F460384

General Info

Members Datasets Scaffolds Average Seq Length
533 322 1066 238

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100012118|Ga0075363_1000121182
Length 267
Sequence MPTPTLRTVWQHDYKFDFKRVRMSFQILPAIDLMDGGCVRLQQGDASRKTKYPTPPADVARSYEEAGAQRIHVVDLDGAFSGKPANLEAIKAIRAATKVTIEVGGGVRDRPTIAALLETGINHVVIGTKALEDLGFLGEMVTEFGDRIIVGADARDGLLATRGWVNTTDVQAVPYLRRLHEEFGVATVIFTDIARDGMFTAPDTETLEQLLDISPTLQVIASGGVGVLEHVVALKNLNRPNLLGVIVGKALYDGRLNLSQAVEALKK

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
6 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
190 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
198 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
210 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
211 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
233 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
234 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
235 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
236 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
237 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
238 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
239 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
240 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
241 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
242 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
266 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
267 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
268 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
269 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
270 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
271 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
272 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
273 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
274 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
275 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
276 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
277 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
278 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
279 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
280 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
281 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
282 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
283 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
284 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
285 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
286 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
287 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
293 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
294 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
295 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
296 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
297 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
298 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
299 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
300 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
301 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
302 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 0.56
Rhizosphere 99.25
Stem 0
Stem Tuber 0
Unclassified 4.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100012118 3300006048 Bacteria 4147
2 SwRhRL2b_contig_345107 2162886007 Bacteria 1403
3 ARCol0yngRDRAFT_1002234 3300000652 Bacteria 1481
4 JGI24737J22298_10067636 3300001990 Bacteria 1069
5 JGI26128J50194_1002358 3300003347 Bacteria 1239
6 JGI26145J50221_1000893 3300003371 Bacteria 2402
7 Ga0065704_10107941 3300005289 Bacteria 2043
8 Ga0065712_10002077 3300005290 Bacteria 5321
9 Ga0065707_10084250 3300005295 Bacteria 7423
10 Ga0065707_10088055 3300005295 Bacteria 4795
11 Ga0065707_10147441 3300005295 Bacteria 1697
12 Ga0065707_10182765 3300005295 Bacteria 1408
13 Ga0070676_10002174 3300005328 Bacteria 9992
14 Ga0070676_10462031 3300005328 Unclassified 895
15 Ga0070683_100056030 3300005329 Bacteria 3660
16 Ga0070690_100003994 3300005330 Bacteria 8156
17 Ga0070670_100036198 3300005331 Bacteria 4248
18 Ga0068869_100013452 3300005334 Bacteria 5443
19 Ga0068869_100788238 3300005334 Unclassified 816
20 Ga0070666_10002808 3300005335 Bacteria 10516
21 Ga0070680_100003352 3300005336 Bacteria 11955
22 Ga0070680_100012497 3300005336 Bacteria 6599
23 Ga0070680_100024366 3300005336 Bacteria 4833
24 Ga0070680_100224970 3300005336 Bacteria 1584
25 Ga0070682_100285053 3300005337 Bacteria 1206
26 Ga0068868_100130790 3300005338 Bacteria 2054
27 Ga0068868_100264387 3300005338 Bacteria 1452
28 Ga0070660_100008995 3300005339 Bacteria 7006
29 Ga0070689_100011281 3300005340 Bacteria 6397
30 Ga0070689_100033620 3300005340 Bacteria 3908
31 Ga0070691_10000339 3300005341 Bacteria 16574
32 Ga0070691_10010625 3300005341 Bacteria 4204
33 Ga0070691_10117269 3300005341 Bacteria 1337
34 Ga0070687_100009496 3300005343 Bacteria 4171
35 Ga0070687_100018396 3300005343 Bacteria 3232
36 Ga0070687_100140947 3300005343 Bacteria 1404
37 Ga0070661_100035700 3300005344 Bacteria 3611
38 Ga0070692_10020877 3300005345 Bacteria 3180
39 Ga0070668_100005779 3300005347 Bacteria 9178
40 Ga0070669_100001470 3300005353 Bacteria 17033
41 Ga0070675_100035025 3300005354 Bacteria 4077
42 Ga0070671_100022227 3300005355 Bacteria 5181
43 Ga0070671_100265885 3300005355 Bacteria 1458
44 Ga0070674_100000841 3300005356 Bacteria 15909
45 Ga0070673_100017531 3300005364 Bacteria 5096
46 Ga0070673_100523410 3300005364 Bacteria 1075
47 Ga0070673_100724822 3300005364 Unclassified 914
48 Ga0070688_100000377 3300005365 Bacteria 22585
49 Ga0070688_100004950 3300005365 Bacteria 6970
50 Ga0070659_100002343 3300005366 Bacteria 13463
51 Ga0070667_100020824 3300005367 Bacteria 5446
52 Ga0070667_100191243 3300005367 Bacteria 1813
53 Ga0070709_10041624 3300005434 Bacteria 2832
54 Ga0070709_10565349 3300005434 Bacteria 872
55 Ga0070714_100011089 3300005435 Bacteria 7143
56 Ga0070714_100137805 3300005435 Unclassified 2187
57 Ga0070710_10114107 3300005437 Unclassified 1627
58 Ga0070710_10276959 3300005437 Bacteria 1087
59 Ga0070701_10001460 3300005438 Bacteria 8739
60 Ga0070701_10113140 3300005438 Bacteria 1519
61 Ga0070711_100344201 3300005439 Bacteria 1197
62 Ga0070705_100012860 3300005440 Bacteria 4268
63 Ga0070705_100161284 3300005440 Unclassified 1499
64 Ga0070700_100000203 3300005441 Bacteria 33460
65 Ga0070700_100001272 3300005441 Bacteria 12505
66 Ga0070694_100005707 3300005444 Bacteria 7547
67 Ga0070694_100141950 3300005444 Bacteria 1745
68 Ga0070694_100322699 3300005444 Bacteria 1189
69 Ga0070694_100380220 3300005444 Bacteria 1101
70 Ga0070708_100022937 3300005445 Bacteria 5301
71 Ga0070708_100086144 3300005445 Bacteria 2853
72 Ga0070708_100118384 3300005445 Unclassified 2440
73 Ga0070708_100290067 3300005445 Bacteria 1540
74 Ga0070708_100403123 3300005445 Bacteria 1290
75 Ga0070708_100806203 3300005445 Unclassified 882
76 Ga0070678_100000694 3300005456 Bacteria 16639
77 Ga0070678_100030670 3300005456 Bacteria 3699
78 Ga0070662_100004564 3300005457 Bacteria 8767
79 Ga0070681_10003975 3300005458 Bacteria 13946
80 Ga0070681_10056424 3300005458 Bacteria 3909
81 Ga0068867_100000470 3300005459 Bacteria 26728
82 Ga0068867_100001004 3300005459 Bacteria 19256
83 Ga0070685_10000233 3300005466 Bacteria 36667
84 Ga0070685_10164037 3300005466 Bacteria 1418
85 Ga0070706_100109579 3300005467 Bacteria 2569
86 Ga0070706_100139272 3300005467 Unclassified 2265
87 Ga0070706_100307105 3300005467 Bacteria 1480
88 Ga0070706_100372879 3300005467 Bacteria 1330
89 Ga0070707_100000013 3300005468 Bacteria 149725
90 Ga0070707_100319706 3300005468 Unclassified 1508
91 Ga0070707_100506953 3300005468 Unclassified 1168
92 Ga0070698_100017641 3300005471 Bacteria 7521
93 Ga0070698_100059422 3300005471 Bacteria 3861
94 Ga0070699_100013189 3300005518 Bacteria 7126
95 Ga0070699_100021013 3300005518 Bacteria 5628
96 Ga0070699_100030108 3300005518 Bacteria 4683
97 Ga0070699_100066719 3300005518 Unclassified 3124
98 Ga0070699_100090711 3300005518 Bacteria 2671
99 Ga0070679_100038651 3300005530 Bacteria 4745
100 Ga0070684_100018809 3300005535 Bacteria 5700
101 Ga0070697_100004870 3300005536 Bacteria 10301
102 Ga0070697_100024290 3300005536 Bacteria 4824
103 Ga0070697_100077596 3300005536 Bacteria 2733
104 Ga0070697_100133445 3300005536 Bacteria 2084
105 Ga0070697_100665906 3300005536 Bacteria 917
106 Ga0068853_100359010 3300005539 Bacteria 1357
107 Ga0068853_100522703 3300005539 Bacteria 1122
108 Ga0070672_100001715 3300005543 Bacteria 13684
109 Ga0070686_100000098 3300005544 Bacteria 60301
110 Ga0070686_100004099 3300005544 Bacteria 8018
111 Ga0070686_100297494 3300005544 Bacteria 1196
112 Ga0070695_100006451 3300005545 Bacteria 6937
113 Ga0070695_100060135 3300005545 Bacteria 2462
114 Ga0070695_100314174 3300005545 Bacteria 1162
115 Ga0070695_100418529 3300005545 Bacteria 1020
116 Ga0070696_100027649 3300005546 Bacteria 3866
117 Ga0070696_100128636 3300005546 Bacteria 1840
118 Ga0070696_100401356 3300005546 Bacteria 1072
119 Ga0070693_100012809 3300005547 Bacteria 4255
120 Ga0070665_100029245 3300005548 Bacteria 5546
121 Ga0070704_100004801 3300005549 Bacteria 7829
122 Ga0070704_100389964 3300005549 Bacteria 1186
123 Ga0068855_100038242 3300005563 Bacteria 5702
124 Ga0070664_100000732 3300005564 Bacteria 25259
125 Ga0070664_100004576 3300005564 Bacteria 11102
126 Ga0068857_100059433 3300005577 Bacteria 3396
127 Ga0070702_100008555 3300005615 Bacteria 4965
128 Ga0070702_100089450 3300005615 Bacteria 1864
129 Ga0070702_100132213 3300005615 Bacteria 1578
130 Ga0070702_100134462 3300005615 Bacteria 1566
131 Ga0068852_100153558 3300005616 Bacteria 2143
132 Ga0068859_100004934 3300005617 Bacteria 13556
133 Ga0068859_100091247 3300005617 Bacteria 3097
134 Ga0068859_100122516 3300005617 Bacteria 2667
135 Ga0068859_100171495 3300005617 Bacteria 2251
136 Ga0068864_100425450 3300005618 Unclassified 1266
137 Ga0068866_10010188 3300005718 Bacteria 4021
138 Ga0068866_10032559 3300005718 Bacteria 2522
139 Ga0068861_100073395 3300005719 Bacteria 2658
140 Ga0068861_100473908 3300005719 Bacteria 1126
141 Ga0068870_10011125 3300005840 Bacteria 4160
142 Ga0068858_100508981 3300005842 Bacteria 1164
143 Ga0068860_100184281 3300005843 Bacteria 2018
144 Ga0068860_100241916 3300005843 Bacteria 1756
145 Ga0068860_100284028 3300005843 Bacteria 1618
146 Ga0081455_10001447 3300005937 Bacteria 29367
147 Ga0070717_10000183 3300006028 Bacteria 46182
148 Ga0070717_10000784 3300006028 Bacteria 20818
149 Ga0070717_10319880 3300006028 Unclassified 1382
150 Ga0075432_10000409 3300006058 Bacteria 12542
151 Ga0070716_100048318 3300006173 Unclassified 2405
152 Ga0070716_100084597 3300006173 Bacteria 1903
153 Ga0070716_100200769 3300006173 Bacteria 1325
154 Ga0070712_100297025 3300006175 Unclassified 1306
155 Ga0070712_100376546 3300006175 Bacteria 1168
156 Ga0097621_100175609 3300006237 Bacteria 1849
157 Ga0068871_100018098 3300006358 Bacteria 5349
158 Ga0068871_100037790 3300006358 Bacteria 3852
159 Ga0075428_100011883 3300006844 Bacteria 9682
160 Ga0075428_100019792 3300006844 Bacteria 7449
161 Ga0075430_100002839 3300006846 Bacteria 14490
162 Ga0075430_100022294 3300006846 Bacteria 5387
163 Ga0075430_100031839 3300006846 Bacteria 4476
164 Ga0075431_100010188 3300006847 Bacteria 9451
165 Ga0075431_100060750 3300006847 Bacteria 3900
166 Ga0075433_10003245 3300006852 Bacteria 12564
167 Ga0075433_10088355 3300006852 Bacteria 2739
168 Ga0075433_10221565 3300006852 Bacteria 1680
169 Ga0075434_100026866 3300006871 Bacteria 5646
170 Ga0075434_100046337 3300006871 Bacteria 4314
171 Ga0075429_100003473 3300006880 Bacteria 13444
172 Ga0075429_100010339 3300006880 Bacteria 8074
173 Ga0068865_100001105 3300006881 Bacteria 15583
174 Ga0075436_100003806 3300006914 Bacteria 10352
175 Ga0075436_100030634 3300006914 Bacteria 3702
176 Ga0075436_100032050 3300006914 Bacteria 3622
177 Ga0075436_100080728 3300006914 Unclassified 2254
178 Ga0075436_100210392 3300006914 Unclassified 1378
179 Ga0075436_100242381 3300006914 Bacteria 1282
180 Ga0097620_100004934 3300006931 Bacteria 13556
181 Ga0097620_100091247 3300006931 Bacteria 3097
182 Ga0097620_100122522 3300006931 Bacteria 2667
183 Ga0097620_100171494 3300006931 Bacteria 2251
184 Ga0075435_100118029 3300007076 Bacteria 2211
185 Ga0075435_100186889 3300007076 Bacteria 1752
186 Ga0099794_10000128 3300007265 Bacteria 27557
187 Ga0099794_10236590 3300007265 Unclassified 940
188 Ga0099795_10035791 3300007788 Bacteria 1738
189 Ga0105240_10003992 3300009093 Bacteria 22736
190 Ga0111539_10073643 3300009094 Bacteria 4026
191 Ga0111539_10143345 3300009094 Bacteria 2797
192 Ga0105245_10001137 3300009098 Bacteria 24067
193 Ga0105245_10305620 3300009098 Bacteria 1562
194 Ga0105247_10042088 3300009101 Bacteria 2796
195 Ga0114129_10004374 3300009147 Bacteria 19934
196 Ga0114129_10135726 3300009147 Bacteria 3376
197 Ga0114129_10275348 3300009147 Bacteria 2250
198 Ga0114129_10939578 3300009147 Bacteria 1093
199 Ga0105243_10009230 3300009148 Bacteria 7530
200 Ga0105243_10042491 3300009148 Bacteria 3558
201 Ga0105243_10129378 3300009148 Bacteria 2140
202 Ga0105243_10752909 3300009148 Bacteria 955
203 Ga0105241_10040419 3300009174 Bacteria 3521
204 Ga0105241_10300651 3300009174 Bacteria 1377
205 Ga0105242_10000070 3300009176 Bacteria 71709
206 Ga0105242_10011786 3300009176 Bacteria 6728
207 Ga0105242_10274366 3300009176 Bacteria 1529
208 Ga0105248_10015376 3300009177 Bacteria 8442
209 Ga0105248_10245182 3300009177 Bacteria 2017
210 Ga0105249_10018433 3300009553 Bacteria 6211
211 Ga0105249_10810330 3300009553 Bacteria 1001
212 Ga0099796_10066067 3300010159 Bacteria 1295
213 Ga0105239_10030984 3300010375 Bacteria 5884
214 Ga0105239_10035710 3300010375 Bacteria 5457
215 Ga0105239_10039656 3300010375 Bacteria 5159
216 Ga0105239_10098133 3300010375 Bacteria 3238
217 Ga0105246_10000272 3300011119 Bacteria 26954
218 Ga0105246_10265282 3300011119 Bacteria 1370
219 Ga0157373_10214921 3300013100 Bacteria 1356
220 Ga0157374_10031464 3300013296 Bacteria 4823
221 Ga0157378_10050174 3300013297 Bacteria 3713
222 Ga0157378_10457764 3300013297 Bacteria 1267
223 Ga0163162_10173880 3300013306 Bacteria 2278
224 Ga0157375_10054241 3300013308 Bacteria 3948
225 Ga0157375_10455201 3300013308 Bacteria 1445
226 Ga0157380_10019988 3300014326 Bacteria 4999
227 Ga0157380_10021064 3300014326 Bacteria 4885
228 Ga0157377_10045974 3300014745 Bacteria 2440
229 Ga0157377_10046780 3300014745 Bacteria 2421
230 Ga0157379_10007585 3300014968 Bacteria 9395
231 Ga0157379_10222624 3300014968 Bacteria 1710
232 Ga0157376_10000505 3300014969 Bacteria 25267
233 Ga0157376_10017006 3300014969 Bacteria 5537
234 Ga0163161_10048709 3300017792 Bacteria 3061
235 Ga0207697_10014801 3300025315 Bacteria 3231
236 Ga0207642_10004052 3300025899 Bacteria 4691
237 Ga0207710_10020326 3300025900 Bacteria 2838
238 Ga0207688_10001321 3300025901 Bacteria 12883
239 Ga0207645_10000271 3300025907 Bacteria 42808
240 Ga0207643_10034479 3300025908 Bacteria 2835
241 Ga0207684_10235922 3300025910 Bacteria 1578
242 Ga0207684_10341757 3300025910 Bacteria 1289
243 Ga0207654_10027925 3300025911 Bacteria 3072
244 Ga0207654_10121676 3300025911 Bacteria 1640
245 Ga0207660_10001727 3300025917 Bacteria 14651
246 Ga0207660_10140800 3300025917 Bacteria 1844
247 Ga0207662_10019320 3300025918 Bacteria 3875
248 Ga0207662_10023766 3300025918 Bacteria 3523
249 Ga0207662_10254293 3300025918 Bacteria 1154
250 Ga0207657_10001016 3300025919 Bacteria 29808
251 Ga0207652_10207207 3300025921 Bacteria 1765
252 Ga0207652_10821807 3300025921 Bacteria 824
253 Ga0207646_10000011 3300025922 Bacteria 370246
254 Ga0207646_10000279 3300025922 Bacteria 69923
255 Ga0207646_10057397 3300025922 Bacteria 3478
256 Ga0207646_10063272 3300025922 Bacteria 3303
257 Ga0207681_10001913 3300025923 Bacteria 13330
258 Ga0207650_10046611 3300025925 Bacteria 3192
259 Ga0207659_10001295 3300025926 Bacteria 14954
260 Ga0207659_10075538 3300025926 Bacteria 2473
261 Ga0207687_10013180 3300025927 Bacteria 5401
262 Ga0207700_10159214 3300025928 Bacteria 1874
263 Ga0207664_10931721 3300025929 Unclassified 779
264 Ga0207644_10080838 3300025931 Bacteria 2401
265 Ga0207690_10015002 3300025932 Bacteria 4691
266 Ga0207706_10000107 3300025933 Bacteria 88259
267 Ga0207686_10000891 3300025934 Bacteria 18029
268 Ga0207686_10012690 3300025934 Bacteria 4638
269 Ga0207686_10316106 3300025934 Bacteria 1165
270 Ga0207670_10000069 3300025936 Bacteria 72500
271 Ga0207670_10287104 3300025936 Bacteria 1284
272 Ga0207669_10001363 3300025937 Bacteria 10401
273 Ga0207704_10000490 3300025938 Bacteria 17679
274 Ga0207704_10419708 3300025938 Bacteria 1060
275 Ga0207665_10025368 3300025939 Bacteria 3910
276 Ga0207665_10243429 3300025939 Bacteria 1326
277 Ga0207691_10000472 3300025940 Bacteria 39858
278 Ga0207691_10027327 3300025940 Bacteria 5350
279 Ga0207711_10022555 3300025941 Bacteria 5266
280 Ga0207711_10184599 3300025941 Bacteria 1898
281 Ga0207689_10002927 3300025942 Bacteria 15764
282 Ga0207689_10010350 3300025942 Bacteria 8037
283 Ga0207679_10000745 3300025945 Bacteria 21640
284 Ga0207679_10016289 3300025945 Bacteria 4933
285 Ga0207651_10002301 3300025960 Bacteria 9089
286 Ga0207712_10012758 3300025961 Bacteria 5372
287 Ga0207712_10056755 3300025961 Bacteria 2760
288 Ga0207668_10001749 3300025972 Bacteria 12720
289 Ga0207640_10100896 3300025981 Bacteria 2023
290 Ga0207658_10010208 3300025986 Bacteria 6379
291 Ga0207703_10329958 3300026035 Bacteria 1399
292 Ga0207678_10097559 3300026067 Bacteria 2512
293 Ga0207708_10001269 3300026075 Bacteria 19023
294 Ga0207708_10007817 3300026075 Bacteria 7919
295 Ga0207708_10445370 3300026075 Bacteria 1078
296 Ga0207641_10342645 3300026088 Bacteria 1423
297 Ga0207648_10000803 3300026089 Bacteria 35454
298 Ga0207648_10007374 3300026089 Bacteria 10827
299 Ga0207648_10263715 3300026089 Bacteria 1537
300 Ga0207674_10075289 3300026116 Bacteria 3385
301 Ga0207675_100013849 3300026118 Bacteria 7520
302 Ga0207675_100037948 3300026118 Bacteria 4495
303 Ga0207675_100127803 3300026118 Bacteria 2408
304 Ga0207683_10000072 3300026121 Bacteria 78277
305 Ga0207683_10068185 3300026121 Bacteria 3139
306 Ga0207698_10320149 3300026142 Bacteria 1452
307 Ga0209969_1000011 3300027360 Bacteria 22908
308 Ga0209967_1000032 3300027364 Bacteria 17713
309 Ga0209996_1000002 3300027395 Bacteria 51944
310 Ga0209984_1000154 3300027424 Bacteria 7922
311 Ga0210000_1000019 3300027462 Bacteria 27891
312 Ga0209179_1046694 3300027512 Bacteria 921
313 Ga0209968_1000004 3300027526 Bacteria 57411
314 Ga0209968_1011809 3300027526 Bacteria 1358
315 Ga0209999_1000704 3300027543 Bacteria 5405
316 Ga0209982_1000035 3300027552 Bacteria 12240
317 Ga0210002_1000517 3300027617 Bacteria 5215
318 Ga0210002_1012696 3300027617 Bacteria 1311
319 Ga0209983_1000126 3300027665 Bacteria 13639
320 Ga0209588_1000190 3300027671 Bacteria 17000
321 Ga0209971_1000561 3300027682 Bacteria 9727
322 Ga0209966_1000037 3300027695 Bacteria 55075
323 Ga0209998_10000081 3300027717 Bacteria 37388
324 Ga0209998_10008168 3300027717 Bacteria 2171
325 Ga0209998_10021122 3300027717 Bacteria 1396
326 Ga0209998_10024935 3300027717 Bacteria 1300
327 Ga0209974_10000011 3300027876 Bacteria 48263
328 Ga0209974_10000211 3300027876 Bacteria 18919
329 Ga0209974_10092408 3300027876 Bacteria 1050
330 Ga0207428_10001486 3300027907 Bacteria 24517
331 Ga0268265_10285036 3300028380 Bacteria 1480
332 Ga0268264_10300628 3300028381 Bacteria 1511
333 Ga0268264_10529341 3300028381 Bacteria 1153
334 Ga0265330_10041652 3300031235 Bacteria 2036
335 Ga0307408_100334696 3300031548 Bacteria 1279
336 Ga0307405_10318721 3300031731 Bacteria 1186
337 Ga0307410_10027422 3300031852 Bacteria 3600
338 Ga0307406_10051690 3300031901 Bacteria 2610
339 Ga0307412_10003462 3300031911 Bacteria 8775
340 Ga0307409_100116984 3300031995 Bacteria 2248
341 Ga0307411_10103178 3300032005 Bacteria 2022
342 Ga0373930_0015774 3300034816 Bacteria 1422
343 Ga0373958_0018179 3300034819 Bacteria 1272
344 Ga0373926_0011412 3300035083 Bacteria 2989
345 Ga0373932_0067750 3300035112 Bacteria 1100
346 Ga0373932_0143865 3300035112 Unclassified 813
347 Ga0373936_0076422 3300035113 Bacteria 1388
348 Ga0373941_0062325 3300035115 Bacteria 1217
349 Ga0373941_0121898 3300035115 Unclassified 930
350 Ga0373954_0047534 3300035118 Bacteria 2009
351 Ga0373956_0050295 3300035119 Bacteria 1871
352 Ga0373957_0063936 3300035120 Bacteria 1430
353 Ga0373960_0014055 3300035121 Bacteria 2021
354 Ga0373955_0190020 3300035172 Bacteria 1221
355 Ga0373961_0119349 3300035241 Bacteria 872
356 Ga0373924_0020302 3300035410 Bacteria 2581
357 Ga0373924_0142238 3300035410 Bacteria 1047
358 Ga0373931_0045704 3300035691 Bacteria 2313
359 Ga0373931_0324671 3300035691 Bacteria 957
360 Ga0373933_0041591 3300035724 Bacteria 2714
361 Ga0373947_0337287 3300035725 Bacteria 1010
362 Ga0373937_0041126 3300036401 Bacteria 4217
363 Ga0436360_0694350 3300039438 Bacteria 2338
364 Ga0439447_006944 3300041407 Bacteria 3630
365 Ga0439448_0065155 3300042005 Bacteria 1208
366 Ga0439432_001323 3300042006 Bacteria 9379
367 Ga0439452_004573 3300042010 Bacteria 4609
368 Ga0439462_0124016 3300042015 Bacteria 719
369 Ga0451577_0243704 3300042876 Bacteria 1627
370 Ga0451577_0267572 3300042876 Bacteria 1548
371 Ga0466957_0215110 3300044842 Bacteria 1267
372 Ga0451576_0002525 3300045051 Bacteria 27099
373 Ga0495629_0106768 3300046459 Bacteria 1953
374 Ga0495580_0192392 3300046472 Bacteria 1407
375 Ga0495582_0041130 3300046473 Bacteria 2547
376 Ga0495639_0064210 3300046475 Bacteria 1687
377 Ga0495584_0225046 3300046491 Bacteria 953
378 Ga0495594_0159143 3300046499 Bacteria 1283
379 Ga0495640_0127827 3300046533 Bacteria 1647
380 Ga0495622_0199607 3300046557 Bacteria 892
381 Ga0495656_0072662 3300046615 Bacteria 1532
382 Ga0495635_0076476 3300046663 Bacteria 2294
383 Ga0495659_0061989 3300046664 Bacteria 1383
384 Ga0495588_0205361 3300046674 Bacteria 1041
385 Ga0495657_0003628 3300046675 Bacteria 12540
386 Ga0495581_0006438 3300047315 Bacteria 6815
387 Ga0495581_0265456 3300047315 Unclassified 1004
388 Ga0496102_0671275 3300048905 Bacteria 959
389 Ga0496108_0165345 3300048911 Bacteria 1913
390 Ga0496109_0214050 3300048912 Bacteria 1812
391 Ga0501290_000114 3300049513 Bacteria 12098
392 Ga0501292_000104 3300049515 Bacteria 15043
393 Ga0501293_000275 3300049516 Bacteria 3790
394 Ga0501294_000052 3300049517 Bacteria 12206
395 Ga0501295_000007 3300049518 Bacteria 26337
396 Ga0501296_000018 3300049519 Bacteria 19806
397 Ga0501297_000001 3300049520 Bacteria 42118
398 Ga0501299_000158 3300049522 Bacteria 7698
399 Ga0501300_000019 3300049523 Bacteria 23860
400 Ga0501302_001456 3300049525 Bacteria 1302
401 Ga0501303_000944 3300049526 Bacteria 2175
402 Ga0501031_0000046 3300049568 Bacteria 66528
403 Ga0501031_0002929 3300049568 Bacteria 10916
404 Ga0501031_0066137 3300049568 Bacteria 2355
405 Ga0501031_0125664 3300049568 Bacteria 1676
406 Ga0501032_0025070 3300049569 Bacteria 4113
407 Ga0501032_0040990 3300049569 Bacteria 3146
408 Ga0501033_0080954 3300049570 Bacteria 2382
409 Ga0501033_0098355 3300049570 Bacteria 2137
410 Ga0501036_0020115 3300049572 Bacteria 5605
411 Ga0501036_0054410 3300049572 Bacteria 3390
412 Ga0501036_0315997 3300049572 Bacteria 1305
413 Ga0501036_0404176 3300049572 Bacteria 1139
414 Ga0501037_0002195 3300049573 Bacteria 14105
415 Ga0501037_0009822 3300049573 Bacteria 7022
416 Ga0501037_0053418 3300049573 Bacteria 2955
417 Ga0501038_0003595 3300049574 Bacteria 14427
418 Ga0501039_0000262 3300049575 Bacteria 38507
419 Ga0501039_0004085 3300049575 Bacteria 10977
420 Ga0501039_0028677 3300049575 Bacteria 4285
421 Ga0501039_0047145 3300049575 Bacteria 3330
422 Ga0501039_0111222 3300049575 Bacteria 2141
423 Ga0501039_0382171 3300049575 Bacteria 1106
424 Ga0501040_0030634 3300049576 Bacteria 3634
425 Ga0501040_0062418 3300049576 Bacteria 2564
426 Ga0501040_0187518 3300049576 Bacteria 1467
427 Ga0501040_0193023 3300049576 Bacteria 1445
428 Ga0501041_0001772 3300049577 Bacteria 12100
429 Ga0501041_0005444 3300049577 Bacteria 7453
430 Ga0501041_0062968 3300049577 Bacteria 2271
431 Ga0501041_0063707 3300049577 Bacteria 2257
432 Ga0501042_0007596 3300049578 Bacteria 7112
433 Ga0501042_0030536 3300049578 Bacteria 3806
434 Ga0501042_0041432 3300049578 Bacteria 3274
435 Ga0501042_0046681 3300049578 Bacteria 3087
436 Ga0501042_0054796 3300049578 Bacteria 2844
437 Ga0501042_0093658 3300049578 Bacteria 2157
438 Ga0501043_0054142 3300049579 Bacteria 3151
439 Ga0501046_0000638 3300049580 Bacteria 34275
440 Ga0501048_0000214 3300049582 Bacteria 37952
441 Ga0501048_0012124 3300049582 Bacteria 6423
442 Ga0501048_0088337 3300049582 Bacteria 2186
443 Ga0501048_0146297 3300049582 Bacteria 1671
444 Ga0501067_0067652 3300049583 Bacteria 1978
445 Ga0501069_0378597 3300049585 Bacteria 836
446 Ga0501071_0095345 3300049587 Bacteria 2189
447 Ga0501071_0174824 3300049587 Bacteria 1608
448 Ga0501072_0022883 3300049588 Bacteria 4850
449 Ga0501073_0102573 3300049589 Bacteria 1987
450 Ga0501074_0031192 3300049590 Bacteria 3861
451 Ga0501075_0035735 3300049591 Bacteria 3707
452 Ga0501075_0101637 3300049591 Bacteria 2183
453 Ga0501076_0022011 3300049592 Bacteria 4896
454 Ga0501076_0082578 3300049592 Bacteria 2579
455 Ga0501076_0183466 3300049592 Bacteria 1706
456 Ga0501076_0374693 3300049592 Bacteria 1170
457 Ga0501077_0012203 3300049593 Bacteria 5379
458 Ga0501077_0051062 3300049593 Bacteria 2628
459 Ga0501077_0436902 3300049593 Bacteria 838
460 Ga0501199_000300 3300049650 Bacteria 4369
461 Ga0501202_000774 3300049652 Bacteria 4798
462 Ga0501206_000037 3300049653 Bacteria 12338
463 Ga0501207_000402 3300049654 Bacteria 4782
464 Ga0501216_000031 3300049660 Bacteria 11316
465 Ga0501223_006614 3300049663 Bacteria 2392
466 Ga0501227_003851 3300049665 Bacteria 3242
467 Ga0501230_001056 3300049667 Bacteria 3159
468 Ga0501233_003182 3300049668 Bacteria 2944
469 Ga0501235_000039 3300049669 Bacteria 20995
470 Ga0501243_001257 3300049675 Bacteria 3622
471 Ga0501249_000329 3300049679 Bacteria 12986
472 Ga0501251_000098 3300049681 Bacteria 6778
473 Ga0501253_000116 3300049683 Bacteria 5797
474 Ga0501257_000347 3300049686 Bacteria 8971
475 Ga0501258_000423 3300049687 Bacteria 2822
476 Ga0501260_000600 3300049689 Bacteria 2781
477 Ga0501261_000130 3300049690 Bacteria 11215
478 Ga0501221_000979 3300049704 Bacteria 4682
479 Ga0501225_0000375 3300049705 Bacteria 14097
480 Ga0501229_001058 3300049706 Bacteria 3162
481 Ga0501234_000085 3300049707 Bacteria 11399
482 Ga0501245_002062 3300049708 Bacteria 2663
483 Ga0501079_0033167 3300049741 Bacteria 3971
484 Ga0501079_0214542 3300049741 Bacteria 1503
485 Ga0501079_0419591 3300049741 Bacteria 1050
486 Ga0501080_0717205 3300049742 Bacteria 881
487 Ga0501081_0013086 3300049743 Bacteria 5457
488 Ga0501081_0023555 3300049743 Bacteria 4127
489 Ga0501083_0108995 3300049744 Bacteria 1821
490 Ga0501264_000200 3300049761 Bacteria 9730
491 Ga0501265_000527 3300049762 Bacteria 4071
492 Ga0501269_001280 3300049766 Bacteria 3369
493 Ga0501270_000028 3300049767 Bacteria 11398
494 Ga0501271_000170 3300049768 Bacteria 5433
495 Ga0501273_000067 3300049770 Bacteria 6541
496 Ga0501274_001546 3300049771 Bacteria 1763
497 Ga0501279_000192 3300049775 Bacteria 8443
498 Ga0501280_005633 3300049776 Bacteria 1788
499 Ga0501281_02808 3300049777 Bacteria 1256
500 Ga0501283_000097 3300049779 Bacteria 10501
501 Ga0501035_0009501 3300049822 Bacteria 9042
502 Ga0501035_0011193 3300049822 Bacteria 8307
503 Ga0501044_0153946 3300049823 Bacteria 2280
504 Ga0501045_0521749 3300049824 Bacteria 882
505 Ga0501226_000734 3300049853 Bacteria 4439
506 nmdc:mga05p37_131706_c1 3300050507 Bacteria 3068
507 nmdc:mga05p37_646507_c1 3300050507 Bacteria 1185
508 nmdc:mga09592_4865_c1 3300050508 Bacteria 10880
509 nmdc:mga09592_6197_c1 3300050508 Bacteria 9735
510 nmdc:mga0qj67_14611_c1 3300050509 Bacteria 5936
511 nmdc:mga0qj67_2346_c1 3300050509 Bacteria 13477
512 nmdc:mga0qj67_9967_c1 3300050509 Bacteria 7086
513 nmdc:mga06r32_17391_c1 3300050510 Bacteria 6562
514 nmdc:mga06r32_66481_c1 3300050510 Bacteria 3478
515 nmdc:mga06r32_6785_c1 3300050510 Bacteria 10288
516 nmdc:mga08y16_79032_c1 3300050511 Bacteria 3429
517 nmdc:mga0n895_196792_c1 3300050512 Bacteria 2047
518 nmdc:mga0n895_599606_c1 3300050512 Bacteria 1104
519 nmdc:mga08x19_20829_c1 3300050514 Bacteria 4041
520 nmdc:mga08x19_63053_c1 3300050514 Unclassified 2404
521 nmdc:mga0a205_24044_c1 3300050515 Bacteria 5786
522 nmdc:mga0a205_330238_c1 3300050515 Bacteria 1395
523 Ga0495601_0059326 3300053077 Bacteria 2426
524 Ga0495655_0004844 3300053083 Bacteria 2336
525 Ga0495595_0094968 3300053084 Bacteria 1434
526 Ga0495619_0100219 3300053085 Bacteria 1971
527 Ga0501084_0022087 3300054114 Bacteria 5307
528 Ga0590077_013366 3300059426 Bacteria 1707
529 Ga0501082_0016900 3300060353 Bacteria 6282
530 Ga0501082_0025574 3300060353 Bacteria 5087
531 Ga0501082_0423102 3300060353 Bacteria 1163
532 Ga0501082_0529220 3300060353 Bacteria 1031
533 Ga0530510_0108348 3300061734 Bacteria 2033
534 Ga0075363_100012118
535 SwRhRL2b_contig_345107
536 ARCol0yngRDRAFT_1002234
537 JGI24737J22298_10067636
538 JGI26128J50194_1002358
539 JGI26145J50221_1000893
540 Ga0065704_10107941
541 Ga0065712_10002077
542 Ga0065707_10084250
543 Ga0065707_10088055
544 Ga0065707_10147441
545 Ga0065707_10182765
546 Ga0070676_10002174
547 Ga0070676_10462031
548 Ga0070683_100056030
549 Ga0070690_100003994
550 Ga0070670_100036198
551 Ga0068869_100013452
552 Ga0068869_100788238
553 Ga0070666_10002808
554 Ga0070680_100003352
555 Ga0070680_100012497
556 Ga0070680_100024366
557 Ga0070680_100224970
558 Ga0070682_100285053
559 Ga0068868_100130790
560 Ga0068868_100264387
561 Ga0070660_100008995
562 Ga0070689_100011281
563 Ga0070689_100033620
564 Ga0070691_10000339
565 Ga0070691_10010625
566 Ga0070691_10117269
567 Ga0070687_100009496
568 Ga0070687_100018396
569 Ga0070687_100140947
570 Ga0070661_100035700
571 Ga0070692_10020877
572 Ga0070668_100005779
573 Ga0070669_100001470
574 Ga0070675_100035025
575 Ga0070671_100022227
576 Ga0070671_100265885
577 Ga0070674_100000841
578 Ga0070673_100017531
579 Ga0070673_100523410
580 Ga0070673_100724822
581 Ga0070688_100000377
582 Ga0070688_100004950
583 Ga0070659_100002343
584 Ga0070667_100020824
585 Ga0070667_100191243
586 Ga0070709_10041624
587 Ga0070709_10565349
588 Ga0070714_100011089
589 Ga0070714_100137805
590 Ga0070710_10114107
591 Ga0070710_10276959
592 Ga0070701_10001460
593 Ga0070701_10113140
594 Ga0070711_100344201
595 Ga0070705_100012860
596 Ga0070705_100161284
597 Ga0070700_100000203
598 Ga0070700_100001272
599 Ga0070694_100005707
600 Ga0070694_100141950
601 Ga0070694_100322699
602 Ga0070694_100380220
603 Ga0070708_100022937
604 Ga0070708_100086144
605 Ga0070708_100118384
606 Ga0070708_100290067
607 Ga0070708_100403123
608 Ga0070708_100806203
609 Ga0070678_100000694
610 Ga0070678_100030670
611 Ga0070662_100004564
612 Ga0070681_10003975
613 Ga0070681_10056424
614 Ga0068867_100000470
615 Ga0068867_100001004
616 Ga0070685_10000233
617 Ga0070685_10164037
618 Ga0070706_100109579
619 Ga0070706_100139272
620 Ga0070706_100307105
621 Ga0070706_100372879
622 Ga0070707_100000013
623 Ga0070707_100319706
624 Ga0070707_100506953
625 Ga0070698_100017641
626 Ga0070698_100059422
627 Ga0070699_100013189
628 Ga0070699_100021013
629 Ga0070699_100030108
630 Ga0070699_100066719
631 Ga0070699_100090711
632 Ga0070679_100038651
633 Ga0070684_100018809
634 Ga0070697_100004870
635 Ga0070697_100024290
636 Ga0070697_100077596
637 Ga0070697_100133445
638 Ga0070697_100665906
639 Ga0068853_100359010
640 Ga0068853_100522703
641 Ga0070672_100001715
642 Ga0070686_100000098
643 Ga0070686_100004099
644 Ga0070686_100297494
645 Ga0070695_100006451
646 Ga0070695_100060135
647 Ga0070695_100314174
648 Ga0070695_100418529
649 Ga0070696_100027649
650 Ga0070696_100128636
651 Ga0070696_100401356
652 Ga0070693_100012809
653 Ga0070665_100029245
654 Ga0070704_100004801
655 Ga0070704_100389964
656 Ga0068855_100038242
657 Ga0070664_100000732
658 Ga0070664_100004576
659 Ga0068857_100059433
660 Ga0070702_100008555
661 Ga0070702_100089450
662 Ga0070702_100132213
663 Ga0070702_100134462
664 Ga0068852_100153558
665 Ga0068859_100004934
666 Ga0068859_100091247
667 Ga0068859_100122516
668 Ga0068859_100171495
669 Ga0068864_100425450
670 Ga0068866_10010188
671 Ga0068866_10032559
672 Ga0068861_100073395
673 Ga0068861_100473908
674 Ga0068870_10011125
675 Ga0068858_100508981
676 Ga0068860_100184281
677 Ga0068860_100241916
678 Ga0068860_100284028
679 Ga0081455_10001447
680 Ga0070717_10000183
681 Ga0070717_10000784
682 Ga0070717_10319880
683 Ga0075432_10000409
684 Ga0070716_100048318
685 Ga0070716_100084597
686 Ga0070716_100200769
687 Ga0070712_100297025
688 Ga0070712_100376546
689 Ga0097621_100175609
690 Ga0068871_100018098
691 Ga0068871_100037790
692 Ga0075428_100011883
693 Ga0075428_100019792
694 Ga0075430_100002839
695 Ga0075430_100022294
696 Ga0075430_100031839
697 Ga0075431_100010188
698 Ga0075431_100060750
699 Ga0075433_10003245
700 Ga0075433_10088355
701 Ga0075433_10221565
702 Ga0075434_100026866
703 Ga0075434_100046337
704 Ga0075429_100003473
705 Ga0075429_100010339
706 Ga0068865_100001105
707 Ga0075436_100003806
708 Ga0075436_100030634
709 Ga0075436_100032050
710 Ga0075436_100080728
711 Ga0075436_100210392
712 Ga0075436_100242381
713 Ga0097620_100004934
714 Ga0097620_100091247
715 Ga0097620_100122522
716 Ga0097620_100171494
717 Ga0075435_100118029
718 Ga0075435_100186889
719 Ga0099794_10000128
720 Ga0099794_10236590
721 Ga0099795_10035791
722 Ga0105240_10003992
723 Ga0111539_10073643
724 Ga0111539_10143345
725 Ga0105245_10001137
726 Ga0105245_10305620
727 Ga0105247_10042088
728 Ga0114129_10004374
729 Ga0114129_10135726
730 Ga0114129_10275348
731 Ga0114129_10939578
732 Ga0105243_10009230
733 Ga0105243_10042491
734 Ga0105243_10129378
735 Ga0105243_10752909
736 Ga0105241_10040419
737 Ga0105241_10300651
738 Ga0105242_10000070
739 Ga0105242_10011786
740 Ga0105242_10274366
741 Ga0105248_10015376
742 Ga0105248_10245182
743 Ga0105249_10018433
744 Ga0105249_10810330
745 Ga0099796_10066067
746 Ga0105239_10030984
747 Ga0105239_10035710
748 Ga0105239_10039656
749 Ga0105239_10098133
750 Ga0105246_10000272
751 Ga0105246_10265282
752 Ga0157373_10214921
753 Ga0157374_10031464
754 Ga0157378_10050174
755 Ga0157378_10457764
756 Ga0163162_10173880
757 Ga0157375_10054241
758 Ga0157375_10455201
759 Ga0157380_10019988
760 Ga0157380_10021064
761 Ga0157377_10045974
762 Ga0157377_10046780
763 Ga0157379_10007585
764 Ga0157379_10222624
765 Ga0157376_10000505
766 Ga0157376_10017006
767 Ga0163161_10048709
768 Ga0207697_10014801
769 Ga0207642_10004052
770 Ga0207710_10020326
771 Ga0207688_10001321
772 Ga0207645_10000271
773 Ga0207643_10034479
774 Ga0207684_10235922
775 Ga0207684_10341757
776 Ga0207654_10027925
777 Ga0207654_10121676
778 Ga0207660_10001727
779 Ga0207660_10140800
780 Ga0207662_10019320
781 Ga0207662_10023766
782 Ga0207662_10254293
783 Ga0207657_10001016
784 Ga0207652_10207207
785 Ga0207652_10821807
786 Ga0207646_10000011
787 Ga0207646_10000279
788 Ga0207646_10057397
789 Ga0207646_10063272
790 Ga0207681_10001913
791 Ga0207650_10046611
792 Ga0207659_10001295
793 Ga0207659_10075538
794 Ga0207687_10013180
795 Ga0207700_10159214
796 Ga0207664_10931721
797 Ga0207644_10080838
798 Ga0207690_10015002
799 Ga0207706_10000107
800 Ga0207686_10000891
801 Ga0207686_10012690
802 Ga0207686_10316106
803 Ga0207670_10000069
804 Ga0207670_10287104
805 Ga0207669_10001363
806 Ga0207704_10000490
807 Ga0207704_10419708
808 Ga0207665_10025368
809 Ga0207665_10243429
810 Ga0207691_10000472
811 Ga0207691_10027327
812 Ga0207711_10022555
813 Ga0207711_10184599
814 Ga0207689_10002927
815 Ga0207689_10010350
816 Ga0207679_10000745
817 Ga0207679_10016289
818 Ga0207651_10002301
819 Ga0207712_10012758
820 Ga0207712_10056755
821 Ga0207668_10001749
822 Ga0207640_10100896
823 Ga0207658_10010208
824 Ga0207703_10329958
825 Ga0207678_10097559
826 Ga0207708_10001269
827 Ga0207708_10007817
828 Ga0207708_10445370
829 Ga0207641_10342645
830 Ga0207648_10000803
831 Ga0207648_10007374
832 Ga0207648_10263715
833 Ga0207674_10075289
834 Ga0207675_100013849
835 Ga0207675_100037948
836 Ga0207675_100127803
837 Ga0207683_10000072
838 Ga0207683_10068185
839 Ga0207698_10320149
840 Ga0209969_1000011
841 Ga0209967_1000032
842 Ga0209996_1000002
843 Ga0209984_1000154
844 Ga0210000_1000019
845 Ga0209179_1046694
846 Ga0209968_1000004
847 Ga0209968_1011809
848 Ga0209999_1000704
849 Ga0209982_1000035
850 Ga0210002_1000517
851 Ga0210002_1012696
852 Ga0209983_1000126
853 Ga0209588_1000190
854 Ga0209971_1000561
855 Ga0209966_1000037
856 Ga0209998_10000081
857 Ga0209998_10008168
858 Ga0209998_10021122
859 Ga0209998_10024935
860 Ga0209974_10000011
861 Ga0209974_10000211
862 Ga0209974_10092408
863 Ga0207428_10001486
864 Ga0268265_10285036
865 Ga0268264_10300628
866 Ga0268264_10529341
867 Ga0265330_10041652
868 Ga0307408_100334696
869 Ga0307405_10318721
870 Ga0307410_10027422
871 Ga0307406_10051690
872 Ga0307412_10003462
873 Ga0307409_100116984
874 Ga0307411_10103178
875 Ga0373930_0015774
876 Ga0373958_0018179
877 Ga0373926_0011412
878 Ga0373932_0067750
879 Ga0373932_0143865
880 Ga0373936_0076422
881 Ga0373941_0062325
882 Ga0373941_0121898
883 Ga0373954_0047534
884 Ga0373956_0050295
885 Ga0373957_0063936
886 Ga0373960_0014055
887 Ga0373955_0190020
888 Ga0373961_0119349
889 Ga0373924_0020302
890 Ga0373924_0142238
891 Ga0373931_0045704
892 Ga0373931_0324671
893 Ga0373933_0041591
894 Ga0373947_0337287
895 Ga0373937_0041126
896 Ga0436360_0694350
897 Ga0439447_006944
898 Ga0439448_0065155
899 Ga0439432_001323
900 Ga0439452_004573
901 Ga0439462_0124016
902 Ga0451577_0243704
903 Ga0451577_0267572
904 Ga0466957_0215110
905 Ga0451576_0002525
906 Ga0495629_0106768
907 Ga0495580_0192392
908 Ga0495582_0041130
909 Ga0495639_0064210
910 Ga0495584_0225046
911 Ga0495594_0159143
912 Ga0495640_0127827
913 Ga0495622_0199607
914 Ga0495656_0072662
915 Ga0495635_0076476
916 Ga0495659_0061989
917 Ga0495588_0205361
918 Ga0495657_0003628
919 Ga0495581_0006438
920 Ga0495581_0265456
921 Ga0496102_0671275
922 Ga0496108_0165345
923 Ga0496109_0214050
924 Ga0501290_000114
925 Ga0501292_000104
926 Ga0501293_000275
927 Ga0501294_000052
928 Ga0501295_000007
929 Ga0501296_000018
930 Ga0501297_000001
931 Ga0501299_000158
932 Ga0501300_000019
933 Ga0501302_001456
934 Ga0501303_000944
935 Ga0501031_0000046
936 Ga0501031_0002929
937 Ga0501031_0066137
938 Ga0501031_0125664
939 Ga0501032_0025070
940 Ga0501032_0040990
941 Ga0501033_0080954
942 Ga0501033_0098355
943 Ga0501036_0020115
944 Ga0501036_0054410
945 Ga0501036_0315997
946 Ga0501036_0404176
947 Ga0501037_0002195
948 Ga0501037_0009822
949 Ga0501037_0053418
950 Ga0501038_0003595
951 Ga0501039_0000262
952 Ga0501039_0004085
953 Ga0501039_0028677
954 Ga0501039_0047145
955 Ga0501039_0111222
956 Ga0501039_0382171
957 Ga0501040_0030634
958 Ga0501040_0062418
959 Ga0501040_0187518
960 Ga0501040_0193023
961 Ga0501041_0001772
962 Ga0501041_0005444
963 Ga0501041_0062968
964 Ga0501041_0063707
965 Ga0501042_0007596
966 Ga0501042_0030536
967 Ga0501042_0041432
968 Ga0501042_0046681
969 Ga0501042_0054796
970 Ga0501042_0093658
971 Ga0501043_0054142
972 Ga0501046_0000638
973 Ga0501048_0000214
974 Ga0501048_0012124
975 Ga0501048_0088337
976 Ga0501048_0146297
977 Ga0501067_0067652
978 Ga0501069_0378597
979 Ga0501071_0095345
980 Ga0501071_0174824
981 Ga0501072_0022883
982 Ga0501073_0102573
983 Ga0501074_0031192
984 Ga0501075_0035735
985 Ga0501075_0101637
986 Ga0501076_0022011
987 Ga0501076_0082578
988 Ga0501076_0183466
989 Ga0501076_0374693
990 Ga0501077_0012203
991 Ga0501077_0051062
992 Ga0501077_0436902
993 Ga0501199_000300
994 Ga0501202_000774
995 Ga0501206_000037
996 Ga0501207_000402
997 Ga0501216_000031
998 Ga0501223_006614
999 Ga0501227_003851
1000 Ga0501230_001056
1001 Ga0501233_003182
1002 Ga0501235_000039
1003 Ga0501243_001257
1004 Ga0501249_000329
1005 Ga0501251_000098
1006 Ga0501253_000116
1007 Ga0501257_000347
1008 Ga0501258_000423
1009 Ga0501260_000600
1010 Ga0501261_000130
1011 Ga0501221_000979
1012 Ga0501225_0000375
1013 Ga0501229_001058
1014 Ga0501234_000085
1015 Ga0501245_002062
1016 Ga0501079_0033167
1017 Ga0501079_0214542
1018 Ga0501079_0419591
1019 Ga0501080_0717205
1020 Ga0501081_0013086
1021 Ga0501081_0023555
1022 Ga0501083_0108995
1023 Ga0501264_000200
1024 Ga0501265_000527
1025 Ga0501269_001280
1026 Ga0501270_000028
1027 Ga0501271_000170
1028 Ga0501273_000067
1029 Ga0501274_001546
1030 Ga0501279_000192
1031 Ga0501280_005633
1032 Ga0501281_02808
1033 Ga0501283_000097
1034 Ga0501035_0009501
1035 Ga0501035_0011193
1036 Ga0501044_0153946
1037 Ga0501045_0521749
1038 Ga0501226_000734
1039 nmdc:mga05p37_131706_c1
1040 nmdc:mga05p37_646507_c1
1041 nmdc:mga09592_4865_c1
1042 nmdc:mga09592_6197_c1
1043 nmdc:mga0qj67_14611_c1
1044 nmdc:mga0qj67_2346_c1
1045 nmdc:mga0qj67_9967_c1
1046 nmdc:mga06r32_17391_c1
1047 nmdc:mga06r32_66481_c1
1048 nmdc:mga06r32_6785_c1
1049 nmdc:mga08y16_79032_c1
1050 nmdc:mga0n895_196792_c1
1051 nmdc:mga0n895_599606_c1
1052 nmdc:mga08x19_20829_c1
1053 nmdc:mga08x19_63053_c1
1054 nmdc:mga0a205_24044_c1
1055 nmdc:mga0a205_330238_c1
1056 Ga0495601_0059326
1057 Ga0495655_0004844
1058 Ga0495595_0094968
1059 Ga0495619_0100219
1060 Ga0501084_0022087
1061 Ga0590077_013366
1062 Ga0501082_0016900
1063 Ga0501082_0025574
1064 Ga0501082_0423102
1065 Ga0501082_0529220
1066 Ga0530510_0108348

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

26

257

0.97

PF01207

Dus

Dihydrouridine synthase (Dus)

55

148

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u28-assembly1.cif.gz_A crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 0.9519 1 239
4w9t-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9459 1 239
4tx9-assembly1.cif.gz_A crystal structure of hisap from streptomyces sviceus with degraded profar 0.9453 1 237
4x9s-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9446 1 238
2vep-assembly1.cif.gz_A crystal structure of the full length bifunctional enzyme pria 0.9433 1 239
ID Description Score Start End Superfamily
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9652 1 238 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9533 1 238 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.948 2 237 3.20.20.70
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9432 1 237 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9327 2 237 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A521L2H5-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (EC 5.3.1.16) 0.9949 1 124 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A1W1HS59-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9942 1 238 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A6L5C9I7-F1-model_v4 deleted 0.9941 9 228
AF-A0A7C5D084-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 0.994 1 117 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A257XKY7-F1-model_v4 deleted 0.9915 1 116

Map