F460369

General Info

Members Datasets Scaffolds Average Seq Length
533 249 533 404

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100051344|Ga0070674_1000513442
Length 461
Sequence MSSHACAPFLDSVTSGTRECPWGRLGAGARTLRPVSRVLVIGLARSGRAAVSTLRAKGENVVAYDADGGLDSAGIDAEIRLGDWDDAFLDGVGTVVKSPGVPSEAPPVAAARARGIPIVSEIELGSRLLSSPLIGVTGTNGKTTTSALLGAMLETAGWNVEVAGNIGRPLTSLVGAVDDDAWVVCELSSFQLEDVETLRPRVAVLTNLEPDHLDRHGSFDAYARAKLRAFERQGPDDVAVVPQGFGRLPGNARRVEFAGDDELPAEPRIPGAHNRENAAAATAAARAIGIPDAAIAEALRTFPGVEHRIEEIATVDGVLYVNDSKATNAAATLRALASFPGRRKHVILGGRGKSEPYDLLAAALEDGDRAYLIGEAADDLAAALGAAGARFDRVETLERAVEQAASGAAAGDVVLLSPACASFDQFTSFEHRGEEFRRLVENLREWGPDDARTEGSSSSGS

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
128 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
142 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
143 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
144 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.69
Rhizosphere 95.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10001717 3300002075 Bacteria 5995
2 JGI25406J46586_10004654 3300003203 Bacteria 6389
3 Ga0070658_10014099 3300005327 Bacteria 6418
4 Ga0070658_10084821 3300005327 Bacteria 2605
5 Ga0070683_100006309 3300005329 Bacteria 9951
6 Ga0070683_100025673 3300005329 Bacteria 5294
7 Ga0070683_100032884 3300005329 Bacteria 4727
8 Ga0070683_100045820 3300005329 Bacteria 4037
9 Ga0070670_100003032 3300005331 Bacteria 13894
10 Ga0070680_100004108 3300005336 Bacteria 10903
11 Ga0070680_100044204 3300005336 Bacteria 3619
12 Ga0070682_100002080 3300005337 Bacteria 11128
13 Ga0068868_100005020 3300005338 Bacteria 9291
14 Ga0070660_100007445 3300005339 Bacteria 7628
15 Ga0070660_100031980 3300005339 Bacteria 3956
16 Ga0070691_10020134 3300005341 Bacteria 3081
17 Ga0070661_100016598 3300005344 Bacteria 5208
18 Ga0070661_100083628 3300005344 Bacteria 2358
19 Ga0070692_10065979 3300005345 Bacteria 1917
20 Ga0070692_10080598 3300005345 Bacteria 1752
21 Ga0070668_100129587 3300005347 Bacteria 2023
22 Ga0070675_100014504 3300005354 Bacteria 6215
23 Ga0070675_100042348 3300005354 Bacteria 3720
24 Ga0070675_100134673 3300005354 Bacteria 2108
25 Ga0070671_100100367 3300005355 Bacteria 2428
26 Ga0070671_100251724 3300005355 Bacteria 1501
27 Ga0070674_100008797 3300005356 Bacteria 6026
28 Ga0070674_100051344 3300005356 Bacteria 2841
29 Ga0070673_100004468 3300005364 Bacteria 8846
30 Ga0070673_100039726 3300005364 Bacteria 3604
31 Ga0070673_100145163 3300005364 Bacteria 2005
32 Ga0070688_100102361 3300005365 Bacteria 1890
33 Ga0070659_100047429 3300005366 Bacteria 3370
34 Ga0070659_100064877 3300005366 Bacteria 2891
35 Ga0070659_100192281 3300005366 Bacteria 1678
36 Ga0070714_100026324 3300005435 Bacteria 4806
37 Ga0070714_100247875 3300005435 Bacteria 1646
38 Ga0070713_100087164 3300005436 Bacteria 2677
39 Ga0070713_100388426 3300005436 Bacteria 1302
40 Ga0070710_10075841 3300005437 Bacteria 1950
41 Ga0070701_10095455 3300005438 Bacteria 1637
42 Ga0070711_100135890 3300005439 Bacteria 1837
43 Ga0070705_100208795 3300005440 Bacteria 1344
44 Ga0070700_100009056 3300005441 Bacteria 5454
45 Ga0070700_100060947 3300005441 Bacteria 2379
46 Ga0070694_100098569 3300005444 Bacteria 2064
47 Ga0070708_100010429 3300005445 Bacteria 7532
48 Ga0070662_100063963 3300005457 Bacteria 2692
49 Ga0070681_10018032 3300005458 Bacteria 7053
50 Ga0070681_10054521 3300005458 Bacteria 3984
51 Ga0068867_100033211 3300005459 Bacteria 3735
52 Ga0068867_100052864 3300005459 Bacteria 2999
53 Ga0070707_100000791 3300005468 Bacteria 31274
54 Ga0070698_100001381 3300005471 Bacteria 26903
55 Ga0070698_100026299 3300005471 Bacteria 6058
56 Ga0070698_100280212 3300005471 Bacteria 1599
57 Ga0070699_100027096 3300005518 Bacteria 4942
58 Ga0070699_100095430 3300005518 Bacteria 2604
59 Ga0070679_100031243 3300005530 Bacteria 5260
60 Ga0070679_100110091 3300005530 Bacteria 2740
61 Ga0070684_100010387 3300005535 Bacteria 7372
62 Ga0070684_100011431 3300005535 Bacteria 7074
63 Ga0070684_100033095 3300005535 Bacteria 4411
64 Ga0070684_100077805 3300005535 Bacteria 2930
65 Ga0070684_100230377 3300005535 Bacteria 1691
66 Ga0070684_100296988 3300005535 Bacteria 1482
67 Ga0068853_100005422 3300005539 Bacteria 9992
68 Ga0070672_100003935 3300005543 Bacteria 9682
69 Ga0070686_100175037 3300005544 Bacteria 1521
70 Ga0070695_100000081 3300005545 Bacteria 39746
71 Ga0070665_100098125 3300005548 Bacteria 2934
72 Ga0070665_100224365 3300005548 Bacteria 1879
73 Ga0070704_100080684 3300005549 Bacteria 2394
74 Ga0070704_100123157 3300005549 Bacteria 1996
75 Ga0070704_100131668 3300005549 Bacteria 1939
76 Ga0070704_100144345 3300005549 Bacteria 1863
77 Ga0068855_100150493 3300005563 Bacteria 2647
78 Ga0068855_100425199 3300005563 Bacteria 1452
79 Ga0070664_100018666 3300005564 Bacteria 5702
80 Ga0070664_100056298 3300005564 Bacteria 3341
81 Ga0068857_100055001 3300005577 Bacteria 3532
82 Ga0068854_100061092 3300005578 Bacteria 2728
83 Ga0068856_100030508 3300005614 Bacteria 5270
84 Ga0068856_100083962 3300005614 Bacteria 3164
85 Ga0070702_100049600 3300005615 Bacteria 2394
86 Ga0068852_100212282 3300005616 Bacteria 1837
87 Ga0068859_100102321 3300005617 Bacteria 2922
88 Ga0068851_10018278 3300005834 Bacteria 3376
89 Ga0068870_10043720 3300005840 Bacteria 2338
90 Ga0068858_100118487 3300005842 Bacteria 2475
91 Ga0081538_10000108 3300005981 Bacteria 82426
92 Ga0081539_10000866 3300005985 Bacteria 57957
93 Ga0081539_10010108 3300005985 Bacteria 7743
94 Ga0081539_10094330 3300005985 Bacteria 1540
95 Ga0070712_100013822 3300006175 Bacteria 5166
96 Ga0070712_100030830 3300006175 Bacteria 3608
97 Ga0097621_100196106 3300006237 Bacteria 1751
98 Ga0075430_100011749 3300006846 Bacteria 7455
99 Ga0075430_100013382 3300006846 Bacteria 6991
100 Ga0075431_100029045 3300006847 Bacteria 5689
101 Ga0075433_10117394 3300006852 Bacteria 2361
102 Ga0075434_100243324 3300006871 Bacteria 1819
103 Ga0075429_100022586 3300006880 Bacteria 5454
104 Ga0068865_100004844 3300006881 Bacteria 8137
105 Ga0068865_100125424 3300006881 Bacteria 1916
106 Ga0068865_100176864 3300006881 Bacteria 1641
107 Ga0097620_100102328 3300006931 Bacteria 2922
108 Ga0105240_10005137 3300009093 Bacteria 19588
109 Ga0111539_10030514 3300009094 Bacteria 6552
110 Ga0111539_10032300 3300009094 Bacteria 6357
111 Ga0111539_10048555 3300009094 Bacteria 5067
112 Ga0111539_10131600 3300009094 Bacteria 2929
113 Ga0105245_10004544 3300009098 Bacteria 12250
114 Ga0105245_10096428 3300009098 Bacteria 2729
115 Ga0105245_10318920 3300009098 Bacteria 1530
116 Ga0105247_10022511 3300009101 Bacteria 3795
117 Ga0114129_10143396 3300009147 Bacteria 3273
118 Ga0114129_10172304 3300009147 Bacteria 2949
119 Ga0105243_10004276 3300009148 Bacteria 11310
120 Ga0105243_10005927 3300009148 Bacteria 9466
121 Ga0105243_10020549 3300009148 Bacteria 5006
122 Ga0105243_10073915 3300009148 Bacteria 2763
123 Ga0105242_10044455 3300009176 Bacteria 3597
124 Ga0105242_10092405 3300009176 Bacteria 2549
125 Ga0105242_10210534 3300009176 Bacteria 1732
126 Ga0105248_10015636 3300009177 Bacteria 8365
127 Ga0105248_10049140 3300009177 Bacteria 4731
128 Ga0105248_10188646 3300009177 Bacteria 2323
129 Ga0105237_10069374 3300009545 Bacteria 3521
130 Ga0105238_10020297 3300009551 Bacteria 6764
131 Ga0105249_10132449 3300009553 Unclassified 2381
132 Ga0105239_10160051 3300010375 Bacteria 2515
133 Ga0105246_10006723 3300011119 Bacteria 7032
134 Ga0157371_10017112 3300013102 Bacteria 5394
135 Ga0157369_10006794 3300013105 Bacteria 13198
136 Ga0157378_10288756 3300013297 Bacteria 1583
137 Ga0157372_10123711 3300013307 Bacteria 2973
138 Ga0157372_10216778 3300013307 Bacteria 2218
139 Ga0157375_10017496 3300013308 Bacteria 6470
140 Ga0157375_10106025 3300013308 Bacteria 2902
141 Ga0157380_10027047 3300014326 Bacteria 4359
142 Ga0157380_10067401 3300014326 Bacteria 2882
143 Ga0157380_10139239 3300014326 Bacteria 2082
144 Ga0157380_10152034 3300014326 Bacteria 2002
145 Ga0182008_10102982 3300014497 Bacteria 1412
146 Ga0157377_10001103 3300014745 Bacteria 11413
147 Ga0157377_10011153 3300014745 Bacteria 4475
148 Ga0157377_10078350 3300014745 Bacteria 1926
149 Ga0157379_10008081 3300014968 Bacteria 9141
150 Ga0157376_10077670 3300014969 Bacteria 2840
151 Ga0207656_10003507 3300025321 Bacteria 5397
152 Ga0207688_10006456 3300025901 Bacteria 6386
153 Ga0207688_10014316 3300025901 Bacteria 4316
154 Ga0207688_10020209 3300025901 Bacteria 3635
155 Ga0207643_10007509 3300025908 Bacteria 5853
156 Ga0207643_10021347 3300025908 Bacteria 3556
157 Ga0207643_10023433 3300025908 Bacteria 3403
158 Ga0207705_10068188 3300025909 Bacteria 2575
159 Ga0207707_10029572 3300025912 Bacteria 4792
160 Ga0207707_10085135 3300025912 Bacteria 2762
161 Ga0207695_10209089 3300025913 Bacteria 1863
162 Ga0207693_10003381 3300025915 Bacteria 13625
163 Ga0207693_10020809 3300025915 Bacteria 5217
164 Ga0207660_10072694 3300025917 Bacteria 2505
165 Ga0207657_10001794 3300025919 Bacteria 23154
166 Ga0207657_10099959 3300025919 Bacteria 2409
167 Ga0207657_10174377 3300025919 Bacteria 1741
168 Ga0207649_10078646 3300025920 Bacteria 2129
169 Ga0207646_10002005 3300025922 Bacteria 24487
170 Ga0207659_10043385 3300025926 Bacteria 3159
171 Ga0207659_10090236 3300025926 Bacteria 2287
172 Ga0207687_10034605 3300025927 Bacteria 3430
173 Ga0207687_10091149 3300025927 Bacteria 2223
174 Ga0207687_10104506 3300025927 Bacteria 2091
175 Ga0207687_10112746 3300025927 Bacteria 2021
176 Ga0207687_10141873 3300025927 Bacteria 1823
177 Ga0207664_10070710 3300025929 Bacteria 2809
178 Ga0207690_10023941 3300025932 Bacteria 3819
179 Ga0207690_10053127 3300025932 Bacteria 2717
180 Ga0207690_10175842 3300025932 Bacteria 1608
181 Ga0207706_10011588 3300025933 Bacteria 8030
182 Ga0207706_10286735 3300025933 Bacteria 1436
183 Ga0207709_10007091 3300025935 Bacteria 6262
184 Ga0207709_10049474 3300025935 Bacteria 2566
185 Ga0207709_10086722 3300025935 Bacteria 2033
186 Ga0207670_10041340 3300025936 Bacteria 3031
187 Ga0207669_10026415 3300025937 Bacteria 3158
188 Ga0207669_10187183 3300025937 Bacteria 1490
189 Ga0207704_10005121 3300025938 Bacteria 6034
190 Ga0207665_10040055 3300025939 Bacteria 3125
191 Ga0207665_10075307 3300025939 Bacteria 2312
192 Ga0207691_10013165 3300025940 Bacteria 7921
193 Ga0207691_10017360 3300025940 Bacteria 6827
194 Ga0207691_10030454 3300025940 Bacteria 5042
195 Ga0207691_10044533 3300025940 Bacteria 4083
196 Ga0207661_10028201 3300025944 Bacteria 4297
197 Ga0207661_10042650 3300025944 Bacteria 3578
198 Ga0207661_10067624 3300025944 Bacteria 2906
199 Ga0207661_10158291 3300025944 Bacteria 1963
200 Ga0207679_10070433 3300025945 Bacteria 2635
201 Ga0207679_10078048 3300025945 Bacteria 2521
202 Ga0207667_10089796 3300025949 Bacteria 3175
203 Ga0207667_10148028 3300025949 Bacteria 2417
204 Ga0207651_10099287 3300025960 Bacteria 2155
205 Ga0207677_10045244 3300026023 Bacteria 2938
206 Ga0207678_10119192 3300026067 Bacteria 2252
207 Ga0207708_10014002 3300026075 Bacteria 5991
208 Ga0207708_10026930 3300026075 Bacteria 4353
209 Ga0207708_10149137 3300026075 Bacteria 1840
210 Ga0207702_10194218 3300026078 Bacteria 1878
211 Ga0207648_10026892 3300026089 Bacteria 5110
212 Ga0207648_10052325 3300026089 Bacteria 3570
213 Ga0207648_10107984 3300026089 Bacteria 2443
214 Ga0207676_10018726 3300026095 Bacteria 5040
215 Ga0207676_10143098 3300026095 Bacteria 2050
216 Ga0207674_10006224 3300026116 Bacteria 14067
217 Ga0207674_10022232 3300026116 Bacteria 6815
218 Ga0207674_10207808 3300026116 Bacteria 1907
219 Ga0207675_100021504 3300026118 Bacteria 6008
220 Ga0207683_10030661 3300026121 Bacteria 4661
221 Ga0207683_10054072 3300026121 Bacteria 3520
222 Ga0207683_10060892 3300026121 Bacteria 3320
223 Ga0207698_10122525 3300026142 Bacteria 2204
224 Ga0207428_10005251 3300027907 Bacteria 12103
225 Ga0207428_10069888 3300027907 Bacteria 2761
226 Ga0265338_10011280 3300028800 Bacteria 10342
227 Ga0307416_100227496 3300032002 Bacteria 1795
228 Ga0373945_0045584 3300035116 Bacteria 1597
229 Ga0373960_0004898 3300035121 Bacteria 3083
230 Ga0373943_0006499 3300035170 Bacteria 5253
231 Ga0373943_0015850 3300035170 Bacteria 3428
232 Ga0373946_0072099 3300035171 Bacteria 1494
233 Ga0373931_0110374 3300035691 Bacteria 1560
234 Ga0373935_0021657 3300035692 Bacteria 3937
235 Ga0373947_0000630 3300035725 Bacteria 20829
236 Ga0373947_0002931 3300035725 Bacteria 10178
237 Ga0373937_0014753 3300036401 Bacteria 6898
238 Ga0373937_0035790 3300036401 Bacteria 4521
239 Ga0373925_0002999 3300037068 Bacteria 13276
240 Ga0395899_0011234 3300037312 Bacteria 6860
241 Ga0395899_0011270 3300037312 Bacteria 6848
242 Ga0395899_0134294 3300037312 Bacteria 1765
243 Ga0395900_0000871 3300037418 Bacteria 39650
244 Ga0395900_0003522 3300037418 Bacteria 16880
245 Ga0395900_0017254 3300037418 Bacteria 7368
246 Ga0395900_0019495 3300037418 Bacteria 6915
247 Ga0395900_0049400 3300037418 Bacteria 4334
248 Ga0395900_0090607 3300037418 Bacteria 3143
249 Ga0395900_0138474 3300037418 Bacteria 2493
250 Ga0395900_0139910 3300037418 Bacteria 2479
251 Ga0395898_0003184 3300037466 Bacteria 18478
252 Ga0395898_0003281 3300037466 Bacteria 18190
253 Ga0395898_0004735 3300037466 Bacteria 14807
254 Ga0395898_0006337 3300037466 Bacteria 12647
255 Ga0395898_0060617 3300037466 Bacteria 3677
256 Ga0395898_0067937 3300037466 Bacteria 3450
257 Ga0395898_0125928 3300037466 Bacteria 2454
258 Ga0395898_0394417 3300037466 Bacteria 1320
259 Ga0395905_0001130 3300037471 Bacteria 33392
260 Ga0395905_0003149 3300037471 Bacteria 17768
261 Ga0395905_0010165 3300037471 Bacteria 9171
262 Ga0395905_0020534 3300037471 Bacteria 6255
263 Ga0395905_0024990 3300037471 Bacteria 5634
264 Ga0395905_0040099 3300037471 Bacteria 4393
265 Ga0395901_0003580 3300038443 Bacteria 15674
266 Ga0395901_0007152 3300038443 Bacteria 11267
267 Ga0395901_0025698 3300038443 Bacteria 6045
268 Ga0395901_0025839 3300038443 Bacteria 6030
269 Ga0395901_0043903 3300038443 Bacteria 4636
270 Ga0395901_0171876 3300038443 Bacteria 2274
271 Ga0395901_0189350 3300038443 Bacteria 2158
272 Ga0242420_010740 3300038996 Bacteria 1527
273 Ga0439447_016484 3300041407 Bacteria 2027
274 Ga0439446_0000168 3300042156 Bacteria 11484
275 Ga0439446_0029108 3300042156 Bacteria 1593
276 Ga0439434_0011622 3300042435 Bacteria 2603
277 Ga0466969_0001011 3300044656 Bacteria 15226
278 Ga0466965_0008394 3300044683 Bacteria 4779
279 Ga0466965_0100466 3300044683 Bacteria 1479
280 Ga0466961_0073570 3300044693 Bacteria 2167
281 Ga0466963_0005109 3300044694 Bacteria 7664
282 Ga0466963_0008835 3300044694 Bacteria 6049
283 Ga0466963_0009590 3300044694 Bacteria 5835
284 Ga0466963_0010635 3300044694 Bacteria 5579
285 Ga0466963_0012900 3300044694 Bacteria 5121
286 Ga0466963_0040775 3300044694 Bacteria 3043
287 Ga0466963_0059822 3300044694 Bacteria 2543
288 Ga0466964_0000812 3300044706 Bacteria 10208
289 Ga0466964_0002244 3300044706 Bacteria 6851
290 Ga0466964_0064531 3300044706 Bacteria 1532
291 Ga0466971_0013921 3300044719 Bacteria 3536
292 Ga0466957_0034035 3300044842 Bacteria 3057
293 Ga0466957_0088808 3300044842 Bacteria 1934
294 Ga0466959_0006509 3300045049 Bacteria 8097
295 Ga0466959_0016954 3300045049 Bacteria 5332
296 Ga0466959_0059108 3300045049 Bacteria 2792
297 Ga0466958_0001783 3300045836 Bacteria 10439
298 Ga0466958_0002308 3300045836 Bacteria 9512
299 Ga0466958_0025746 3300045836 Bacteria 3471
300 Ga0466967_0001299 3300045976 Bacteria 14243
301 Ga0466967_0008382 3300045976 Bacteria 7566
302 Ga0466967_0010914 3300045976 Bacteria 6846
303 Ga0466967_0018955 3300045976 Bacteria 5520
304 Ga0466967_0040331 3300045976 Bacteria 4018
305 Ga0466967_0041745 3300045976 Bacteria 3958
306 Ga0466967_0045952 3300045976 Bacteria 3798
307 Ga0466967_0058986 3300045976 Bacteria 3394
308 Ga0466967_0059336 3300045976 Bacteria 3386
309 Ga0466967_0059961 3300045976 Bacteria 3370
310 Ga0466967_0226250 3300045976 Bacteria 1780
311 Ga0495592_0000881 3300046454 Bacteria 20811
312 Ga0495592_0010195 3300046454 Bacteria 7084
313 Ga0495603_0033049 3300046455 Bacteria 3113
314 Ga0495629_0001115 3300046459 Bacteria 21246
315 Ga0495641_0002311 3300046461 Bacteria 15176
316 Ga0495651_0000654 3300046462 Bacteria 26784
317 Ga0495651_0023878 3300046462 Bacteria 4755
318 Ga0495651_0032536 3300046462 Bacteria 4067
319 Ga0495653_0001972 3300046463 Bacteria 16161
320 Ga0495653_0007273 3300046463 Bacteria 9070
321 Ga0495653_0022443 3300046463 Bacteria 5108
322 Ga0495653_0085529 3300046463 Bacteria 2320
323 Ga0495580_0017514 3300046472 Bacteria 5356
324 Ga0495582_0000777 3300046473 Bacteria 17673
325 Ga0495582_0033518 3300046473 Bacteria 2823
326 Ga0495639_0000672 3300046475 Bacteria 15755
327 Ga0495662_0002880 3300046476 Bacteria 8704
328 Ga0495664_0006517 3300046477 Bacteria 6452
329 Ga0495608_0020402 3300046511 Bacteria 4555
330 Ga0495618_0001592 3300046514 Bacteria 15151
331 Ga0495618_0003613 3300046514 Bacteria 9582
332 Ga0495618_0083327 3300046514 Bacteria 2043
333 Ga0495618_0135923 3300046514 Bacteria 1573
334 Ga0495628_0002585 3300046516 Bacteria 16279
335 Ga0495628_0006711 3300046516 Bacteria 10035
336 Ga0495630_0001161 3300046517 Bacteria 18180
337 Ga0495630_0047124 3300046517 Bacteria 3223
338 Ga0495630_0063624 3300046517 Bacteria 2771
339 Ga0495666_0000195 3300046526 Bacteria 26154
340 Ga0495652_0000697 3300046529 Bacteria 39018
341 Ga0495652_0015013 3300046529 Bacteria 6938
342 Ga0495652_0040603 3300046529 Bacteria 4021
343 Ga0495665_0006474 3300046531 Bacteria 6324
344 Ga0495586_0001132 3300046535 Bacteria 14987
345 Ga0495586_0017317 3300046535 Bacteria 3831
346 Ga0495586_0064514 3300046535 Unclassified 1996
347 Ga0495587_0000484 3300046536 Bacteria 27661
348 Ga0495587_0017567 3300046536 Bacteria 4443
349 Ga0495587_0032632 3300046536 Bacteria 3147
350 Ga0495645_0000221 3300046543 Bacteria 40987
351 Ga0495667_0013814 3300046559 Bacteria 5453
352 Ga0495656_0080097 3300046615 Bacteria 1472
353 Ga0495635_0001056 3300046663 Bacteria 18244
354 Ga0495635_0118097 3300046663 Bacteria 1810
355 Ga0495659_0052240 3300046664 Bacteria 1491
356 Ga0495657_0009816 3300046675 Bacteria 7227
357 Ga0495599_0000316 3300046678 Bacteria 28843
358 Ga0495599_0001484 3300046678 Bacteria 13459
359 Ga0495623_0000041 3300046679 Bacteria 78481
360 Ga0495646_0000520 3300046680 Bacteria 20619
361 Ga0495646_0052570 3300046680 Bacteria 2460
362 Ga0495647_0000069 3300046681 Bacteria 24849
363 Ga0495613_0011605 3300046689 Bacteria 6547
364 Ga0495624_0001609 3300046690 Bacteria 17333
365 Ga0495624_0042123 3300046690 Bacteria 2918
366 Ga0495624_0051915 3300046690 Bacteria 2593
367 Ga0495581_0001572 3300047315 Bacteria 12736
368 Ga0495604_0000167 3300047317 Bacteria 57533
369 Ga0495604_0021001 3300047317 Bacteria 5210
370 Ga0495604_0201308 3300047317 Bacteria 1381
371 Ga0495674_0002825 3300047319 Bacteria 16877
372 Ga0495674_0041986 3300047319 Bacteria 4083
373 Ga0495674_0095848 3300047319 Bacteria 2529
374 Ga0495676_0004923 3300047321 Bacteria 12248
375 Ga0495676_0061099 3300047321 Bacteria 2949
376 Ga0495680_0010733 3300047322 Bacteria 8164
377 Ga0495680_0044832 3300047322 Bacteria 3494
378 Ga0495680_0061950 3300047322 Bacteria 2877
379 Ga0495675_0000264 3300047444 Bacteria 38010
380 Ga0495684_0005495 3300047471 Bacteria 9864
381 Ga0495684_0005986 3300047471 Bacteria 9449
382 Ga0495593_0000635 3300047673 Bacteria 20129
383 Ga0495602_0007327 3300048088 Bacteria 11550
384 Ga0495602_0050903 3300048088 Bacteria 3696
385 Ga0495602_0109317 3300048088 Bacteria 2249
386 Ga0495614_0001744 3300048089 Bacteria 9495
387 Ga0496101_0088474 3300048904 Bacteria 2300
388 Ga0496102_0004483 3300048905 Bacteria 11786
389 Ga0496102_0123320 3300048905 Bacteria 2421
390 Ga0496102_0155608 3300048905 Bacteria 2149
391 Ga0496104_0000894 3300048907 Bacteria 25656
392 Ga0496104_0056894 3300048907 Bacteria 3700
393 Ga0496105_0002747 3300048908 Bacteria 12843
394 Ga0496105_0030929 3300048908 Bacteria 4388
395 Ga0496105_0080771 3300048908 Bacteria 2686
396 Ga0496105_0184232 3300048908 Bacteria 1709
397 Ga0496108_0118778 3300048911 Bacteria 2267
398 Ga0496108_0174105 3300048911 Bacteria 1862
399 Ga0496109_0003648 3300048912 Bacteria 12867
400 Ga0496109_0035920 3300048912 Bacteria 4473
401 Ga0496109_0057405 3300048912 Bacteria 3553
402 Ga0496109_0104132 3300048912 Bacteria 2635
403 Ga0496110_0318814 3300048913 Bacteria 1416
404 Ga0496111_0021871 3300048914 Bacteria 4470
405 Ga0496111_0048556 3300048914 Bacteria 3057
406 Ga0496111_0048703 3300048914 Bacteria 3053
407 Ga0496111_0107863 3300048914 Bacteria 2050
408 Ga0496112_0142415 3300048915 Bacteria 2367
409 Ga0496113_0067270 3300048916 Bacteria 2716
410 Ga0496115_0002001 3300048918 Bacteria 14568
411 Ga0496115_0006472 3300048918 Bacteria 8587
412 Ga0501031_0003306 3300049568 Bacteria 10347
413 Ga0501031_0008503 3300049568 Bacteria 6680
414 Ga0501031_0009014 3300049568 Bacteria 6493
415 Ga0501031_0014848 3300049568 Bacteria 5062
416 Ga0501032_0023637 3300049569 Bacteria 4243
417 Ga0501033_0009976 3300049570 Bacteria 7292
418 Ga0501036_0006896 3300049572 Bacteria 9233
419 Ga0501036_0078972 3300049572 Bacteria 2784
420 Ga0501037_0020585 3300049573 Bacteria 4871
421 Ga0501038_0000481 3300049574 Bacteria 35069
422 Ga0501038_0026650 3300049574 Bacteria 5146
423 Ga0501038_0192561 3300049574 Bacteria 1640
424 Ga0501039_0004612 3300049575 Bacteria 10422
425 Ga0501039_0006963 3300049575 Bacteria 8608
426 Ga0501039_0024007 3300049575 Bacteria 4682
427 Ga0501039_0029009 3300049575 Bacteria 4260
428 Ga0501039_0065184 3300049575 Bacteria 2825
429 Ga0501040_0000732 3300049576 Bacteria 20290
430 Ga0501040_0002358 3300049576 Bacteria 12127
431 Ga0501040_0005612 3300049576 Bacteria 8107
432 Ga0501040_0006707 3300049576 Bacteria 7467
433 Ga0501040_0013521 3300049576 Bacteria 5366
434 Ga0501041_0003159 3300049577 Bacteria 9474
435 Ga0501041_0011133 3300049577 Bacteria 5311
436 Ga0501041_0011844 3300049577 Bacteria 5161
437 Ga0501041_0012756 3300049577 Bacteria 4980
438 Ga0501041_0044898 3300049577 Bacteria 2685
439 Ga0501042_0000757 3300049578 Bacteria 17568
440 Ga0501042_0001269 3300049578 Bacteria 14695
441 Ga0501042_0005127 3300049578 Bacteria 8409
442 Ga0501042_0021347 3300049578 Bacteria 4511
443 Ga0501042_0055563 3300049578 Bacteria 2826
444 Ga0501043_0021406 3300049579 Bacteria 5069
445 Ga0501043_0049324 3300049579 Bacteria 3310
446 Ga0501046_0003329 3300049580 Bacteria 14773
447 Ga0501046_0004243 3300049580 Bacteria 13046
448 Ga0501046_0007826 3300049580 Bacteria 9378
449 Ga0501046_0109087 3300049580 Bacteria 2116
450 Ga0501048_0004840 3300049582 Bacteria 10261
451 Ga0501048_0014711 3300049582 Bacteria 5789
452 Ga0501048_0015245 3300049582 Bacteria 5677
453 Ga0501048_0034917 3300049582 Bacteria 3623
454 Ga0501067_0038878 3300049583 Bacteria 2642
455 Ga0501067_0118335 3300049583 Bacteria 1474
456 Ga0501068_0010703 3300049584 Bacteria 5157
457 Ga0501068_0126768 3300049584 Bacteria 1594
458 Ga0501069_0021927 3300049585 Bacteria 3470
459 Ga0501069_0025316 3300049585 Bacteria 3242
460 Ga0501070_0026398 3300049586 Bacteria 4872
461 Ga0501070_0045954 3300049586 Bacteria 3631
462 Ga0501071_0000401 3300049587 Bacteria 21407
463 Ga0501071_0001654 3300049587 Bacteria 13066
464 Ga0501071_0002420 3300049587 Bacteria 11313
465 Ga0501071_0015623 3300049587 Bacteria 5212
466 Ga0501071_0197642 3300049587 Bacteria 1510
467 Ga0501072_0001331 3300049588 Bacteria 18519
468 Ga0501072_0002225 3300049588 Bacteria 14491
469 Ga0501072_0004390 3300049588 Bacteria 10705
470 Ga0501072_0006570 3300049588 Bacteria 8854
471 Ga0501072_0029430 3300049588 Bacteria 4290
472 Ga0501072_0147804 3300049588 Bacteria 1874
473 Ga0501073_0005779 3300049589 Bacteria 9247
474 Ga0501074_0001764 3300049590 Bacteria 14771
475 Ga0501074_0005478 3300049590 Bacteria 9132
476 Ga0501074_0006671 3300049590 Bacteria 8338
477 Ga0501074_0061905 3300049590 Bacteria 2696
478 Ga0501075_0001692 3300049591 Bacteria 14490
479 Ga0501075_0005584 3300049591 Bacteria 8603
480 Ga0501075_0024928 3300049591 Bacteria 4391
481 Ga0501075_0074192 3300049591 Bacteria 2573
482 Ga0501076_0000834 3300049592 Bacteria 20025
483 Ga0501076_0002608 3300049592 Bacteria 12408
484 Ga0501076_0004883 3300049592 Bacteria 9585
485 Ga0501076_0039548 3300049592 Bacteria 3702
486 Ga0501077_0003521 3300049593 Bacteria 9404
487 Ga0501077_0007230 3300049593 Bacteria 6849
488 Ga0501077_0008900 3300049593 Bacteria 6229
489 Ga0501079_0007448 3300049741 Bacteria 8280
490 Ga0501079_0013164 3300049741 Bacteria 6305
491 Ga0501079_0035312 3300049741 Bacteria 3848
492 Ga0501080_0015637 3300049742 Bacteria 6997
493 Ga0501080_0020830 3300049742 Bacteria 6069
494 Ga0501081_0000434 3300049743 Bacteria 23110
495 Ga0501081_0002323 3300049743 Bacteria 11977
496 Ga0501081_0007123 3300049743 Bacteria 7267
497 Ga0501081_0053338 3300049743 Bacteria 2791
498 Ga0501083_0003460 3300049744 Bacteria 11037
499 Ga0501035_0017631 3300049822 Bacteria 6587
500 Ga0501035_0023289 3300049822 Bacteria 5680
501 Ga0501045_0000222 3300049824 Bacteria 32828
502 Ga0501045_0002535 3300049824 Bacteria 12439
503 Ga0501045_0007255 3300049824 Bacteria 7697
504 Ga0501045_0013950 3300049824 Bacteria 5687
505 Ga0501045_0115544 3300049824 Bacteria 1990
506 nmdc:mga05p37_204559_c1 3300050507 Bacteria 2389
507 nmdc:mga0qj67_380_c1 3300050509 Bacteria 30607
508 nmdc:mga08y16_108028_c1 3300050511 Bacteria 2897
509 nmdc:mga0a205_42088_c1 3300050515 Bacteria 4400
510 Ga0495601_0002902 3300053077 Bacteria 9751
511 Ga0495601_0014034 3300053077 Bacteria 4825
512 Ga0495601_0055491 3300053077 Bacteria 2508
513 Ga0495612_0004229 3300053078 Bacteria 5958
514 Ga0495595_0027487 3300053084 Bacteria 2535
515 Ga0495619_0003797 3300053085 Bacteria 9715
516 Ga0495619_0004893 3300053085 Bacteria 8508
517 Ga0495619_0059633 3300053085 Bacteria 2535
518 Ga0501084_0001022 3300054114 Bacteria 21691
519 Ga0501084_0003475 3300054114 Bacteria 12798
520 Ga0501084_0004414 3300054114 Bacteria 11476
521 Ga0501084_0019500 3300054114 Bacteria 5649
522 Ga0501084_0302202 3300054114 Bacteria 1352
523 Ga0501082_0003558 3300060353 Bacteria 13604
524 Ga0501082_0037086 3300060353 Bacteria 4200
525 Ga0501082_0045872 3300060353 Bacteria 3768
526 Ga0501082_0221302 3300060353 Bacteria 1647
527 Ga0466962_0001604 3300061719 Bacteria 10591
528 Ga0466962_0057036 3300061719 Bacteria 1865
529 Ga0530510_0007708 3300061734 Bacteria 7497
530 Ga0530510_0011715 3300061734 Bacteria 6154
531 Ga0530510_0023162 3300061734 Bacteria 4422
532 Ga0530510_0024988 3300061734 Bacteria 4270
533 Ga0530510_0044944 3300061734 Bacteria 3191

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049584 Ga0501068_0126768 Ga0501068_0126768_16_1041 316
2 3300045976 Ga0466967_0226250 Ga0466967_0226250_614_1642 323
3 3300038443 Ga0395901_0025839 Ga0395901_0025839_3225_4478 349
4 3300044706 Ga0466964_0064531 Ga0466964_0064531_344_1456 349
5 3300049570 Ga0501033_0009976 Ga0501033_0009976_5491_6693 356
6 3300049574 Ga0501038_0000481 Ga0501038_0000481_14992_16194 356
7 3300049575 Ga0501039_0024007 Ga0501039_0024007_676_1878 356
8 3300049586 Ga0501070_0026398 Ga0501070_0026398_1105_2307 356
9 3300049587 Ga0501071_0000401 Ga0501071_0000401_6686_7888 356
10 3300049589 Ga0501073_0005779 Ga0501073_0005779_49_1251 356
11 3300049742 Ga0501080_0020830 Ga0501080_0020830_3136_4338 356
12 3300049824 Ga0501045_0007255 Ga0501045_0007255_549_1751 356
13 3300005471 Ga0070698_100001381 Ga0070698_10000138114 358
14 3300045049 Ga0466959_0059108 Ga0466959_0059108_1487_2758 361
15 3300009093 Ga0105240_10005137 Ga0105240_1000513712 362
16 3300009545 Ga0105237_10069374 Ga0105237_100693743 362
17 3300013307 Ga0157372_10123711 Ga0157372_101237112 362
18 3300037312 Ga0395899_0011234 Ga0395899_0011234_2431_3684 362
19 3300037418 Ga0395900_0000871 Ga0395900_0000871_10523_11776 362
20 3300037466 Ga0395898_0003281 Ga0395898_0003281_6516_7769 362
21 3300037471 Ga0395905_0001130 Ga0395905_0001130_457_1710 362
22 3300038443 Ga0395901_0003580 Ga0395901_0003580_2260_3513 362
23 3300005436 Ga0070713_100388426 Ga0070713_1003884262 363
24 3300048088 Ga0495602_0050903 Ga0495602_0050903_482_1639 363
25 3300025929 Ga0207664_10070710 Ga0207664_100707102 364
26 3300044656 Ga0466969_0001011 Ga0466969_0001011_1687_2958 364
27 3300047319 Ga0495674_0095848 Ga0495674_0095848_503_1648 364
28 3300005366 Ga0070659_100192281 Ga0070659_1001922812 365
29 3300005563 Ga0068855_100425199 Ga0068855_1004251992 365
30 3300009098 Ga0105245_10096428 Ga0105245_100964282 365
31 3300025901 Ga0207688_10014316 Ga0207688_100143162 365
32 3300025927 Ga0207687_10091149 Ga0207687_100911492 365
33 3300025932 Ga0207690_10175842 Ga0207690_101758422 365
34 3300025939 Ga0207665_10075307 Ga0207665_100753072 365
35 3300026023 Ga0207677_10045244 Ga0207677_100452442 365
36 3300037418 Ga0395900_0139910 Ga0395900_0139910_343_1530 365
37 3300038443 Ga0395901_0189350 Ga0395901_0189350_130_1317 365
38 3300049582 Ga0501048_0015245 Ga0501048_0015245_74_1276 366
39 3300049588 Ga0501072_0029430 Ga0501072_0029430_1305_2507 366
40 3300049593 Ga0501077_0008900 Ga0501077_0008900_626_1828 366
41 3300061734 Ga0530510_0023162 Ga0530510_0023162_1916_3118 366
42 3300037466 Ga0395898_0006337 Ga0395898_0006337_8149_9312 367
43 3300037466 Ga0395898_0394417 Ga0395898_0394417_80_1252 367
44 3300037471 Ga0395905_0020534 Ga0395905_0020534_3404_4567 367
45 3300038996 Ga0242420_010740 Ga0242420_010740_186_1349 367
46 3300045049 Ga0466959_0016954 Ga0466959_0016954_1279_2415 367
47 3300046514 Ga0495618_0083327 Ga0495618_0083327_535_1665 367
48 3300046517 Ga0495630_0047124 Ga0495630_0047124_971_2101 367
49 3300046535 Ga0495586_0064514 Ga0495586_0064514_639_1796 368
50 3300049568 Ga0501031_0009014 Ga0501031_0009014_586_1788 368
51 3300005549 Ga0070704_100131668 Ga0070704_1001316682 369
52 3300006175 Ga0070712_100013822 Ga0070712_1000138224 369
53 3300013105 Ga0157369_10006794 Ga0157369_1000679410 369
54 3300025915 Ga0207693_10020809 Ga0207693_100208094 369
55 3300046454 Ga0495592_0010195 Ga0495592_0010195_2139_3410 369
56 3300046516 Ga0495628_0006711 Ga0495628_0006711_5928_7199 369
57 3300046536 Ga0495587_0017567 Ga0495587_0017567_2020_3291 369
58 3300046678 Ga0495599_0001484 Ga0495599_0001484_3353_4624 369
59 3300047317 Ga0495604_0021001 Ga0495604_0021001_178_1335 369
60 3300048088 Ga0495602_0109317 Ga0495602_0109317_654_1925 369
61 3300053077 Ga0495601_0055491 Ga0495601_0055491_1293_2450 369
62 3300014745 Ga0157377_10078350 Ga0157377_100783502 370
63 3300044694 Ga0466963_0012900 Ga0466963_0012900_3775_5046 370
64 3300048905 Ga0496102_0123320 Ga0496102_0123320_643_1806 370
65 3300049583 Ga0501067_0118335 Ga0501067_0118335_253_1455 370
66 3300005439 Ga0070711_100135890 Ga0070711_1001358902 371
67 3300005440 Ga0070705_100208795 Ga0070705_1002087952 371
68 3300009148 Ga0105243_10073915 Ga0105243_100739152 371
69 3300014326 Ga0157380_10152034 Ga0157380_101520342 371
70 3300025915 Ga0207693_10003381 Ga0207693_1000338115 371
71 3300025939 Ga0207665_10040055 Ga0207665_100400552 371
72 3300048913 Ga0496110_0318814 Ga0496110_0318814_65_1228 371
73 3300048916 Ga0496113_0067270 Ga0496113_0067270_131_1294 371
74 3300005530 Ga0070679_100031243 Ga0070679_1000312433 372
75 3300005985 Ga0081539_10094330 Ga0081539_100943302 372
76 3300014497 Ga0182008_10102982 Ga0182008_101029821 372
77 3300025917 Ga0207660_10072694 Ga0207660_100726942 372
78 3300042156 Ga0439446_0000168 Ga0439446_0000168_4455_5690 372
79 3300042435 Ga0439434_0011622 Ga0439434_0011622_736_1923 372
80 3300005435 Ga0070714_100247875 Ga0070714_1002478751 373
81 3300028800 Ga0265338_10011280 Ga0265338_100112808 373
82 3300048918 Ga0496115_0006472 Ga0496115_0006472_4849_5979 373
83 3300005445 Ga0070708_100010429 Ga0070708_1000104292 374
84 3300005471 Ga0070698_100026299 Ga0070698_1000262994 374
85 3300009094 Ga0111539_10048555 Ga0111539_100485554 375
86 3300044706 Ga0466964_0000812 Ga0466964_0000812_8091_9233 375
87 3300006237 Ga0097621_100196106 Ga0097621_1001961062 376
88 3300037418 Ga0395900_0090607 Ga0395900_0090607_696_1859 376
89 3300037471 Ga0395905_0040099 Ga0395905_0040099_2569_3732 376
90 3300038443 Ga0395901_0043903 Ga0395901_0043903_1488_2627 376
91 3300038443 Ga0395901_0171876 Ga0395901_0171876_842_2056 376
92 3300005985 Ga0081539_10010108 Ga0081539_100101085 377
93 3300006846 Ga0075430_100011749 Ga0075430_1000117495 377
94 3300037312 Ga0395899_0011270 Ga0395899_0011270_516_1727 377
95 3300037418 Ga0395900_0019495 Ga0395900_0019495_551_1762 377
96 3300037466 Ga0395898_0004735 Ga0395898_0004735_9490_10701 377
97 3300037471 Ga0395905_0003149 Ga0395905_0003149_13132_14343 377
98 3300045976 Ga0466967_0059336 Ga0466967_0059336_1209_2357 377
99 3300049568 Ga0501031_0008503 Ga0501031_0008503_1490_2680 377
100 3300049574 Ga0501038_0026650 Ga0501038_0026650_587_1777 377
101 3300049575 Ga0501039_0006963 Ga0501039_0006963_4192_5382 377
102 3300049576 Ga0501040_0005612 Ga0501040_0005612_587_1777 377
103 3300049577 Ga0501041_0011133 Ga0501041_0011133_3896_5086 377
104 3300049578 Ga0501042_0005127 Ga0501042_0005127_2883_4073 377
105 3300049587 Ga0501071_0001654 Ga0501071_0001654_8831_10021 377
106 3300049588 Ga0501072_0001331 Ga0501072_0001331_12469_13659 377
107 3300049590 Ga0501074_0001764 Ga0501074_0001764_1257_2447 377
108 3300049592 Ga0501076_0002608 Ga0501076_0002608_5009_6199 377
109 3300049593 Ga0501077_0003521 Ga0501077_0003521_1590_2780 377
110 3300049741 Ga0501079_0035312 Ga0501079_0035312_1555_2745 377
111 3300049743 Ga0501081_0002323 Ga0501081_0002323_3912_5102 377
112 3300049824 Ga0501045_0002535 Ga0501045_0002535_7452_8642 377
113 3300050509 nmdc:mga0qj67_380_c1 nmdc:mga0qj67_380_c1_28220_29425 377
114 3300054114 Ga0501084_0003475 Ga0501084_0003475_2894_4084 377
115 3300061734 Ga0530510_0024988 Ga0530510_0024988_2717_3907 377
116 3300006871 Ga0075434_100243324 Ga0075434_1002433242 378
117 3300006881 Ga0068865_100125424 Ga0068865_1001254242 378
118 3300025935 Ga0207709_10086722 Ga0207709_100867222 378
119 3300036401 Ga0373937_0014753 Ga0373937_0014753_2676_3947 378
120 3300044694 Ga0466963_0005109 Ga0466963_0005109_5640_6911 378
121 3300046454 Ga0495592_0000881 Ga0495592_0000881_14339_15610 378
122 3300046462 Ga0495651_0000654 Ga0495651_0000654_374_1645 378
123 3300046463 Ga0495653_0001972 Ga0495653_0001972_8163_9434 378
124 3300046514 Ga0495618_0001592 Ga0495618_0001592_3970_5241 378
125 3300046516 Ga0495628_0002585 Ga0495628_0002585_6772_8043 378
126 3300046529 Ga0495652_0000697 Ga0495652_0000697_17913_19184 378
127 3300046536 Ga0495587_0000484 Ga0495587_0000484_23196_24467 378
128 3300046543 Ga0495645_0000221 Ga0495645_0000221_14575_15846 378
129 3300046678 Ga0495599_0000316 Ga0495599_0000316_2433_3704 378
130 3300046679 Ga0495623_0000041 Ga0495623_0000041_52071_53342 378
131 3300046680 Ga0495646_0000520 Ga0495646_0000520_13152_14423 378
132 3300047317 Ga0495604_0000167 Ga0495604_0000167_9091_10362 378
133 3300047322 Ga0495680_0010733 Ga0495680_0010733_3865_5136 378
134 3300047444 Ga0495675_0000264 Ga0495675_0000264_36606_37877 378
135 3300048088 Ga0495602_0007327 Ga0495602_0007327_9175_10446 378
136 3300053077 Ga0495601_0002902 Ga0495601_0002902_2165_3436 378
137 3300053084 Ga0495595_0027487 Ga0495595_0027487_1244_2515 378
138 3300053085 Ga0495619_0003797 Ga0495619_0003797_1217_2488 378
139 3300035170 Ga0373943_0006499 Ga0373943_0006499_1309_2463 380
140 3300035725 Ga0373947_0002931 Ga0373947_0002931_7805_8959 380
141 3300036401 Ga0373937_0035790 Ga0373937_0035790_1141_2313 381
142 3300044683 Ga0466965_0100466 Ga0466965_0100466_39_1310 381
143 3300044694 Ga0466963_0008835 Ga0466963_0008835_2141_3412 381
144 3300044842 Ga0466957_0088808 Ga0466957_0088808_630_1901 381
145 3300045836 Ga0466958_0002308 Ga0466958_0002308_5297_6568 381
146 3300045976 Ga0466967_0001299 Ga0466967_0001299_6762_7967 381
147 3300046462 Ga0495651_0023878 Ga0495651_0023878_3195_4367 381
148 3300046514 Ga0495618_0135923 Ga0495618_0135923_326_1498 381
149 3300046536 Ga0495587_0032632 Ga0495587_0032632_605_1777 381
150 3300047317 Ga0495604_0201308 Ga0495604_0201308_151_1323 381
151 3300047319 Ga0495674_0041986 Ga0495674_0041986_1610_2782 381
152 3300049744 Ga0501083_0003460 Ga0501083_0003460_5123_6316 381
153 3300054114 Ga0501084_0302202 Ga0501084_0302202_82_1293 381
154 3300005327 Ga0070658_10014099 Ga0070658_100140993 382
155 3300005329 Ga0070683_100045820 Ga0070683_1000458204 382
156 3300005336 Ga0070680_100044204 Ga0070680_1000442043 382
157 3300005339 Ga0070660_100031980 Ga0070660_1000319803 382
158 3300005341 Ga0070691_10020134 Ga0070691_100201342 382
159 3300005458 Ga0070681_10054521 Ga0070681_100545213 382
160 3300005535 Ga0070684_100010387 Ga0070684_1000103874 382
161 3300005614 Ga0068856_100030508 Ga0068856_1000305083 382
162 3300005616 Ga0068852_100212282 Ga0068852_1002122822 382
163 3300009098 Ga0105245_10318920 Ga0105245_103189202 382
164 3300025913 Ga0207695_10209089 Ga0207695_102090891 382
165 3300025919 Ga0207657_10099959 Ga0207657_100999592 382
166 3300025949 Ga0207667_10148028 Ga0207667_101480282 382
167 3300026142 Ga0207698_10122525 Ga0207698_101225252 382
168 3300035691 Ga0373931_0110374 Ga0373931_0110374_337_1545 382
169 3300046529 Ga0495652_0015013 Ga0495652_0015013_3291_4562 382
170 3300048914 Ga0496111_0048703 Ga0496111_0048703_1010_2287 382
171 3300053077 Ga0495601_0014034 Ga0495601_0014034_3369_4640 382
172 3300053078 Ga0495612_0004229 Ga0495612_0004229_90_1361 382
173 3300005518 Ga0070699_100095430 Ga0070699_1000954303 383
174 3300005535 Ga0070684_100296988 Ga0070684_1002969881 383
175 3300025927 Ga0207687_10141873 Ga0207687_101418732 383
176 3300045976 Ga0466967_0045952 Ga0466967_0045952_252_1460 384
177 3300046462 Ga0495651_0032536 Ga0495651_0032536_193_1464 384
178 3300048908 Ga0496105_0080771 Ga0496105_0080771_1441_2652 384
179 3300005981 Ga0081538_10000108 Ga0081538_1000010834 385
180 3300035116 Ga0373945_0045584 Ga0373945_0045584_249_1520 385
181 3300035170 Ga0373943_0015850 Ga0373943_0015850_843_2114 385
182 3300035171 Ga0373946_0072099 Ga0373946_0072099_64_1335 385
183 3300035692 Ga0373935_0021657 Ga0373935_0021657_1721_2992 385
184 3300035725 Ga0373947_0000630 Ga0373947_0000630_12776_14047 385
185 3300037068 Ga0373925_0002999 Ga0373925_0002999_5506_6777 385
186 3300044694 Ga0466963_0040775 Ga0466963_0040775_1319_2590 385
187 3300045976 Ga0466967_0018955 Ga0466967_0018955_3777_5048 385
188 3300046459 Ga0495629_0001115 Ga0495629_0001115_17822_19093 385
189 3300046461 Ga0495641_0002311 Ga0495641_0002311_992_2263 385
190 3300046463 Ga0495653_0007273 Ga0495653_0007273_3419_4690 385
191 3300046472 Ga0495580_0017514 Ga0495580_0017514_2988_4259 385
192 3300046473 Ga0495582_0000777 Ga0495582_0000777_15328_16599 385
193 3300046475 Ga0495639_0000672 Ga0495639_0000672_8321_9592 385
194 3300046476 Ga0495662_0002880 Ga0495662_0002880_6316_7587 385
195 3300046477 Ga0495664_0006517 Ga0495664_0006517_4235_5506 385
196 3300046514 Ga0495618_0003613 Ga0495618_0003613_2051_3322 385
197 3300046517 Ga0495630_0001161 Ga0495630_0001161_6336_7607 385
198 3300046526 Ga0495666_0000195 Ga0495666_0000195_12258_13529 385
199 3300046529 Ga0495652_0040603 Ga0495652_0040603_1070_2341 385
200 3300046531 Ga0495665_0006474 Ga0495665_0006474_947_2218 385
201 3300046535 Ga0495586_0001132 Ga0495586_0001132_12599_13870 385
202 3300046663 Ga0495635_0001056 Ga0495635_0001056_1118_2389 385
203 3300046680 Ga0495646_0052570 Ga0495646_0052570_111_1382 385
204 3300046681 Ga0495647_0000069 Ga0495647_0000069_12810_14081 385
205 3300046689 Ga0495613_0011605 Ga0495613_0011605_4256_5527 385
206 3300046690 Ga0495624_0001609 Ga0495624_0001609_14989_16260 385
207 3300047315 Ga0495581_0001572 Ga0495581_0001572_4595_5866 385
208 3300047319 Ga0495674_0002825 Ga0495674_0002825_6076_7347 385
209 3300047321 Ga0495676_0004923 Ga0495676_0004923_6871_8142 385
210 3300047322 Ga0495680_0044832 Ga0495680_0044832_948_2219 385
211 3300047471 Ga0495684_0005495 Ga0495684_0005495_1273_2544 385
212 3300047673 Ga0495593_0000635 Ga0495593_0000635_14603_15874 385
213 3300048089 Ga0495614_0001744 Ga0495614_0001744_3827_5098 385
214 3300049568 Ga0501031_0003306 Ga0501031_0003306_3604_4791 385
215 3300049569 Ga0501032_0023637 Ga0501032_0023637_1843_3030 385
216 3300049572 Ga0501036_0006896 Ga0501036_0006896_6187_7374 385
217 3300049573 Ga0501037_0020585 Ga0501037_0020585_509_1696 385
218 3300049574 Ga0501038_0192561 Ga0501038_0192561_261_1448 385
219 3300049575 Ga0501039_0004612 Ga0501039_0004612_7900_9087 385
220 3300049576 Ga0501040_0000732 Ga0501040_0000732_5637_6824 385
221 3300049577 Ga0501041_0003159 Ga0501041_0003159_403_1590 385
222 3300049578 Ga0501042_0000757 Ga0501042_0000757_7953_9140 385
223 3300049579 Ga0501043_0049324 Ga0501043_0049324_234_1421 385
224 3300049580 Ga0501046_0004243 Ga0501046_0004243_7990_9177 385
225 3300049582 Ga0501048_0004840 Ga0501048_0004840_5764_6951 385
226 3300049587 Ga0501071_0002420 Ga0501071_0002420_4124_5311 385
227 3300049588 Ga0501072_0004390 Ga0501072_0004390_5990_7177 385
228 3300049590 Ga0501074_0005478 Ga0501074_0005478_3185_4372 385
229 3300049591 Ga0501075_0001692 Ga0501075_0001692_5266_6453 385
230 3300049592 Ga0501076_0004883 Ga0501076_0004883_4870_6057 385
231 3300049593 Ga0501077_0007230 Ga0501077_0007230_3000_4187 385
232 3300049741 Ga0501079_0007448 Ga0501079_0007448_1023_2210 385
233 3300049742 Ga0501080_0015637 Ga0501080_0015637_5220_6407 385
234 3300049743 Ga0501081_0000434 Ga0501081_0000434_14032_15219 385
235 3300049822 Ga0501035_0023289 Ga0501035_0023289_3926_5113 385
236 3300049824 Ga0501045_0000222 Ga0501045_0000222_15330_16517 385
237 3300053085 Ga0495619_0004893 Ga0495619_0004893_7118_8389 385
238 3300054114 Ga0501084_0001022 Ga0501084_0001022_8078_9265 385
239 3300060353 Ga0501082_0003558 Ga0501082_0003558_12343_13530 385
240 3300061734 Ga0530510_0007708 Ga0530510_0007708_4894_6081 385
241 3300005366 Ga0070659_100047429 Ga0070659_1000474292 386
242 3300005435 Ga0070714_100026324 Ga0070714_1000263244 386
243 3300005518 Ga0070699_100027096 Ga0070699_1000270964 386
244 3300005545 Ga0070695_100000081 Ga0070695_1000000819 386
245 3300009094 Ga0111539_10032300 Ga0111539_100323002 386
246 3300013308 Ga0157375_10106025 Ga0157375_101060253 386
247 3300025932 Ga0207690_10053127 Ga0207690_100531272 386
248 3300041407 Ga0439447_016484 Ga0439447_016484_462_1634 386
249 3300042156 Ga0439446_0029108 Ga0439446_0029108_49_1221 386
250 3300046517 Ga0495630_0063624 Ga0495630_0063624_27_1256 386
251 3300046690 Ga0495624_0042123 Ga0495624_0042123_100_1278 386
252 3300048904 Ga0496101_0088474 Ga0496101_0088474_1096_2265 386
253 3300048905 Ga0496102_0004483 Ga0496102_0004483_8999_10270 386
254 3300048907 Ga0496104_0056894 Ga0496104_0056894_1451_2620 386
255 3300048908 Ga0496105_0030929 Ga0496105_0030929_2203_3372 386
256 3300005436 Ga0070713_100087164 Ga0070713_1000871642 387
257 3300005437 Ga0070710_10075841 Ga0070710_100758411 387
258 3300009147 Ga0114129_10143396 Ga0114129_101433962 387
259 3300048911 Ga0496108_0118778 Ga0496108_0118778_1056_2234 387
260 3300006175 Ga0070712_100030830 Ga0070712_1000308303 388
261 3300044683 Ga0466965_0008394 Ga0466965_0008394_2636_3907 388
262 3300044693 Ga0466961_0073570 Ga0466961_0073570_492_1763 388
263 3300044719 Ga0466971_0013921 Ga0466971_0013921_89_1360 388
264 3300045049 Ga0466959_0006509 Ga0466959_0006509_2357_3628 388
265 3300045836 Ga0466958_0001783 Ga0466958_0001783_884_2155 388
266 3300045836 Ga0466958_0025746 Ga0466958_0025746_1134_2405 388
267 3300046511 Ga0495608_0020402 Ga0495608_0020402_2987_4201 388
268 3300046559 Ga0495667_0013814 Ga0495667_0013814_1407_2621 388
269 3300046663 Ga0495635_0118097 Ga0495635_0118097_407_1657 388
270 3300046675 Ga0495657_0009816 Ga0495657_0009816_3303_4517 388
271 3300047471 Ga0495684_0005986 Ga0495684_0005986_3314_4528 388
272 3300048907 Ga0496104_0000894 Ga0496104_0000894_21676_22866 388
273 3300048915 Ga0496112_0142415 Ga0496112_0142415_1043_2314 388
274 3300053085 Ga0495619_0059633 Ga0495619_0059633_1190_2404 388
275 3300061719 Ga0466962_0001604 Ga0466962_0001604_4435_5706 388
276 3300005468 Ga0070707_100000791 Ga0070707_1000007916 389
277 3300025922 Ga0207646_10002005 Ga0207646_100020056 389
278 3300037418 Ga0395900_0049400 Ga0395900_0049400_566_1837 389
279 3300037466 Ga0395898_0060617 Ga0395898_0060617_2200_3471 389
280 3300044694 Ga0466963_0059822 Ga0466963_0059822_1217_2488 389
281 3300044706 Ga0466964_0002244 Ga0466964_0002244_4012_5283 389
282 3300044842 Ga0466957_0034035 Ga0466957_0034035_1587_2858 389
283 3300045976 Ga0466967_0008382 Ga0466967_0008382_2887_4158 389
284 3300045976 Ga0466967_0010914 Ga0466967_0010914_3835_5106 389
285 3300045976 Ga0466967_0040331 Ga0466967_0040331_2628_3899 389
286 3300046690 Ga0495624_0051915 Ga0495624_0051915_488_1771 389
287 3300048908 Ga0496105_0002747 Ga0496105_0002747_4260_5531 389
288 3300048912 Ga0496109_0003648 Ga0496109_0003648_7414_8685 389
289 3300048918 Ga0496115_0002001 Ga0496115_0002001_10402_11685 389
290 3300049588 Ga0501072_0147804 Ga0501072_0147804_164_1426 389
291 3300061719 Ga0466962_0057036 Ga0466962_0057036_223_1494 389
292 3300044694 Ga0466963_0009590 Ga0466963_0009590_2577_3848 390
293 3300045976 Ga0466967_0041745 Ga0466967_0041745_2449_3720 390
294 3300047321 Ga0495676_0061099 Ga0495676_0061099_1285_2640 390
295 3300005471 Ga0070698_100280212 Ga0070698_1002802122 391
296 3300025926 Ga0207659_10043385 Ga0207659_100433852 391
297 3300025944 Ga0207661_10042650 Ga0207661_100426503 391
298 3300026075 Ga0207708_10149137 Ga0207708_101491372 391
299 3300026121 Ga0207683_10054072 Ga0207683_100540724 391
300 3300044694 Ga0466963_0010635 Ga0466963_0010635_1137_2408 391
301 3300045976 Ga0466967_0059961 Ga0466967_0059961_386_1657 391
302 3300046615 Ga0495656_0080097 Ga0495656_0080097_186_1373 391
303 3300046664 Ga0495659_0052240 Ga0495659_0052240_118_1344 391
304 3300005548 Ga0070665_100098125 Ga0070665_1000981252 392
305 3300005840 Ga0068870_10043720 Ga0068870_100437202 392
306 3300025908 Ga0207643_10021347 Ga0207643_100213473 392
307 3300049572 Ga0501036_0078972 Ga0501036_0078972_159_1400 393
308 3300049578 Ga0501042_0055563 Ga0501042_0055563_229_1470 393
309 3300005364 Ga0070673_100039726 Ga0070673_1000397262 394
310 3300025936 Ga0207670_10041340 Ga0207670_100413403 395
311 3300032002 Ga0307416_100227496 Ga0307416_1002274962 395
312 3300046463 Ga0495653_0022443 Ga0495653_0022443_2578_3849 395
313 3300006847 Ga0075431_100029045 Ga0075431_1000290452 397
314 3300014326 Ga0157380_10139239 Ga0157380_101392392 399
315 3300005331 Ga0070670_100003032 Ga0070670_10000303213 400
316 3300005347 Ga0070668_100129587 Ga0070668_1001295872 400
317 3300005355 Ga0070671_100100367 Ga0070671_1001003672 400
318 3300005438 Ga0070701_10095455 Ga0070701_100954552 400
319 3300005441 Ga0070700_100009056 Ga0070700_1000090565 400
320 3300005549 Ga0070704_100144345 Ga0070704_1001443452 400
321 3300005564 Ga0070664_100018666 Ga0070664_1000186662 400
322 3300006846 Ga0075430_100013382 Ga0075430_1000133824 400
323 3300006880 Ga0075429_100022586 Ga0075429_1000225863 400
324 3300009094 Ga0111539_10131600 Ga0111539_101316002 400
325 3300009098 Ga0105245_10004544 Ga0105245_1000454413 400
326 3300009553 Ga0105249_10132449 Ga0105249_101324493 400
327 3300014745 Ga0157377_10011153 Ga0157377_100111534 400
328 3300025901 Ga0207688_10006456 Ga0207688_100064566 400
329 3300025940 Ga0207691_10030454 Ga0207691_100304544 400
330 3300025945 Ga0207679_10078048 Ga0207679_100780482 400
331 3300026121 Ga0207683_10030661 Ga0207683_100306612 400
332 3300027907 Ga0207428_10005251 Ga0207428_100052512 400
333 3300045976 Ga0466967_0058986 Ga0466967_0058986_2035_3306 400
334 3300048914 Ga0496111_0021871 Ga0496111_0021871_1848_3122 400
335 3300049576 Ga0501040_0002358 Ga0501040_0002358_1338_2621 400
336 3300049577 Ga0501041_0044898 Ga0501041_0044898_259_1542 400
337 3300049580 Ga0501046_0007826 Ga0501046_0007826_6276_7559 400
338 3300049585 Ga0501069_0021927 Ga0501069_0021927_851_2134 400
339 3300049591 Ga0501075_0074192 Ga0501075_0074192_402_1685 400
340 3300049743 Ga0501081_0053338 Ga0501081_0053338_933_2216 400
341 3300049824 Ga0501045_0115544 Ga0501045_0115544_449_1732 400
342 3300050511 nmdc:mga08y16_108028_c1 nmdc:mga08y16_108028_c1_1427_2695 400
343 3300060353 Ga0501082_0037086 Ga0501082_0037086_1423_2706 400
344 3300061734 Ga0530510_0011715 Ga0530510_0011715_1716_2999 400
345 3300005329 Ga0070683_100025673 Ga0070683_1000256734 401
346 3300005329 Ga0070683_100032884 Ga0070683_1000328842 401
347 3300005336 Ga0070680_100004108 Ga0070680_1000041089 401
348 3300005444 Ga0070694_100098569 Ga0070694_1000985692 401
349 3300005458 Ga0070681_10018032 Ga0070681_100180327 401
350 3300005535 Ga0070684_100033095 Ga0070684_1000330953 401
351 3300005549 Ga0070704_100123157 Ga0070704_1001231572 401
352 3300005577 Ga0068857_100055001 Ga0068857_1000550013 401
353 3300006881 Ga0068865_100176864 Ga0068865_1001768642 401
354 3300009148 Ga0105243_10020549 Ga0105243_100205492 401
355 3300009176 Ga0105242_10210534 Ga0105242_102105342 401
356 3300025937 Ga0207669_10187183 Ga0207669_101871832 401
357 3300025944 Ga0207661_10067624 Ga0207661_100676242 401
358 3300025944 Ga0207661_10158291 Ga0207661_101582911 401
359 3300026078 Ga0207702_10194218 Ga0207702_101942182 401
360 3300026116 Ga0207674_10006224 Ga0207674_1000622413 401
361 3300026116 Ga0207674_10022232 Ga0207674_100222324 401
362 3300037312 Ga0395899_0134294 Ga0395899_0134294_358_1584 401
363 3300037418 Ga0395900_0003522 Ga0395900_0003522_7158_8384 401
364 3300037418 Ga0395900_0017254 Ga0395900_0017254_4159_5385 401
365 3300037418 Ga0395900_0138474 Ga0395900_0138474_1210_2436 401
366 3300037466 Ga0395898_0003184 Ga0395898_0003184_8985_10211 401
367 3300037466 Ga0395898_0067937 Ga0395898_0067937_1278_2504 401
368 3300037466 Ga0395898_0125928 Ga0395898_0125928_11_1252 401
369 3300037471 Ga0395905_0010165 Ga0395905_0010165_344_1570 401
370 3300037471 Ga0395905_0024990 Ga0395905_0024990_2916_4142 401
371 3300038443 Ga0395901_0007152 Ga0395901_0007152_3703_4929 401
372 3300038443 Ga0395901_0025698 Ga0395901_0025698_3547_4773 401
373 3300046473 Ga0495582_0033518 Ga0495582_0033518_559_1785 401
374 3300046535 Ga0495586_0017317 Ga0495586_0017317_224_1450 401
375 3300048912 Ga0496109_0057405 Ga0496109_0057405_126_1352 401
376 3300048914 Ga0496111_0107863 Ga0496111_0107863_503_1729 401
377 3300050515 nmdc:mga0a205_42088_c1 nmdc:mga0a205_42088_c1_1057_2283 401
378 3300005354 Ga0070675_100014504 Ga0070675_1000145043 403
379 3300005617 Ga0068859_100102321 Ga0068859_1001023212 403
380 3300006931 Ga0097620_100102328 Ga0097620_1001023282 403
381 3300011119 Ga0105246_10006723 Ga0105246_100067234 403
382 3300025927 Ga0207687_10112746 Ga0207687_101127462 403
383 3300050507 nmdc:mga05p37_204559_c1 nmdc:mga05p37_204559_c1_97_1359 403
384 3300046463 Ga0495653_0085529 Ga0495653_0085529_22_1269 404
385 3300047322 Ga0495680_0061950 Ga0495680_0061950_284_1531 404
386 3300005842 Ga0068858_100118487 Ga0068858_1001184871 405
387 3300009148 Ga0105243_10005927 Ga0105243_100059278 405
388 3300014326 Ga0157380_10027047 Ga0157380_100270473 405
389 3300014969 Ga0157376_10077670 Ga0157376_100776702 405
390 3300025937 Ga0207669_10026415 Ga0207669_100264152 405
391 3300048912 Ga0496109_0104132 Ga0496109_0104132_89_1384 408
392 3300049587 Ga0501071_0197642 Ga0501071_0197642_180_1439 409
393 3300005441 Ga0070700_100060947 Ga0070700_1000609471 410
394 3300005535 Ga0070684_100077805 Ga0070684_1000778052 410
395 3300009176 Ga0105242_10092405 Ga0105242_100924053 410
396 3300025908 Ga0207643_10023433 Ga0207643_100234332 410
397 3300025940 Ga0207691_10044533 Ga0207691_100445333 410
398 3300026075 Ga0207708_10026930 Ga0207708_100269303 410
399 3300026089 Ga0207648_10107984 Ga0207648_101079841 410
400 3300026095 Ga0207676_10143098 Ga0207676_101430982 410
401 3300026121 Ga0207683_10060892 Ga0207683_100608923 410
402 3300049575 Ga0501039_0029009 Ga0501039_0029009_1376_2650 410
403 3300049576 Ga0501040_0006707 Ga0501040_0006707_4503_5777 410
404 3300049577 Ga0501041_0011844 Ga0501041_0011844_3483_4757 410
405 3300049578 Ga0501042_0021347 Ga0501042_0021347_1825_3099 410
406 3300049579 Ga0501043_0021406 Ga0501043_0021406_1438_2712 410
407 3300049580 Ga0501046_0003329 Ga0501046_0003329_1635_2909 410
408 3300049582 Ga0501048_0034917 Ga0501048_0034917_1879_3153 410
409 3300049584 Ga0501068_0010703 Ga0501068_0010703_3566_4840 410
410 3300049585 Ga0501069_0025316 Ga0501069_0025316_1386_2660 410
411 3300049586 Ga0501070_0045954 Ga0501070_0045954_751_2025 410
412 3300049587 Ga0501071_0015623 Ga0501071_0015623_1730_3004 410
413 3300049588 Ga0501072_0006570 Ga0501072_0006570_6147_7421 410
414 3300049590 Ga0501074_0006671 Ga0501074_0006671_2520_3794 410
415 3300049591 Ga0501075_0005584 Ga0501075_0005584_6759_8033 410
416 3300049592 Ga0501076_0039548 Ga0501076_0039548_1848_3122 410
417 3300049741 Ga0501079_0013164 Ga0501079_0013164_2823_4097 410
418 3300049743 Ga0501081_0007123 Ga0501081_0007123_3400_4674 410
419 3300049822 Ga0501035_0017631 Ga0501035_0017631_2941_4215 410
420 3300054114 Ga0501084_0004414 Ga0501084_0004414_3517_4791 410
421 3300060353 Ga0501082_0045872 Ga0501082_0045872_1513_2787 410
422 3300061734 Ga0530510_0044944 Ga0530510_0044944_676_1950 410
423 3300005329 Ga0070683_100006309 Ga0070683_1000063099 411
424 3300005356 Ga0070674_100008797 Ga0070674_1000087975 411
425 3300005543 Ga0070672_100003935 Ga0070672_1000039358 411
426 3300005614 Ga0068856_100083962 Ga0068856_1000839622 411
427 3300005834 Ga0068851_10018278 Ga0068851_100182783 411
428 3300014326 Ga0157380_10067401 Ga0157380_100674012 411
429 3300025321 Ga0207656_10003507 Ga0207656_100035074 411
430 3300025909 Ga0207705_10068188 Ga0207705_100681882 411
431 3300025920 Ga0207649_10078646 Ga0207649_100786461 411
432 3300025927 Ga0207687_10104506 Ga0207687_101045062 411
433 3300025933 Ga0207706_10011588 Ga0207706_100115886 411
434 3300025935 Ga0207709_10007091 Ga0207709_100070912 411
435 3300025945 Ga0207679_10070433 Ga0207679_100704332 411
436 3300026089 Ga0207648_10026892 Ga0207648_100268923 411
437 3300060353 Ga0501082_0221302 Ga0501082_0221302_320_1567 411
438 3300046455 Ga0495603_0033049 Ga0495603_0033049_337_1632 412
439 3300009177 Ga0105248_10188646 Ga0105248_101886462 413
440 3300005354 Ga0070675_100134673 Ga0070675_1001346731 415
441 3300009147 Ga0114129_10172304 Ga0114129_101723043 415
442 3300025926 Ga0207659_10090236 Ga0207659_100902362 415
443 3300025912 Ga0207707_10029572 Ga0207707_100295722 416
444 3300049583 Ga0501067_0038878 Ga0501067_0038878_1215_2498 416
445 3300049824 Ga0501045_0013950 Ga0501045_0013950_1292_2575 416
446 3300003203 JGI25406J46586_10004654 JGI25406J46586_100046545 419
447 3300005985 Ga0081539_10000866 Ga0081539_1000086658 419
448 3300026116 Ga0207674_10207808 Ga0207674_102078082 422
449 3300049575 Ga0501039_0065184 Ga0501039_0065184_1263_2546 422
450 3300009148 Ga0105243_10004276 Ga0105243_100042764 424
451 3300009176 Ga0105242_10044455 Ga0105242_100444552 424
452 3300009177 Ga0105248_10015636 Ga0105248_100156366 424
453 3300009551 Ga0105238_10020297 Ga0105238_100202972 424
454 3300010375 Ga0105239_10160051 Ga0105239_101600512 424
455 3300013102 Ga0157371_10017112 Ga0157371_100171122 424
456 3300013297 Ga0157378_10288756 Ga0157378_102887562 424
457 3300013307 Ga0157372_10216778 Ga0157372_102167782 424
458 3300013308 Ga0157375_10017496 Ga0157375_100174962 424
459 3300014745 Ga0157377_10001103 Ga0157377_100011038 424
460 3300048905 Ga0496102_0155608 Ga0496102_0155608_806_2080 424
461 3300002075 JGI24738J21930_10001717 JGI24738J21930_100017174 427
462 3300005327 Ga0070658_10084821 Ga0070658_100848211 427
463 3300005337 Ga0070682_100002080 Ga0070682_1000020801 427
464 3300005338 Ga0068868_100005020 Ga0068868_1000050204 427
465 3300005339 Ga0070660_100007445 Ga0070660_1000074455 427
466 3300005344 Ga0070661_100016598 Ga0070661_1000165984 427
467 3300005344 Ga0070661_100083628 Ga0070661_1000836282 427
468 3300005345 Ga0070692_10065979 Ga0070692_100659791 427
469 3300005345 Ga0070692_10080598 Ga0070692_100805982 427
470 3300005354 Ga0070675_100042348 Ga0070675_1000423481 427
471 3300005355 Ga0070671_100251724 Ga0070671_1002517241 427
472 3300005356 Ga0070674_100051344 Ga0070674_1000513442 427
473 3300005364 Ga0070673_100004468 Ga0070673_1000044685 427
474 3300005364 Ga0070673_100145163 Ga0070673_1001451631 427
475 3300005365 Ga0070688_100102361 Ga0070688_1001023612 427
476 3300005366 Ga0070659_100064877 Ga0070659_1000648772 427
477 3300005457 Ga0070662_100063963 Ga0070662_1000639631 427
478 3300005459 Ga0068867_100033211 Ga0068867_1000332111 427
479 3300005459 Ga0068867_100052864 Ga0068867_1000528642 427
480 3300005530 Ga0070679_100110091 Ga0070679_1001100912 427
481 3300005535 Ga0070684_100011431 Ga0070684_1000114311 427
482 3300005535 Ga0070684_100230377 Ga0070684_1002303772 427
483 3300005539 Ga0068853_100005422 Ga0068853_1000054227 427
484 3300005544 Ga0070686_100175037 Ga0070686_1001750371 427
485 3300005548 Ga0070665_100224365 Ga0070665_1002243651 427
486 3300005549 Ga0070704_100080684 Ga0070704_1000806842 427
487 3300005563 Ga0068855_100150493 Ga0068855_1001504932 427
488 3300005564 Ga0070664_100056298 Ga0070664_1000562982 427
489 3300005578 Ga0068854_100061092 Ga0068854_1000610921 427
490 3300005615 Ga0070702_100049600 Ga0070702_1000496002 427
491 3300006852 Ga0075433_10117394 Ga0075433_101173942 427
492 3300006881 Ga0068865_100004844 Ga0068865_1000048442 427
493 3300009094 Ga0111539_10030514 Ga0111539_100305142 427
494 3300009101 Ga0105247_10022511 Ga0105247_100225114 427
495 3300009177 Ga0105248_10049140 Ga0105248_100491402 427
496 3300014968 Ga0157379_10008081 Ga0157379_1000808110 427
497 3300025901 Ga0207688_10020209 Ga0207688_100202092 427
498 3300025908 Ga0207643_10007509 Ga0207643_100075096 427
499 3300025912 Ga0207707_10085135 Ga0207707_100851353 427
500 3300025919 Ga0207657_10001794 Ga0207657_100017942 427
501 3300025919 Ga0207657_10174377 Ga0207657_101743772 427
502 3300025927 Ga0207687_10034605 Ga0207687_100346052 427
503 3300025932 Ga0207690_10023941 Ga0207690_100239412 427
504 3300025933 Ga0207706_10286735 Ga0207706_102867352 427
505 3300025935 Ga0207709_10049474 Ga0207709_100494742 427
506 3300025938 Ga0207704_10005121 Ga0207704_100051215 427
507 3300025940 Ga0207691_10013165 Ga0207691_100131656 427
508 3300025940 Ga0207691_10017360 Ga0207691_100173605 427
509 3300025944 Ga0207661_10028201 Ga0207661_100282014 427
510 3300025949 Ga0207667_10089796 Ga0207667_100897962 427
511 3300025960 Ga0207651_10099287 Ga0207651_100992871 427
512 3300026067 Ga0207678_10119192 Ga0207678_101191922 427
513 3300026075 Ga0207708_10014002 Ga0207708_100140022 427
514 3300026089 Ga0207648_10052325 Ga0207648_100523253 427
515 3300026095 Ga0207676_10018726 Ga0207676_100187264 427
516 3300026118 Ga0207675_100021504 Ga0207675_1000215044 427
517 3300027907 Ga0207428_10069888 Ga0207428_100698882 427
518 3300035121 Ga0373960_0004898 Ga0373960_0004898_745_2028 427
519 3300048908 Ga0496105_0184232 Ga0496105_0184232_389_1672 427
520 3300048911 Ga0496108_0174105 Ga0496108_0174105_252_1535 427
521 3300048912 Ga0496109_0035920 Ga0496109_0035920_56_1339 427
522 3300048914 Ga0496111_0048556 Ga0496111_0048556_60_1343 427
523 3300049568 Ga0501031_0014848 Ga0501031_0014848_233_1516 427
524 3300049576 Ga0501040_0013521 Ga0501040_0013521_2827_4110 427
525 3300049577 Ga0501041_0012756 Ga0501041_0012756_3423_4706 427
526 3300049578 Ga0501042_0001269 Ga0501042_0001269_9921_11204 427
527 3300049580 Ga0501046_0109087 Ga0501046_0109087_725_2008 427
528 3300049582 Ga0501048_0014711 Ga0501048_0014711_3277_4560 427
529 3300049588 Ga0501072_0002225 Ga0501072_0002225_1286_2569 427
530 3300049590 Ga0501074_0061905 Ga0501074_0061905_285_1568 427
531 3300049591 Ga0501075_0024928 Ga0501075_0024928_106_1389 427
532 3300049592 Ga0501076_0000834 Ga0501076_0000834_2962_4245 427
533 3300054114 Ga0501084_0019500 Ga0501084_0019500_2963_4246 427

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08245

Mur_ligase_M

Mur ligase middle domain

136

245

0.96

PF21799

MurD-like_N

Mur ligase MurD-like, N-terminal domain

36

120

0.94

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

307

420

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3if9-assembly1.cif.gz_B-2 crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate 0.9746 4 33
3i3l-assembly1.cif.gz_A crystal structure of cmls, a flavin-dependent halogenase 0.9703 2 33
4rep-assembly1.cif.gz_A crystal structure of gamma-carotenoid desaturase 0.969 1 33
3ka7-assembly1.cif.gz_A crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 0.9623 2 33
1c0i-assembly1.cif.gz_A crystal structure of d-amino acid oxidase in complex with two anthranylate molecules 0.9559 2 33
ID Description Score Start End Superfamily
af_P9WNY9_4_366_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9778 4 33 3.50.50.60
af_P49086_94_556_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9599 3 33 3.50.50.60
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9507 4 35 3.50.50.60
af_A0A1D6E3F3_39_301_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9498 2 34 3.50.50.60
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.949 4 36 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7V9JRD2-F1-model_v4 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase 0.9736 2 232 GO:0005524
GO:0005737
GO:0008360
GO:0008764
GO:0009058
GO:0051301
AF-A0A538CYT9-F1-model_v4 Mur ligase central domain-containing protein 0.9695 3 288 GO:0005524
GO:0005737
GO:0008360
GO:0008764
GO:0009058
GO:0051301
AF-A0A2W6CQC1-F1-model_v4 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase 0.9544 15 341 GO:0005524
GO:0005737
GO:0008360
GO:0008764
GO:0009252
GO:0051301
AF-A0A2V6WRM2-F1-model_v4 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase 0.9521 294 410 GO:0005524
GO:0005737
GO:0008360
GO:0008764
GO:0009058
GO:0051301
AF-V9G3M9-F1-model_v4 UDP-N-acetylmuramoylalanine-D-glutamate ligase 0.9508 235 409 GO:0005524
GO:0005737
GO:0008360
GO:0008764
GO:0009252
GO:0051301
GO:0071555

Feature Viewer

pLDDT pTM Quality
92.39 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map