | 11313 |
| 465 | Ga0501071_0015623 | 3300049587 | Bacteria | 5212 |
| 466 | Ga0501071_0197642 | 3300049587 | Bacteria | 1510 |
| 467 | Ga0501072_0001331 | 3300049588 | Bacteria | 18519 |
| 468 | Ga0501072_0002225 | 3300049588 | Bacteria | 14491 |
| 469 | Ga0501072_0004390 | 3300049588 | Bacteria | 10705 |
| 470 | Ga0501072_0006570 | 3300049588 | Bacteria | 8854 |
| 471 | Ga0501072_0029430 | 3300049588 | Bacteria | 4290 |
| 472 | Ga0501072_0147804 | 3300049588 | Bacteria | 1874 |
| 473 | Ga0501073_0005779 | 3300049589 | Bacteria | 9247 |
| 474 | Ga0501074_0001764 | 3300049590 | Bacteria | 14771 |
| 475 | Ga0501074_0005478 | 3300049590 | Bacteria | 9132 |
| 476 | Ga0501074_0006671 | 3300049590 | Bacteria | 8338 |
| 477 | Ga0501074_0061905 | 3300049590 | Bacteria | 2696 |
| 478 | Ga0501075_0001692 | 3300049591 | Bacteria | 14490 |
| 479 | Ga0501075_0005584 | 3300049591 | Bacteria | 8603 |
| 480 | Ga0501075_0024928 | 3300049591 | Bacteria | 4391 |
| 481 | Ga0501075_0074192 | 3300049591 | Bacteria | 2573 |
| 482 | Ga0501076_0000834 | 3300049592 | Bacteria | 20025 |
| 483 | Ga0501076_0002608 | 3300049592 | Bacteria | 12408 |
| 484 | Ga0501076_0004883 | 3300049592 | Bacteria | 9585 |
| 485 | Ga0501076_0039548 | 3300049592 | Bacteria | 3702 |
| 486 | Ga0501077_0003521 | 3300049593 | Bacteria | 9404 |
| 487 | Ga0501077_0007230 | 3300049593 | Bacteria | 6849 |
| 488 | Ga0501077_0008900 | 3300049593 | Bacteria | 6229 |
| 489 | Ga0501079_0007448 | 3300049741 | Bacteria | 8280 |
| 490 | Ga0501079_0013164 | 3300049741 | Bacteria | 6305 |
| 491 | Ga0501079_0035312 | 3300049741 | Bacteria | 3848 |
| 492 | Ga0501080_0015637 | 3300049742 | Bacteria | 6997 |
| 493 | Ga0501080_0020830 | 3300049742 | Bacteria | 6069 |
| 494 | Ga0501081_0000434 | 3300049743 | Bacteria | 23110 |
| 495 | Ga0501081_0002323 | 3300049743 | Bacteria | 11977 |
| 496 | Ga0501081_0007123 | 3300049743 | Bacteria | 7267 |
| 497 | Ga0501081_0053338 | 3300049743 | Bacteria | 2791 |
| 498 | Ga0501083_0003460 | 3300049744 | Bacteria | 11037 |
| 499 | Ga0501035_0017631 | 3300049822 | Bacteria | 6587 |
| 500 | Ga0501035_0023289 | 3300049822 | Bacteria | 5680 |
| 501 | Ga0501045_0000222 | 3300049824 | Bacteria | 32828 |
| 502 | Ga0501045_0002535 | 3300049824 | Bacteria | 12439 |
| 503 | Ga0501045_0007255 | 3300049824 | Bacteria | 7697 |
| 504 | Ga0501045_0013950 | 3300049824 | Bacteria | 5687 |
| 505 | Ga0501045_0115544 | 3300049824 | Bacteria | 1990 |
| 506 | nmdc:mga05p37_204559_c1 | 3300050507 | Bacteria | 2389 |
| 507 | nmdc:mga0qj67_380_c1 | 3300050509 | Bacteria | 30607 |
| 508 | nmdc:mga08y16_108028_c1 | 3300050511 | Bacteria | 2897 |
| 509 | nmdc:mga0a205_42088_c1 | 3300050515 | Bacteria | 4400 |
| 510 | Ga0495601_0002902 | 3300053077 | Bacteria | 9751 |
| 511 | Ga0495601_0014034 | 3300053077 | Bacteria | 4825 |
| 512 | Ga0495601_0055491 | 3300053077 | Bacteria | 2508 |
| 513 | Ga0495612_0004229 | 3300053078 | Bacteria | 5958 |
| 514 | Ga0495595_0027487 | 3300053084 | Bacteria | 2535 |
| 515 | Ga0495619_0003797 | 3300053085 | Bacteria | 9715 |
| 516 | Ga0495619_0004893 | 3300053085 | Bacteria | 8508 |
| 517 | Ga0495619_0059633 | 3300053085 | Bacteria | 2535 |
| 518 | Ga0501084_0001022 | 3300054114 | Bacteria | 21691 |
| 519 | Ga0501084_0003475 | 3300054114 | Bacteria | 12798 |
| 520 | Ga0501084_0004414 | 3300054114 | Bacteria | 11476 |
| 521 | Ga0501084_0019500 | 3300054114 | Bacteria | 5649 |
| 522 | Ga0501084_0302202 | 3300054114 | Bacteria | 1352 |
| 523 | Ga0501082_0003558 | 3300060353 | Bacteria | 13604 |
| 524 | Ga0501082_0037086 | 3300060353 | Bacteria | 4200 |
| 525 | Ga0501082_0045872 | 3300060353 | Bacteria | 3768 |
| 526 | Ga0501082_0221302 | 3300060353 | Bacteria | 1647 |
| 527 | Ga0466962_0001604 | 3300061719 | Bacteria | 10591 |
| 528 | Ga0466962_0057036 | 3300061719 | Bacteria | 1865 |
| 529 | Ga0530510_0007708 | 3300061734 | Bacteria | 7497 |
| 530 | Ga0530510_0011715 | 3300061734 | Bacteria | 6154 |
| 531 | Ga0530510_0023162 | 3300061734 | Bacteria | 4422 |
| 532 | Ga0530510_0024988 | 3300061734 | Bacteria | 4270 |
| 533 | Ga0530510_0044944 | 3300061734 | Bacteria | 3191 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049584 | Ga0501068_0126768 | Ga0501068_0126768_16_1041 | 316 |
| 2 | 3300045976 | Ga0466967_0226250 | Ga0466967_0226250_614_1642 | 323 |
| 3 | 3300038443 | Ga0395901_0025839 | Ga0395901_0025839_3225_4478 | 349 |
| 4 | 3300044706 | Ga0466964_0064531 | Ga0466964_0064531_344_1456 | 349 |
| 5 | 3300049570 | Ga0501033_0009976 | Ga0501033_0009976_5491_6693 | 356 |
| 6 | 3300049574 | Ga0501038_0000481 | Ga0501038_0000481_14992_16194 | 356 |
| 7 | 3300049575 | Ga0501039_0024007 | Ga0501039_0024007_676_1878 | 356 |
| 8 | 3300049586 | Ga0501070_0026398 | Ga0501070_0026398_1105_2307 | 356 |
| 9 | 3300049587 | Ga0501071_0000401 | Ga0501071_0000401_6686_7888 | 356 |
| 10 | 3300049589 | Ga0501073_0005779 | Ga0501073_0005779_49_1251 | 356 |
| 11 | 3300049742 | Ga0501080_0020830 | Ga0501080_0020830_3136_4338 | 356 |
| 12 | 3300049824 | Ga0501045_0007255 | Ga0501045_0007255_549_1751 | 356 |
| 13 | 3300005471 | Ga0070698_100001381 | Ga0070698_10000138114 | 358 |
| 14 | 3300045049 | Ga0466959_0059108 | Ga0466959_0059108_1487_2758 | 361 |
| 15 | 3300009093 | Ga0105240_10005137 | Ga0105240_1000513712 | 362 |
| 16 | 3300009545 | Ga0105237_10069374 | Ga0105237_100693743 | 362 |
| 17 | 3300013307 | Ga0157372_10123711 | Ga0157372_101237112 | 362 |
| 18 | 3300037312 | Ga0395899_0011234 | Ga0395899_0011234_2431_3684 | 362 |
| 19 | 3300037418 | Ga0395900_0000871 | Ga0395900_0000871_10523_11776 | 362 |
| 20 | 3300037466 | Ga0395898_0003281 | Ga0395898_0003281_6516_7769 | 362 |
| 21 | 3300037471 | Ga0395905_0001130 | Ga0395905_0001130_457_1710 | 362 |
| 22 | 3300038443 | Ga0395901_0003580 | Ga0395901_0003580_2260_3513 | 362 |
| 23 | 3300005436 | Ga0070713_100388426 | Ga0070713_1003884262 | 363 |
| 24 | 3300048088 | Ga0495602_0050903 | Ga0495602_0050903_482_1639 | 363 |
| 25 | 3300025929 | Ga0207664_10070710 | Ga0207664_100707102 | 364 |
| 26 | 3300044656 | Ga0466969_0001011 | Ga0466969_0001011_1687_2958 | 364 |
| 27 | 3300047319 | Ga0495674_0095848 | Ga0495674_0095848_503_1648 | 364 |
| 28 | 3300005366 | Ga0070659_100192281 | Ga0070659_1001922812 | 365 |
| 29 | 3300005563 | Ga0068855_100425199 | Ga0068855_1004251992 | 365 |
| 30 | 3300009098 | Ga0105245_10096428 | Ga0105245_100964282 | 365 |
| 31 | 3300025901 | Ga0207688_10014316 | Ga0207688_100143162 | 365 |
| 32 | 3300025927 | Ga0207687_10091149 | Ga0207687_100911492 | 365 |
| 33 | 3300025932 | Ga0207690_10175842 | Ga0207690_101758422 | 365 |
| 34 | 3300025939 | Ga0207665_10075307 | Ga0207665_100753072 | 365 |
| 35 | 3300026023 | Ga0207677_10045244 | Ga0207677_100452442 | 365 |
| 36 | 3300037418 | Ga0395900_0139910 | Ga0395900_0139910_343_1530 | 365 |
| 37 | 3300038443 | Ga0395901_0189350 | Ga0395901_0189350_130_1317 | 365 |
| 38 | 3300049582 | Ga0501048_0015245 | Ga0501048_0015245_74_1276 | 366 |
| 39 | 3300049588 | Ga0501072_0029430 | Ga0501072_0029430_1305_2507 | 366 |
| 40 | 3300049593 | Ga0501077_0008900 | Ga0501077_0008900_626_1828 | 366 |
| 41 | 3300061734 | Ga0530510_0023162 | Ga0530510_0023162_1916_3118 | 366 |
| 42 | 3300037466 | Ga0395898_0006337 | Ga0395898_0006337_8149_9312 | 367 |
| 43 | 3300037466 | Ga0395898_0394417 | Ga0395898_0394417_80_1252 | 367 |
| 44 | 3300037471 | Ga0395905_0020534 | Ga0395905_0020534_3404_4567 | 367 |
| 45 | 3300038996 | Ga0242420_010740 | Ga0242420_010740_186_1349 | 367 |
| 46 | 3300045049 | Ga0466959_0016954 | Ga0466959_0016954_1279_2415 | 367 |
| 47 | 3300046514 | Ga0495618_0083327 | Ga0495618_0083327_535_1665 | 367 |
| 48 | 3300046517 | Ga0495630_0047124 | Ga0495630_0047124_971_2101 | 367 |
| 49 | 3300046535 | Ga0495586_0064514 | Ga0495586_0064514_639_1796 | 368 |
| 50 | 3300049568 | Ga0501031_0009014 | Ga0501031_0009014_586_1788 | 368 |
| 51 | 3300005549 | Ga0070704_100131668 | Ga0070704_1001316682 | 369 |
| 52 | 3300006175 | Ga0070712_100013822 | Ga0070712_1000138224 | 369 |
| 53 | 3300013105 | Ga0157369_10006794 | Ga0157369_1000679410 | 369 |
| 54 | 3300025915 | Ga0207693_10020809 | Ga0207693_100208094 | 369 |
| 55 | 3300046454 | Ga0495592_0010195 | Ga0495592_0010195_2139_3410 | 369 |
| 56 | 3300046516 | Ga0495628_0006711 | Ga0495628_0006711_5928_7199 | 369 |
| 57 | 3300046536 | Ga0495587_0017567 | Ga0495587_0017567_2020_3291 | 369 |
| 58 | 3300046678 | Ga0495599_0001484 | Ga0495599_0001484_3353_4624 | 369 |
| 59 | 3300047317 | Ga0495604_0021001 | Ga0495604_0021001_178_1335 | 369 |
| 60 | 3300048088 | Ga0495602_0109317 | Ga0495602_0109317_654_1925 | 369 |
| 61 | 3300053077 | Ga0495601_0055491 | Ga0495601_0055491_1293_2450 | 369 |
| 62 | 3300014745 | Ga0157377_10078350 | Ga0157377_100783502 | 370 |
| 63 | 3300044694 | Ga0466963_0012900 | Ga0466963_0012900_3775_5046 | 370 |
| 64 | 3300048905 | Ga0496102_0123320 | Ga0496102_0123320_643_1806 | 370 |
| 65 | 3300049583 | Ga0501067_0118335 | Ga0501067_0118335_253_1455 | 370 |
| 66 | 3300005439 | Ga0070711_100135890 | Ga0070711_1001358902 | 371 |
| 67 | 3300005440 | Ga0070705_100208795 | Ga0070705_1002087952 | 371 |
| 68 | 3300009148 | Ga0105243_10073915 | Ga0105243_100739152 | 371 |
| 69 | 3300014326 | Ga0157380_10152034 | Ga0157380_101520342 | 371 |
| 70 | 3300025915 | Ga0207693_10003381 | Ga0207693_1000338115 | 371 |
| 71 | 3300025939 | Ga0207665_10040055 | Ga0207665_100400552 | 371 |
| 72 | 3300048913 | Ga0496110_0318814 | Ga0496110_0318814_65_1228 | 371 |
| 73 | 3300048916 | Ga0496113_0067270 | Ga0496113_0067270_131_1294 | 371 |
| 74 | 3300005530 | Ga0070679_100031243 | Ga0070679_1000312433 | 372 |
| 75 | 3300005985 | Ga0081539_10094330 | Ga0081539_100943302 | 372 |
| 76 | 3300014497 | Ga0182008_10102982 | Ga0182008_101029821 | 372 |
| 77 | 3300025917 | Ga0207660_10072694 | Ga0207660_100726942 | 372 |
| 78 | 3300042156 | Ga0439446_0000168 | Ga0439446_0000168_4455_5690 | 372 |
| 79 | 3300042435 | Ga0439434_0011622 | Ga0439434_0011622_736_1923 | 372 |
| 80 | 3300005435 | Ga0070714_100247875 | Ga0070714_1002478751 | 373 |
| 81 | 3300028800 | Ga0265338_10011280 | Ga0265338_100112808 | 373 |
| 82 | 3300048918 | Ga0496115_0006472 | Ga0496115_0006472_4849_5979 | 373 |
| 83 | 3300005445 | Ga0070708_100010429 | Ga0070708_1000104292 | 374 |
| 84 | 3300005471 | Ga0070698_100026299 | Ga0070698_1000262994 | 374 |
| 85 | 3300009094 | Ga0111539_10048555 | Ga0111539_100485554 | 375 |
| 86 | 3300044706 | Ga0466964_0000812 | Ga0466964_0000812_8091_9233 | 375 |
| 87 | 3300006237 | Ga0097621_100196106 | Ga0097621_1001961062 | 376 |
| 88 | 3300037418 | Ga0395900_0090607 | Ga0395900_0090607_696_1859 | 376 |
| 89 | 3300037471 | Ga0395905_0040099 | Ga0395905_0040099_2569_3732 | 376 |
| 90 | 3300038443 | Ga0395901_0043903 | Ga0395901_0043903_1488_2627 | 376 |
| 91 | 3300038443 | Ga0395901_0171876 | Ga0395901_0171876_842_2056 | 376 |
| 92 | 3300005985 | Ga0081539_10010108 | Ga0081539_100101085 | 377 |
| 93 | 3300006846 | Ga0075430_100011749 | Ga0075430_1000117495 | 377 |
| 94 | 3300037312 | Ga0395899_0011270 | Ga0395899_0011270_516_1727 | 377 |
| 95 | 3300037418 | Ga0395900_0019495 | Ga0395900_0019495_551_1762 | 377 |
| 96 | 3300037466 | Ga0395898_0004735 | Ga0395898_0004735_9490_10701 | 377 |
| 97 | 3300037471 | Ga0395905_0003149 | Ga0395905_0003149_13132_14343 | 377 |
| 98 | 3300045976 | Ga0466967_0059336 | Ga0466967_0059336_1209_2357 | 377 |
| 99 | 3300049568 | Ga0501031_0008503 | Ga0501031_0008503_1490_2680 | 377 |
| 100 | 3300049574 | Ga0501038_0026650 | Ga0501038_0026650_587_1777 | 377 |
| 101 | 3300049575 | Ga0501039_0006963 | Ga0501039_0006963_4192_5382 | 377 |
| 102 | 3300049576 | Ga0501040_0005612 | Ga0501040_0005612_587_1777 | 377 |
| 103 | 3300049577 | Ga0501041_0011133 | Ga0501041_0011133_3896_5086 | 377 |
| 104 | 3300049578 | Ga0501042_0005127 | Ga0501042_0005127_2883_4073 | 377 |
| 105 | 3300049587 | Ga0501071_0001654 | Ga0501071_0001654_8831_10021 | 377 |
| 106 | 3300049588 | Ga0501072_0001331 | Ga0501072_0001331_12469_13659 | 377 |
| 107 | 3300049590 | Ga0501074_0001764 | Ga0501074_0001764_1257_2447 | 377 |
| 108 | 3300049592 | Ga0501076_0002608 | Ga0501076_0002608_5009_6199 | 377 |
| 109 | 3300049593 | Ga0501077_0003521 | Ga0501077_0003521_1590_2780 | 377 |
| 110 | 3300049741 | Ga0501079_0035312 | Ga0501079_0035312_1555_2745 | 377 |
| 111 | 3300049743 | Ga0501081_0002323 | Ga0501081_0002323_3912_5102 | 377 |
| 112 | 3300049824 | Ga0501045_0002535 | Ga0501045_0002535_7452_8642 | 377 |
| 113 | 3300050509 | nmdc:mga0qj67_380_c1 | nmdc:mga0qj67_380_c1_28220_29425 | 377 |
| 114 | 3300054114 | Ga0501084_0003475 | Ga0501084_0003475_2894_4084 | 377 |
| 115 | 3300061734 | Ga0530510_0024988 | Ga0530510_0024988_2717_3907 | 377 |
| 116 | 3300006871 | Ga0075434_100243324 | Ga0075434_1002433242 | 378 |
| 117 | 3300006881 | Ga0068865_100125424 | Ga0068865_1001254242 | 378 |
| 118 | 3300025935 | Ga0207709_10086722 | Ga0207709_100867222 | 378 |
| 119 | 3300036401 | Ga0373937_0014753 | Ga0373937_0014753_2676_3947 | 378 |
| 120 | 3300044694 | Ga0466963_0005109 | Ga0466963_0005109_5640_6911 | 378 |
| 121 | 3300046454 | Ga0495592_0000881 | Ga0495592_0000881_14339_15610 | 378 |
| 122 | 3300046462 | Ga0495651_0000654 | Ga0495651_0000654_374_1645 | 378 |
| 123 | 3300046463 | Ga0495653_0001972 | Ga0495653_0001972_8163_9434 | 378 |
| 124 | 3300046514 | Ga0495618_0001592 | Ga0495618_0001592_3970_5241 | 378 |
| 125 | 3300046516 | Ga0495628_0002585 | Ga0495628_0002585_6772_8043 | 378 |
| 126 | 3300046529 | Ga0495652_0000697 | Ga0495652_0000697_17913_19184 | 378 |
| 127 | 3300046536 | Ga0495587_0000484 | Ga0495587_0000484_23196_24467 | 378 |
| 128 | 3300046543 | Ga0495645_0000221 | Ga0495645_0000221_14575_15846 | 378 |
| 129 | 3300046678 | Ga0495599_0000316 | Ga0495599_0000316_2433_3704 | 378 |
| 130 | 3300046679 | Ga0495623_0000041 | Ga0495623_0000041_52071_53342 | 378 |
| 131 | 3300046680 | Ga0495646_0000520 | Ga0495646_0000520_13152_14423 | 378 |
| 132 | 3300047317 | Ga0495604_0000167 | Ga0495604_0000167_9091_10362 | 378 |
| 133 | 3300047322 | Ga0495680_0010733 | Ga0495680_0010733_3865_5136 | 378 |
| 134 | 3300047444 | Ga0495675_0000264 | Ga0495675_0000264_36606_37877 | 378 |
| 135 | 3300048088 | Ga0495602_0007327 | Ga0495602_0007327_9175_10446 | 378 |
| 136 | 3300053077 | Ga0495601_0002902 | Ga0495601_0002902_2165_3436 | 378 |
| 137 | 3300053084 | Ga0495595_0027487 | Ga0495595_0027487_1244_2515 | 378 |
| 138 | 3300053085 | Ga0495619_0003797 | Ga0495619_0003797_1217_2488 | 378 |
| 139 | 3300035170 | Ga0373943_0006499 | Ga0373943_0006499_1309_2463 | 380 |
| 140 | 3300035725 | Ga0373947_0002931 | Ga0373947_0002931_7805_8959 | 380 |
| 141 | 3300036401 | Ga0373937_0035790 | Ga0373937_0035790_1141_2313 | 381 |
| 142 | 3300044683 | Ga0466965_0100466 | Ga0466965_0100466_39_1310 | 381 |
| 143 | 3300044694 | Ga0466963_0008835 | Ga0466963_0008835_2141_3412 | 381 |
| 144 | 3300044842 | Ga0466957_0088808 | Ga0466957_0088808_630_1901 | 381 |
| 145 | 3300045836 | Ga0466958_0002308 | Ga0466958_0002308_5297_6568 | 381 |
| 146 | 3300045976 | Ga0466967_0001299 | Ga0466967_0001299_6762_7967 | 381 |
| 147 | 3300046462 | Ga0495651_0023878 | Ga0495651_0023878_3195_4367 | 381 |
| 148 | 3300046514 | Ga0495618_0135923 | Ga0495618_0135923_326_1498 | 381 |
| 149 | 3300046536 | Ga0495587_0032632 | Ga0495587_0032632_605_1777 | 381 |
| 150 | 3300047317 | Ga0495604_0201308 | Ga0495604_0201308_151_1323 | 381 |
| 151 | 3300047319 | Ga0495674_0041986 | Ga0495674_0041986_1610_2782 | 381 |
| 152 | 3300049744 | Ga0501083_0003460 | Ga0501083_0003460_5123_6316 | 381 |
| 153 | 3300054114 | Ga0501084_0302202 | Ga0501084_0302202_82_1293 | 381 |
| 154 | 3300005327 | Ga0070658_10014099 | Ga0070658_100140993 | 382 |
| 155 | 3300005329 | Ga0070683_100045820 | Ga0070683_1000458204 | 382 |
| 156 | 3300005336 | Ga0070680_100044204 | Ga0070680_1000442043 | 382 |
| 157 | 3300005339 | Ga0070660_100031980 | Ga0070660_1000319803 | 382 |
| 158 | 3300005341 | Ga0070691_10020134 | Ga0070691_100201342 | 382 |
| 159 | 3300005458 | Ga0070681_10054521 | Ga0070681_100545213 | 382 |
| 160 | 3300005535 | Ga0070684_100010387 | Ga0070684_1000103874 | 382 |
| 161 | 3300005614 | Ga0068856_100030508 | Ga0068856_1000305083 | 382 |
| 162 | 3300005616 | Ga0068852_100212282 | Ga0068852_1002122822 | 382 |
| 163 | 3300009098 | Ga0105245_10318920 | Ga0105245_103189202 | 382 |
| 164 | 3300025913 | Ga0207695_10209089 | Ga0207695_102090891 | 382 |
| 165 | 3300025919 | Ga0207657_10099959 | Ga0207657_100999592 | 382 |
| 166 | 3300025949 | Ga0207667_10148028 | Ga0207667_101480282 | 382 |
| 167 | 3300026142 | Ga0207698_10122525 | Ga0207698_101225252 | 382 |
| 168 | 3300035691 | Ga0373931_0110374 | Ga0373931_0110374_337_1545 | 382 |
| 169 | 3300046529 | Ga0495652_0015013 | Ga0495652_0015013_3291_4562 | 382 |
| 170 | 3300048914 | Ga0496111_0048703 | Ga0496111_0048703_1010_2287 | 382 |
| 171 | 3300053077 | Ga0495601_0014034 | Ga0495601_0014034_3369_4640 | 382 |
| 172 | 3300053078 | Ga0495612_0004229 | Ga0495612_0004229_90_1361 | 382 |
| 173 | 3300005518 | Ga0070699_100095430 | Ga0070699_1000954303 | 383 |
| 174 | 3300005535 | Ga0070684_100296988 | Ga0070684_1002969881 | 383 |
| 175 | 3300025927 | Ga0207687_10141873 | Ga0207687_101418732 | 383 |
| 176 | 3300045976 | Ga0466967_0045952 | Ga0466967_0045952_252_1460 | 384 |
| 177 | 3300046462 | Ga0495651_0032536 | Ga0495651_0032536_193_1464 | 384 |
| 178 | 3300048908 | Ga0496105_0080771 | Ga0496105_0080771_1441_2652 | 384 |
| 179 | 3300005981 | Ga0081538_10000108 | Ga0081538_1000010834 | 385 |
| 180 | 3300035116 | Ga0373945_0045584 | Ga0373945_0045584_249_1520 | 385 |
| 181 | 3300035170 | Ga0373943_0015850 | Ga0373943_0015850_843_2114 | 385 |
| 182 | 3300035171 | Ga0373946_0072099 | Ga0373946_0072099_64_1335 | 385 |
| 183 | 3300035692 | Ga0373935_0021657 | Ga0373935_0021657_1721_2992 | 385 |
| 184 | 3300035725 | Ga0373947_0000630 | Ga0373947_0000630_12776_14047 | 385 |
| 185 | 3300037068 | Ga0373925_0002999 | Ga0373925_0002999_5506_6777 | 385 |
| 186 | 3300044694 | Ga0466963_0040775 | Ga0466963_0040775_1319_2590 | 385 |
| 187 | 3300045976 | Ga0466967_0018955 | Ga0466967_0018955_3777_5048 | 385 |
| 188 | 3300046459 | Ga0495629_0001115 | Ga0495629_0001115_17822_19093 | 385 |
| 189 | 3300046461 | Ga0495641_0002311 | Ga0495641_0002311_992_2263 | 385 |
| 190 | 3300046463 | Ga0495653_0007273 | Ga0495653_0007273_3419_4690 | 385 |
| 191 | 3300046472 | Ga0495580_0017514 | Ga0495580_0017514_2988_4259 | 385 |
| 192 | 3300046473 | Ga0495582_0000777 | Ga0495582_0000777_15328_16599 | 385 |
| 193 | 3300046475 | Ga0495639_0000672 | Ga0495639_0000672_8321_9592 | 385 |
| 194 | 3300046476 | Ga0495662_0002880 | Ga0495662_0002880_6316_7587 | 385 |
| 195 | 3300046477 | Ga0495664_0006517 | Ga0495664_0006517_4235_5506 | 385 |
| 196 | 3300046514 | Ga0495618_0003613 | Ga0495618_0003613_2051_3322 | 385 |
| 197 | 3300046517 | Ga0495630_0001161 | Ga0495630_0001161_6336_7607 | 385 |
| 198 | 3300046526 | Ga0495666_0000195 | Ga0495666_0000195_12258_13529 | 385 |
| 199 | 3300046529 | Ga0495652_0040603 | Ga0495652_0040603_1070_2341 | 385 |
| 200 | 3300046531 | Ga0495665_0006474 | Ga0495665_0006474_947_2218 | 385 |
| 201 | 3300046535 | Ga0495586_0001132 | Ga0495586_0001132_12599_13870 | 385 |
| 202 | 3300046663 | Ga0495635_0001056 | Ga0495635_0001056_1118_2389 | 385 |
| 203 | 3300046680 | Ga0495646_0052570 | Ga0495646_0052570_111_1382 | 385 |
| 204 | 3300046681 | Ga0495647_0000069 | Ga0495647_0000069_12810_14081 | 385 |
| 205 | 3300046689 | Ga0495613_0011605 | Ga0495613_0011605_4256_5527 | 385 |
| 206 | 3300046690 | Ga0495624_0001609 | Ga0495624_0001609_14989_16260 | 385 |
| 207 | 3300047315 | Ga0495581_0001572 | Ga0495581_0001572_4595_5866 | 385 |
| 208 | 3300047319 | Ga0495674_0002825 | Ga0495674_0002825_6076_7347 | 385 |
| 209 | 3300047321 | Ga0495676_0004923 | Ga0495676_0004923_6871_8142 | 385 |
| 210 | 3300047322 | Ga0495680_0044832 | Ga0495680_0044832_948_2219 | 385 |
| 211 | 3300047471 | Ga0495684_0005495 | Ga0495684_0005495_1273_2544 | 385 |
| 212 | 3300047673 | Ga0495593_0000635 | Ga0495593_0000635_14603_15874 | 385 |
| 213 | 3300048089 | Ga0495614_0001744 | Ga0495614_0001744_3827_5098 | 385 |
| 214 | 3300049568 | Ga0501031_0003306 | Ga0501031_0003306_3604_4791 | 385 |
| 215 | 3300049569 | Ga0501032_0023637 | Ga0501032_0023637_1843_3030 | 385 |
| 216 | 3300049572 | Ga0501036_0006896 | Ga0501036_0006896_6187_7374 | 385 |
| 217 | 3300049573 | Ga0501037_0020585 | Ga0501037_0020585_509_1696 | 385 |
| 218 | 3300049574 | Ga0501038_0192561 | Ga0501038_0192561_261_1448 | 385 |
| 219 | 3300049575 | Ga0501039_0004612 | Ga0501039_0004612_7900_9087 | 385 |
| 220 | 3300049576 | Ga0501040_0000732 | Ga0501040_0000732_5637_6824 | 385 |
| 221 | 3300049577 | Ga0501041_0003159 | Ga0501041_0003159_403_1590 | 385 |
| 222 | 3300049578 | Ga0501042_0000757 | Ga0501042_0000757_7953_9140 | 385 |
| 223 | 3300049579 | Ga0501043_0049324 | Ga0501043_0049324_234_1421 | 385 |
| 224 | 3300049580 | Ga0501046_0004243 | Ga0501046_0004243_7990_9177 | 385 |
| 225 | 3300049582 | Ga0501048_0004840 | Ga0501048_0004840_5764_6951 | 385 |
| 226 | 3300049587 | Ga0501071_0002420 | Ga0501071_0002420_4124_5311 | 385 |
| 227 | 3300049588 | Ga0501072_0004390 | Ga0501072_0004390_5990_7177 | 385 |
| 228 | 3300049590 | Ga0501074_0005478 | Ga0501074_0005478_3185_4372 | 385 |
| 229 | 3300049591 | Ga0501075_0001692 | Ga0501075_0001692_5266_6453 | 385 |
| 230 | 3300049592 | Ga0501076_0004883 | Ga0501076_0004883_4870_6057 | 385 |
| 231 | 3300049593 | Ga0501077_0007230 | Ga0501077_0007230_3000_4187 | 385 |
| 232 | 3300049741 | Ga0501079_0007448 | Ga0501079_0007448_1023_2210 | 385 |
| 233 | 3300049742 | Ga0501080_0015637 | Ga0501080_0015637_5220_6407 | 385 |
| 234 | 3300049743 | Ga0501081_0000434 | Ga0501081_0000434_14032_15219 | 385 |
| 235 | 3300049822 | Ga0501035_0023289 | Ga0501035_0023289_3926_5113 | 385 |
| 236 | 3300049824 | Ga0501045_0000222 | Ga0501045_0000222_15330_16517 | 385 |
| 237 | 3300053085 | Ga0495619_0004893 | Ga0495619_0004893_7118_8389 | 385 |
| 238 | 3300054114 | Ga0501084_0001022 | Ga0501084_0001022_8078_9265 | 385 |
| 239 | 3300060353 | Ga0501082_0003558 | Ga0501082_0003558_12343_13530 | 385 |
| 240 | 3300061734 | Ga0530510_0007708 | Ga0530510_0007708_4894_6081 | 385 |
| 241 | 3300005366 | Ga0070659_100047429 | Ga0070659_1000474292 | 386 |
| 242 | 3300005435 | Ga0070714_100026324 | Ga0070714_1000263244 | 386 |
| 243 | 3300005518 | Ga0070699_100027096 | Ga0070699_1000270964 | 386 |
| 244 | 3300005545 | Ga0070695_100000081 | Ga0070695_1000000819 | 386 |
| 245 | 3300009094 | Ga0111539_10032300 | Ga0111539_100323002 | 386 |
| 246 | 3300013308 | Ga0157375_10106025 | Ga0157375_101060253 | 386 |
| 247 | 3300025932 | Ga0207690_10053127 | Ga0207690_100531272 | 386 |
| 248 | 3300041407 | Ga0439447_016484 | Ga0439447_016484_462_1634 | 386 |
| 249 | 3300042156 | Ga0439446_0029108 | Ga0439446_0029108_49_1221 | 386 |
| 250 | 3300046517 | Ga0495630_0063624 | Ga0495630_0063624_27_1256 | 386 |
| 251 | 3300046690 | Ga0495624_0042123 | Ga0495624_0042123_100_1278 | 386 |
| 252 | 3300048904 | Ga0496101_0088474 | Ga0496101_0088474_1096_2265 | 386 |
| 253 | 3300048905 | Ga0496102_0004483 | Ga0496102_0004483_8999_10270 | 386 |
| 254 | 3300048907 | Ga0496104_0056894 | Ga0496104_0056894_1451_2620 | 386 |
| 255 | 3300048908 | Ga0496105_0030929 | Ga0496105_0030929_2203_3372 | 386 |
| 256 | 3300005436 | Ga0070713_100087164 | Ga0070713_1000871642 | 387 |
| 257 | 3300005437 | Ga0070710_10075841 | Ga0070710_100758411 | 387 |
| 258 | 3300009147 | Ga0114129_10143396 | Ga0114129_101433962 | 387 |
| 259 | 3300048911 | Ga0496108_0118778 | Ga0496108_0118778_1056_2234 | 387 |
| 260 | 3300006175 | Ga0070712_100030830 | Ga0070712_1000308303 | 388 |
| 261 | 3300044683 | Ga0466965_0008394 | Ga0466965_0008394_2636_3907 | 388 |
| 262 | 3300044693 | Ga0466961_0073570 | Ga0466961_0073570_492_1763 | 388 |
| 263 | 3300044719 | Ga0466971_0013921 | Ga0466971_0013921_89_1360 | 388 |
| 264 | 3300045049 | Ga0466959_0006509 | Ga0466959_0006509_2357_3628 | 388 |
| 265 | 3300045836 | Ga0466958_0001783 | Ga0466958_0001783_884_2155 | 388 |
| 266 | 3300045836 | Ga0466958_0025746 | Ga0466958_0025746_1134_2405 | 388 |
| 267 | 3300046511 | Ga0495608_0020402 | Ga0495608_0020402_2987_4201 | 388 |
| 268 | 3300046559 | Ga0495667_0013814 | Ga0495667_0013814_1407_2621 | 388 |
| 269 | 3300046663 | Ga0495635_0118097 | Ga0495635_0118097_407_1657 | 388 |
| 270 | 3300046675 | Ga0495657_0009816 | Ga0495657_0009816_3303_4517 | 388 |
| 271 | 3300047471 | Ga0495684_0005986 | Ga0495684_0005986_3314_4528 | 388 |
| 272 | 3300048907 | Ga0496104_0000894 | Ga0496104_0000894_21676_22866 | 388 |
| 273 | 3300048915 | Ga0496112_0142415 | Ga0496112_0142415_1043_2314 | 388 |
| 274 | 3300053085 | Ga0495619_0059633 | Ga0495619_0059633_1190_2404 | 388 |
| 275 | 3300061719 | Ga0466962_0001604 | Ga0466962_0001604_4435_5706 | 388 |
| 276 | 3300005468 | Ga0070707_100000791 | Ga0070707_1000007916 | 389 |
| 277 | 3300025922 | Ga0207646_10002005 | Ga0207646_100020056 | 389 |
| 278 | 3300037418 | Ga0395900_0049400 | Ga0395900_0049400_566_1837 | 389 |
| 279 | 3300037466 | Ga0395898_0060617 | Ga0395898_0060617_2200_3471 | 389 |
| 280 | 3300044694 | Ga0466963_0059822 | Ga0466963_0059822_1217_2488 | 389 |
| 281 | 3300044706 | Ga0466964_0002244 | Ga0466964_0002244_4012_5283 | 389 |
| 282 | 3300044842 | Ga0466957_0034035 | Ga0466957_0034035_1587_2858 | 389 |
| 283 | 3300045976 | Ga0466967_0008382 | Ga0466967_0008382_2887_4158 | 389 |
| 284 | 3300045976 | Ga0466967_0010914 | Ga0466967_0010914_3835_5106 | 389 |
| 285 | 3300045976 | Ga0466967_0040331 | Ga0466967_0040331_2628_3899 | 389 |
| 286 | 3300046690 | Ga0495624_0051915 | Ga0495624_0051915_488_1771 | 389 |
| 287 | 3300048908 | Ga0496105_0002747 | Ga0496105_0002747_4260_5531 | 389 |
| 288 | 3300048912 | Ga0496109_0003648 | Ga0496109_0003648_7414_8685 | 389 |
| 289 | 3300048918 | Ga0496115_0002001 | Ga0496115_0002001_10402_11685 | 389 |
| 290 | 3300049588 | Ga0501072_0147804 | Ga0501072_0147804_164_1426 | 389 |
| 291 | 3300061719 | Ga0466962_0057036 | Ga0466962_0057036_223_1494 | 389 |
| 292 | 3300044694 | Ga0466963_0009590 | Ga0466963_0009590_2577_3848 | 390 |
| 293 | 3300045976 | Ga0466967_0041745 | Ga0466967_0041745_2449_3720 | 390 |
| 294 | 3300047321 | Ga0495676_0061099 | Ga0495676_0061099_1285_2640 | 390 |
| 295 | 3300005471 | Ga0070698_100280212 | Ga0070698_1002802122 | 391 |
| 296 | 3300025926 | Ga0207659_10043385 | Ga0207659_100433852 | 391 |
| 297 | 3300025944 | Ga0207661_10042650 | Ga0207661_100426503 | 391 |
| 298 | 3300026075 | Ga0207708_10149137 | Ga0207708_101491372 | 391 |
| 299 | 3300026121 | Ga0207683_10054072 | Ga0207683_100540724 | 391 |
| 300 | 3300044694 | Ga0466963_0010635 | Ga0466963_0010635_1137_2408 | 391 |
| 301 | 3300045976 | Ga0466967_0059961 | Ga0466967_0059961_386_1657 | 391 |
| 302 | 3300046615 | Ga0495656_0080097 | Ga0495656_0080097_186_1373 | 391 |
| 303 | 3300046664 | Ga0495659_0052240 | Ga0495659_0052240_118_1344 | 391 |
| 304 | 3300005548 | Ga0070665_100098125 | Ga0070665_1000981252 | 392 |
| 305 | 3300005840 | Ga0068870_10043720 | Ga0068870_100437202 | 392 |
| 306 | 3300025908 | Ga0207643_10021347 | Ga0207643_100213473 | 392 |
| 307 | 3300049572 | Ga0501036_0078972 | Ga0501036_0078972_159_1400 | 393 |
| 308 | 3300049578 | Ga0501042_0055563 | Ga0501042_0055563_229_1470 | 393 |
| 309 | 3300005364 | Ga0070673_100039726 | Ga0070673_1000397262 | 394 |
| 310 | 3300025936 | Ga0207670_10041340 | Ga0207670_100413403 | 395 |
| 311 | 3300032002 | Ga0307416_100227496 | Ga0307416_1002274962 | 395 |
| 312 | 3300046463 | Ga0495653_0022443 | Ga0495653_0022443_2578_3849 | 395 |
| 313 | 3300006847 | Ga0075431_100029045 | Ga0075431_1000290452 | 397 |
| 314 | 3300014326 | Ga0157380_10139239 | Ga0157380_101392392 | 399 |
| 315 | 3300005331 | Ga0070670_100003032 | Ga0070670_10000303213 | 400 |
| 316 | 3300005347 | Ga0070668_100129587 | Ga0070668_1001295872 | 400 |
| 317 | 3300005355 | Ga0070671_100100367 | Ga0070671_1001003672 | 400 |
| 318 | 3300005438 | Ga0070701_10095455 | Ga0070701_100954552 | 400 |
| 319 | 3300005441 | Ga0070700_100009056 | Ga0070700_1000090565 | 400 |
| 320 | 3300005549 | Ga0070704_100144345 | Ga0070704_1001443452 | 400 |
| 321 | 3300005564 | Ga0070664_100018666 | Ga0070664_1000186662 | 400 |
| 322 | 3300006846 | Ga0075430_100013382 | Ga0075430_1000133824 | 400 |
| 323 | 3300006880 | Ga0075429_100022586 | Ga0075429_1000225863 | 400 |
| 324 | 3300009094 | Ga0111539_10131600 | Ga0111539_101316002 | 400 |
| 325 | 3300009098 | Ga0105245_10004544 | Ga0105245_1000454413 | 400 |
| 326 | 3300009553 | Ga0105249_10132449 | Ga0105249_101324493 | 400 |
| 327 | 3300014745 | Ga0157377_10011153 | Ga0157377_100111534 | 400 |
| 328 | 3300025901 | Ga0207688_10006456 | Ga0207688_100064566 | 400 |
| 329 | 3300025940 | Ga0207691_10030454 | Ga0207691_100304544 | 400 |
| 330 | 3300025945 | Ga0207679_10078048 | Ga0207679_100780482 | 400 |
| 331 | 3300026121 | Ga0207683_10030661 | Ga0207683_100306612 | 400 |
| 332 | 3300027907 | Ga0207428_10005251 | Ga0207428_100052512 | 400 |
| 333 | 3300045976 | Ga0466967_0058986 | Ga0466967_0058986_2035_3306 | 400 |
| 334 | 3300048914 | Ga0496111_0021871 | Ga0496111_0021871_1848_3122 | 400 |
| 335 | 3300049576 | Ga0501040_0002358 | Ga0501040_0002358_1338_2621 | 400 |
| 336 | 3300049577 | Ga0501041_0044898 | Ga0501041_0044898_259_1542 | 400 |
| 337 | 3300049580 | Ga0501046_0007826 | Ga0501046_0007826_6276_7559 | 400 |
| 338 | 3300049585 | Ga0501069_0021927 | Ga0501069_0021927_851_2134 | 400 |
| 339 | 3300049591 | Ga0501075_0074192 | Ga0501075_0074192_402_1685 | 400 |
| 340 | 3300049743 | Ga0501081_0053338 | Ga0501081_0053338_933_2216 | 400 |
| 341 | 3300049824 | Ga0501045_0115544 | Ga0501045_0115544_449_1732 | 400 |
| 342 | 3300050511 | nmdc:mga08y16_108028_c1 | nmdc:mga08y16_108028_c1_1427_2695 | 400 |
| 343 | 3300060353 | Ga0501082_0037086 | Ga0501082_0037086_1423_2706 | 400 |
| 344 | 3300061734 | Ga0530510_0011715 | Ga0530510_0011715_1716_2999 | 400 |
| 345 | 3300005329 | Ga0070683_100025673 | Ga0070683_1000256734 | 401 |
| 346 | 3300005329 | Ga0070683_100032884 | Ga0070683_1000328842 | 401 |
| 347 | 3300005336 | Ga0070680_100004108 | Ga0070680_1000041089 | 401 |
| 348 | 3300005444 | Ga0070694_100098569 | Ga0070694_1000985692 | 401 |
| 349 | 3300005458 | Ga0070681_10018032 | Ga0070681_100180327 | 401 |
| 350 | 3300005535 | Ga0070684_100033095 | Ga0070684_1000330953 | 401 |
| 351 | 3300005549 | Ga0070704_100123157 | Ga0070704_1001231572 | 401 |
| 352 | 3300005577 | Ga0068857_100055001 | Ga0068857_1000550013 | 401 |
| 353 | 3300006881 | Ga0068865_100176864 | Ga0068865_1001768642 | 401 |
| 354 | 3300009148 | Ga0105243_10020549 | Ga0105243_100205492 | 401 |
| 355 | 3300009176 | Ga0105242_10210534 | Ga0105242_102105342 | 401 |
| 356 | 3300025937 | Ga0207669_10187183 | Ga0207669_101871832 | 401 |
| 357 | 3300025944 | Ga0207661_10067624 | Ga0207661_100676242 | 401 |
| 358 | 3300025944 | Ga0207661_10158291 | Ga0207661_101582911 | 401 |
| 359 | 3300026078 | Ga0207702_10194218 | Ga0207702_101942182 | 401 |
| 360 | 3300026116 | Ga0207674_10006224 | Ga0207674_1000622413 | 401 |
| 361 | 3300026116 | Ga0207674_10022232 | Ga0207674_100222324 | 401 |
| 362 | 3300037312 | Ga0395899_0134294 | Ga0395899_0134294_358_1584 | 401 |
| 363 | 3300037418 | Ga0395900_0003522 | Ga0395900_0003522_7158_8384 | 401 |
| 364 | 3300037418 | Ga0395900_0017254 | Ga0395900_0017254_4159_5385 | 401 |
| 365 | 3300037418 | Ga0395900_0138474 | Ga0395900_0138474_1210_2436 | 401 |
| 366 | 3300037466 | Ga0395898_0003184 | Ga0395898_0003184_8985_10211 | 401 |
| 367 | 3300037466 | Ga0395898_0067937 | Ga0395898_0067937_1278_2504 | 401 |
| 368 | 3300037466 | Ga0395898_0125928 | Ga0395898_0125928_11_1252 | 401 |
| 369 | 3300037471 | Ga0395905_0010165 | Ga0395905_0010165_344_1570 | 401 |
| 370 | 3300037471 | Ga0395905_0024990 | Ga0395905_0024990_2916_4142 | 401 |
| 371 | 3300038443 | Ga0395901_0007152 | Ga0395901_0007152_3703_4929 | 401 |
| 372 | 3300038443 | Ga0395901_0025698 | Ga0395901_0025698_3547_4773 | 401 |
| 373 | 3300046473 | Ga0495582_0033518 | Ga0495582_0033518_559_1785 | 401 |
| 374 | 3300046535 | Ga0495586_0017317 | Ga0495586_0017317_224_1450 | 401 |
| 375 | 3300048912 | Ga0496109_0057405 | Ga0496109_0057405_126_1352 | 401 |
| 376 | 3300048914 | Ga0496111_0107863 | Ga0496111_0107863_503_1729 | 401 |
| 377 | 3300050515 | nmdc:mga0a205_42088_c1 | nmdc:mga0a205_42088_c1_1057_2283 | 401 |
| 378 | 3300005354 | Ga0070675_100014504 | Ga0070675_1000145043 | 403 |
| 379 | 3300005617 | Ga0068859_100102321 | Ga0068859_1001023212 | 403 |
| 380 | 3300006931 | Ga0097620_100102328 | Ga0097620_1001023282 | 403 |
| 381 | 3300011119 | Ga0105246_10006723 | Ga0105246_100067234 | 403 |
| 382 | 3300025927 | Ga0207687_10112746 | Ga0207687_101127462 | 403 |
| 383 | 3300050507 | nmdc:mga05p37_204559_c1 | nmdc:mga05p37_204559_c1_97_1359 | 403 |
| 384 | 3300046463 | Ga0495653_0085529 | Ga0495653_0085529_22_1269 | 404 |
| 385 | 3300047322 | Ga0495680_0061950 | Ga0495680_0061950_284_1531 | 404 |
| 386 | 3300005842 | Ga0068858_100118487 | Ga0068858_1001184871 | 405 |
| 387 | 3300009148 | Ga0105243_10005927 | Ga0105243_100059278 | 405 |
| 388 | 3300014326 | Ga0157380_10027047 | Ga0157380_100270473 | 405 |
| 389 | 3300014969 | Ga0157376_10077670 | Ga0157376_100776702 | 405 |
| 390 | 3300025937 | Ga0207669_10026415 | Ga0207669_100264152 | 405 |
| 391 | 3300048912 | Ga0496109_0104132 | Ga0496109_0104132_89_1384 | 408 |
| 392 | 3300049587 | Ga0501071_0197642 | Ga0501071_0197642_180_1439 | 409 |
| 393 | 3300005441 | Ga0070700_100060947 | Ga0070700_1000609471 | 410 |
| 394 | 3300005535 | Ga0070684_100077805 | Ga0070684_1000778052 | 410 |
| 395 | 3300009176 | Ga0105242_10092405 | Ga0105242_100924053 | 410 |
| 396 | 3300025908 | Ga0207643_10023433 | Ga0207643_100234332 | 410 |
| 397 | 3300025940 | Ga0207691_10044533 | Ga0207691_100445333 | 410 |
| 398 | 3300026075 | Ga0207708_10026930 | Ga0207708_100269303 | 410 |
| 399 | 3300026089 | Ga0207648_10107984 | Ga0207648_101079841 | 410 |
| 400 | 3300026095 | Ga0207676_10143098 | Ga0207676_101430982 | 410 |
| 401 | 3300026121 | Ga0207683_10060892 | Ga0207683_100608923 | 410 |
| 402 | 3300049575 | Ga0501039_0029009 | Ga0501039_0029009_1376_2650 | 410 |
| 403 | 3300049576 | Ga0501040_0006707 | Ga0501040_0006707_4503_5777 | 410 |
| 404 | 3300049577 | Ga0501041_0011844 | Ga0501041_0011844_3483_4757 | 410 |
| 405 | 3300049578 | Ga0501042_0021347 | Ga0501042_0021347_1825_3099 | 410 |
| 406 | 3300049579 | Ga0501043_0021406 | Ga0501043_0021406_1438_2712 | 410 |
| 407 | 3300049580 | Ga0501046_0003329 | Ga0501046_0003329_1635_2909 | 410 |
| 408 | 3300049582 | Ga0501048_0034917 | Ga0501048_0034917_1879_3153 | 410 |
| 409 | 3300049584 | Ga0501068_0010703 | Ga0501068_0010703_3566_4840 | 410 |
| 410 | 3300049585 | Ga0501069_0025316 | Ga0501069_0025316_1386_2660 | 410 |
| 411 | 3300049586 | Ga0501070_0045954 | Ga0501070_0045954_751_2025 | 410 |
| 412 | 3300049587 | Ga0501071_0015623 | Ga0501071_0015623_1730_3004 | 410 |
| 413 | 3300049588 | Ga0501072_0006570 | Ga0501072_0006570_6147_7421 | 410 |
| 414 | 3300049590 | Ga0501074_0006671 | Ga0501074_0006671_2520_3794 | 410 |
| 415 | 3300049591 | Ga0501075_0005584 | Ga0501075_0005584_6759_8033 | 410 |
| 416 | 3300049592 | Ga0501076_0039548 | Ga0501076_0039548_1848_3122 | 410 |
| 417 | 3300049741 | Ga0501079_0013164 | Ga0501079_0013164_2823_4097 | 410 |
| 418 | 3300049743 | Ga0501081_0007123 | Ga0501081_0007123_3400_4674 | 410 |
| 419 | 3300049822 | Ga0501035_0017631 | Ga0501035_0017631_2941_4215 | 410 |
| 420 | 3300054114 | Ga0501084_0004414 | Ga0501084_0004414_3517_4791 | 410 |
| 421 | 3300060353 | Ga0501082_0045872 | Ga0501082_0045872_1513_2787 | 410 |
| 422 | 3300061734 | Ga0530510_0044944 | Ga0530510_0044944_676_1950 | 410 |
| 423 | 3300005329 | Ga0070683_100006309 | Ga0070683_1000063099 | 411 |
| 424 | 3300005356 | Ga0070674_100008797 | Ga0070674_1000087975 | 411 |
| 425 | 3300005543 | Ga0070672_100003935 | Ga0070672_1000039358 | 411 |
| 426 | 3300005614 | Ga0068856_100083962 | Ga0068856_1000839622 | 411 |
| 427 | 3300005834 | Ga0068851_10018278 | Ga0068851_100182783 | 411 |
| 428 | 3300014326 | Ga0157380_10067401 | Ga0157380_100674012 | 411 |
| 429 | 3300025321 | Ga0207656_10003507 | Ga0207656_100035074 | 411 |
| 430 | 3300025909 | Ga0207705_10068188 | Ga0207705_100681882 | 411 |
| 431 | 3300025920 | Ga0207649_10078646 | Ga0207649_100786461 | 411 |
| 432 | 3300025927 | Ga0207687_10104506 | Ga0207687_101045062 | 411 |
| 433 | 3300025933 | Ga0207706_10011588 | Ga0207706_100115886 | 411 |
| 434 | 3300025935 | Ga0207709_10007091 | Ga0207709_100070912 | 411 |
| 435 | 3300025945 | Ga0207679_10070433 | Ga0207679_100704332 | 411 |
| 436 | 3300026089 | Ga0207648_10026892 | Ga0207648_100268923 | 411 |
| 437 | 3300060353 | Ga0501082_0221302 | Ga0501082_0221302_320_1567 | 411 |
| 438 | 3300046455 | Ga0495603_0033049 | Ga0495603_0033049_337_1632 | 412 |
| 439 | 3300009177 | Ga0105248_10188646 | Ga0105248_101886462 | 413 |
| 440 | 3300005354 | Ga0070675_100134673 | Ga0070675_1001346731 | 415 |
| 441 | 3300009147 | Ga0114129_10172304 | Ga0114129_101723043 | 415 |
| 442 | 3300025926 | Ga0207659_10090236 | Ga0207659_100902362 | 415 |
| 443 | 3300025912 | Ga0207707_10029572 | Ga0207707_100295722 | 416 |
| 444 | 3300049583 | Ga0501067_0038878 | Ga0501067_0038878_1215_2498 | 416 |
| 445 | 3300049824 | Ga0501045_0013950 | Ga0501045_0013950_1292_2575 | 416 |
| 446 | 3300003203 | JGI25406J46586_10004654 | JGI25406J46586_100046545 | 419 |
| 447 | 3300005985 | Ga0081539_10000866 | Ga0081539_1000086658 | 419 |
| 448 | 3300026116 | Ga0207674_10207808 | Ga0207674_102078082 | 422 |
| 449 | 3300049575 | Ga0501039_0065184 | Ga0501039_0065184_1263_2546 | 422 |
| 450 | 3300009148 | Ga0105243_10004276 | Ga0105243_100042764 | 424 |
| 451 | 3300009176 | Ga0105242_10044455 | Ga0105242_100444552 | 424 |
| 452 | 3300009177 | Ga0105248_10015636 | Ga0105248_100156366 | 424 |
| 453 | 3300009551 | Ga0105238_10020297 | Ga0105238_100202972 | 424 |
| 454 | 3300010375 | Ga0105239_10160051 | Ga0105239_101600512 | 424 |
| 455 | 3300013102 | Ga0157371_10017112 | Ga0157371_100171122 | 424 |
| 456 | 3300013297 | Ga0157378_10288756 | Ga0157378_102887562 | 424 |
| 457 | 3300013307 | Ga0157372_10216778 | Ga0157372_102167782 | 424 |
| 458 | 3300013308 | Ga0157375_10017496 | Ga0157375_100174962 | 424 |
| 459 | 3300014745 | Ga0157377_10001103 | Ga0157377_100011038 | 424 |
| 460 | 3300048905 | Ga0496102_0155608 | Ga0496102_0155608_806_2080 | 424 |
| 461 | 3300002075 | JGI24738J21930_10001717 | JGI24738J21930_100017174 | 427 |
| 462 | 3300005327 | Ga0070658_10084821 | Ga0070658_100848211 | 427 |
| 463 | 3300005337 | Ga0070682_100002080 | Ga0070682_1000020801 | 427 |
| 464 | 3300005338 | Ga0068868_100005020 | Ga0068868_1000050204 | 427 |
| 465 | 3300005339 | Ga0070660_100007445 | Ga0070660_1000074455 | 427 |
| 466 | 3300005344 | Ga0070661_100016598 | Ga0070661_1000165984 | 427 |
| 467 | 3300005344 | Ga0070661_100083628 | Ga0070661_1000836282 | 427 |
| 468 | 3300005345 | Ga0070692_10065979 | Ga0070692_100659791 | 427 |
| 469 | 3300005345 | Ga0070692_10080598 | Ga0070692_100805982 | 427 |
| 470 | 3300005354 | Ga0070675_100042348 | Ga0070675_1000423481 | 427 |
| 471 | 3300005355 | Ga0070671_100251724 | Ga0070671_1002517241 | 427 |
| 472 | 3300005356 | Ga0070674_100051344 | Ga0070674_1000513442 | 427 |
| 473 | 3300005364 | Ga0070673_100004468 | Ga0070673_1000044685 | 427 |
| 474 | 3300005364 | Ga0070673_100145163 | Ga0070673_1001451631 | 427 |
| 475 | 3300005365 | Ga0070688_100102361 | Ga0070688_1001023612 | 427 |
| 476 | 3300005366 | Ga0070659_100064877 | Ga0070659_1000648772 | 427 |
| 477 | 3300005457 | Ga0070662_100063963 | Ga0070662_1000639631 | 427 |
| 478 | 3300005459 | Ga0068867_100033211 | Ga0068867_1000332111 | 427 |
| 479 | 3300005459 | Ga0068867_100052864 | Ga0068867_1000528642 | 427 |
| 480 | 3300005530 | Ga0070679_100110091 | Ga0070679_1001100912 | 427 |
| 481 | 3300005535 | Ga0070684_100011431 | Ga0070684_1000114311 | 427 |
| 482 | 3300005535 | Ga0070684_100230377 | Ga0070684_1002303772 | 427 |
| 483 | 3300005539 | Ga0068853_100005422 | Ga0068853_1000054227 | 427 |
| 484 | 3300005544 | Ga0070686_100175037 | Ga0070686_1001750371 | 427 |
| 485 | 3300005548 | Ga0070665_100224365 | Ga0070665_1002243651 | 427 |
| 486 | 3300005549 | Ga0070704_100080684 | Ga0070704_1000806842 | 427 |
| 487 | 3300005563 | Ga0068855_100150493 | Ga0068855_1001504932 | 427 |
| 488 | 3300005564 | Ga0070664_100056298 | Ga0070664_1000562982 | 427 |
| 489 | 3300005578 | Ga0068854_100061092 | Ga0068854_1000610921 | 427 |
| 490 | 3300005615 | Ga0070702_100049600 | Ga0070702_1000496002 | 427 |
| 491 | 3300006852 | Ga0075433_10117394 | Ga0075433_101173942 | 427 |
| 492 | 3300006881 | Ga0068865_100004844 | Ga0068865_1000048442 | 427 |
| 493 | 3300009094 | Ga0111539_10030514 | Ga0111539_100305142 | 427 |
| 494 | 3300009101 | Ga0105247_10022511 | Ga0105247_100225114 | 427 |
| 495 | 3300009177 | Ga0105248_10049140 | Ga0105248_100491402 | 427 |
| 496 | 3300014968 | Ga0157379_10008081 | Ga0157379_1000808110 | 427 |
| 497 | 3300025901 | Ga0207688_10020209 | Ga0207688_100202092 | 427 |
| 498 | 3300025908 | Ga0207643_10007509 | Ga0207643_100075096 | 427 |
| 499 | 3300025912 | Ga0207707_10085135 | Ga0207707_100851353 | 427 |
| 500 | 3300025919 | Ga0207657_10001794 | Ga0207657_100017942 | 427 |
| 501 | 3300025919 | Ga0207657_10174377 | Ga0207657_101743772 | 427 |
| 502 | 3300025927 | Ga0207687_10034605 | Ga0207687_100346052 | 427 |
| 503 | 3300025932 | Ga0207690_10023941 | Ga0207690_100239412 | 427 |
| 504 | 3300025933 | Ga0207706_10286735 | Ga0207706_102867352 | 427 |
| 505 | 3300025935 | Ga0207709_10049474 | Ga0207709_100494742 | 427 |
| 506 | 3300025938 | Ga0207704_10005121 | Ga0207704_100051215 | 427 |
| 507 | 3300025940 | Ga0207691_10013165 | Ga0207691_100131656 | 427 |
| 508 | 3300025940 | Ga0207691_10017360 | Ga0207691_100173605 | 427 |
| 509 | 3300025944 | Ga0207661_10028201 | Ga0207661_100282014 | 427 |
| 510 | 3300025949 | Ga0207667_10089796 | Ga0207667_100897962 | 427 |
| 511 | 3300025960 | Ga0207651_10099287 | Ga0207651_100992871 | 427 |
| 512 | 3300026067 | Ga0207678_10119192 | Ga0207678_101191922 | 427 |
| 513 | 3300026075 | Ga0207708_10014002 | Ga0207708_100140022 | 427 |
| 514 | 3300026089 | Ga0207648_10052325 | Ga0207648_100523253 | 427 |
| 515 | 3300026095 | Ga0207676_10018726 | Ga0207676_100187264 | 427 |
| 516 | 3300026118 | Ga0207675_100021504 | Ga0207675_1000215044 | 427 |
| 517 | 3300027907 | Ga0207428_10069888 | Ga0207428_100698882 | 427 |
| 518 | 3300035121 | Ga0373960_0004898 | Ga0373960_0004898_745_2028 | 427 |
| 519 | 3300048908 | Ga0496105_0184232 | Ga0496105_0184232_389_1672 | 427 |
| 520 | 3300048911 | Ga0496108_0174105 | Ga0496108_0174105_252_1535 | 427 |
| 521 | 3300048912 | Ga0496109_0035920 | Ga0496109_0035920_56_1339 | 427 |
| 522 | 3300048914 | Ga0496111_0048556 | Ga0496111_0048556_60_1343 | 427 |
| 523 | 3300049568 | Ga0501031_0014848 | Ga0501031_0014848_233_1516 | 427 |
| 524 | 3300049576 | Ga0501040_0013521 | Ga0501040_0013521_2827_4110 | 427 |
| 525 | 3300049577 | Ga0501041_0012756 | Ga0501041_0012756_3423_4706 | 427 |
| 526 | 3300049578 | Ga0501042_0001269 | Ga0501042_0001269_9921_11204 | 427 |
| 527 | 3300049580 | Ga0501046_0109087 | Ga0501046_0109087_725_2008 | 427 |
| 528 | 3300049582 | Ga0501048_0014711 | Ga0501048_0014711_3277_4560 | 427 |
| 529 | 3300049588 | Ga0501072_0002225 | Ga0501072_0002225_1286_2569 | 427 |
| 530 | 3300049590 | Ga0501074_0061905 | Ga0501074_0061905_285_1568 | 427 |
| 531 | 3300049591 | Ga0501075_0024928 | Ga0501075_0024928_106_1389 | 427 |
| 532 | 3300049592 | Ga0501076_0000834 | Ga0501076_0000834_2962_4245 | 427 |
| 533 | 3300054114 | Ga0501084_0019500 | Ga0501084_0019500_2963_4246 | 427 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3if9-assembly1.cif.gz_B-2 | crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate | 0.9746 | 4 | 33 |
| 3i3l-assembly1.cif.gz_A | crystal structure of cmls, a flavin-dependent halogenase | 0.9703 | 2 | 33 |
| 4rep-assembly1.cif.gz_A | crystal structure of gamma-carotenoid desaturase | 0.969 | 1 | 33 |
| 3ka7-assembly1.cif.gz_A | crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 | 0.9623 | 2 | 33 |
| 1c0i-assembly1.cif.gz_A | crystal structure of d-amino acid oxidase in complex with two anthranylate molecules | 0.9559 | 2 | 33 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WNY9_4_366_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9778 | 4 | 33 | 3.50.50.60 |
| af_P49086_94_556_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9599 | 3 | 33 | 3.50.50.60 |
| af_A0A1D6E7M3_47_537_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9507 | 4 | 35 | 3.50.50.60 |
| af_A0A1D6E3F3_39_301_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9498 | 2 | 34 | 3.50.50.60 |
| af_Q5VQP1_29_415_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.949 | 4 | 36 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9JRD2-F1-model_v4 | UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase | 0.9736 | 2 | 232 |
GO:0005524
GO:0005737 GO:0008360 GO:0008764 GO:0009058 GO:0051301 |
| AF-A0A538CYT9-F1-model_v4 | Mur ligase central domain-containing protein | 0.9695 | 3 | 288 |
GO:0005524
GO:0005737 GO:0008360 GO:0008764 GO:0009058 GO:0051301 |
| AF-A0A2W6CQC1-F1-model_v4 | UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase | 0.9544 | 15 | 341 |
GO:0005524
GO:0005737 GO:0008360 GO:0008764 GO:0009252 GO:0051301 |
| AF-A0A2V6WRM2-F1-model_v4 | UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase | 0.9521 | 294 | 410 |
GO:0005524
GO:0005737 GO:0008360 GO:0008764 GO:0009058 GO:0051301 |
| AF-V9G3M9-F1-model_v4 | UDP-N-acetylmuramoylalanine-D-glutamate ligase | 0.9508 | 235 | 409 |
GO:0005524
GO:0005737 GO:0008360 GO:0008764 GO:0009252 GO:0051301 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar