F460402

General Info

Members Datasets Scaffolds Average Seq Length
533 237 533 442

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10000013|Ga0105238_1000001338
Length 468
Sequence MATTTDAPTVIRSSFHPDVESYEQVNRDADRLLTKPGKGYLALLGMAISLVGLMVIAELHNIWFGLGMSGLTNPVGWGVYITTFVFWVGIGHAGTLISAILYLFRAPWRQSIYRFAEAMTVFAVLTAALFPIIHIGRPWFFYWLLPLPSQRHLWPNFRSPLLWDVFAVTTYLTVSSVFFYIGLIPDIAAARDTAVNPMRKRVYTILSLGWKGTDREWRHFTRAYLFLAALATPLVLSVHSVVSWDFAVSIVPGWHTTIFAPYFVAGAILSGVAMVVTLMVPVHRIFGLGAYFTPTHYDRLAKLLLLTSLIVGYAYGMEYFMAYYSGELFERDVFWDRVTGQYWWAGWSMITFNAFVPQLLWIPRIRRNLNAFFLISIFVNIGMWWERFVIIVPSLAHSYEPWKFMNYHLTWVEASILLGSFGWSIAEIKEVLPPPMKRHDPEEHMEQIDASGPAGLLPTGYFDHAASR

Samples

Sample ID Description Type Environment
1 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
139 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
143 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
179 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 1.13
Rhizosphere 98.5
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26145J50221_1000569 3300003371 Bacteria 3150
2 Ga0065712_10078073 3300005290 Bacteria 3399
3 Ga0065715_10002243 3300005293 Bacteria 5465
4 Ga0065707_10094603 3300005295 Bacteria 3476
5 Ga0070676_10020004 3300005328 Bacteria 3731
6 Ga0070690_100033631 3300005330 Bacteria 3211
7 Ga0070670_100017109 3300005331 Bacteria 6221
8 Ga0070670_100057854 3300005331 Bacteria 3327
9 Ga0068869_100000454 3300005334 Bacteria 22524
10 Ga0068869_100002372 3300005334 Bacteria 11330
11 Ga0070680_100000745 3300005336 Bacteria 22728
12 Ga0070680_100170009 3300005336 Bacteria 1834
13 Ga0070682_100000164 3300005337 Bacteria 50996
14 Ga0068868_100011970 3300005338 Bacteria 6331
15 Ga0070660_100001192 3300005339 Bacteria 17625
16 Ga0070689_100001844 3300005340 Bacteria 13658
17 Ga0070689_100151087 3300005340 Bacteria 1873
18 Ga0070691_10005084 3300005341 Bacteria 5978
19 Ga0070691_10014674 3300005341 Bacteria 3595
20 Ga0070687_100001960 3300005343 Bacteria 7523
21 Ga0070661_100008371 3300005344 Bacteria 7146
22 Ga0070692_10000185 3300005345 Bacteria 16429
23 Ga0070692_10002417 3300005345 Bacteria 7241
24 Ga0070669_100021415 3300005353 Bacteria 4619
25 Ga0070673_100075603 3300005364 Bacteria 2717
26 Ga0070673_100102458 3300005364 Bacteria 2360
27 Ga0070688_100000685 3300005365 Bacteria 16865
28 Ga0070688_100009871 3300005365 Bacteria 5246
29 Ga0070659_100000169 3300005366 Bacteria 50438
30 Ga0070703_10028752 3300005406 Bacteria 1663
31 Ga0070701_10000434 3300005438 Bacteria 14271
32 Ga0070701_10024538 3300005438 Bacteria 2917
33 Ga0070701_10043040 3300005438 Bacteria 2308
34 Ga0070705_100018069 3300005440 Bacteria 3690
35 Ga0070705_100086402 3300005440 Bacteria 1941
36 Ga0070694_100000153 3300005444 Bacteria 35445
37 Ga0070694_100000394 3300005444 Bacteria 23658
38 Ga0070694_100003625 3300005444 Bacteria 9226
39 Ga0070694_100037165 3300005444 Bacteria 3229
40 Ga0070694_100041527 3300005444 Bacteria 3069
41 Ga0070708_100030956 3300005445 Bacteria 4629
42 Ga0070708_100053641 3300005445 Bacteria 3578
43 Ga0070708_100110492 3300005445 Bacteria 2526
44 Ga0070681_10030371 3300005458 Bacteria 5422
45 Ga0070681_10042257 3300005458 Bacteria 4568
46 Ga0068867_100003177 3300005459 Bacteria 11583
47 Ga0068867_100118067 3300005459 Bacteria 2046
48 Ga0070685_10002669 3300005466 Bacteria 9130
49 Ga0070706_100002480 3300005467 Bacteria 18577
50 Ga0070706_100038669 3300005467 Bacteria 4403
51 Ga0070706_100049561 3300005467 Bacteria 3875
52 Ga0070706_100111998 3300005467 Bacteria 2540
53 Ga0070707_100004480 3300005468 Bacteria 13085
54 Ga0070707_100029700 3300005468 Bacteria 5203
55 Ga0070707_100106664 3300005468 Bacteria 2717
56 Ga0070698_100002229 3300005471 Bacteria 21462
57 Ga0070698_100013773 3300005471 Bacteria 8559
58 Ga0070698_100015432 3300005471 Bacteria 8071
59 Ga0070698_100132543 3300005471 Bacteria 2447
60 Ga0070699_100007122 3300005518 Bacteria 9716
61 Ga0070699_100022592 3300005518 Bacteria 5421
62 Ga0070699_100028896 3300005518 Bacteria 4780
63 Ga0070699_100059410 3300005518 Bacteria 3312
64 Ga0070699_100074234 3300005518 Bacteria 2959
65 Ga0070679_100000780 3300005530 Bacteria 27672
66 Ga0070697_100004341 3300005536 Bacteria 10878
67 Ga0070697_100011711 3300005536 Bacteria 6859
68 Ga0070697_100016067 3300005536 Bacteria 5886
69 Ga0070697_100060234 3300005536 Bacteria 3093
70 Ga0070697_100076471 3300005536 Bacteria 2753
71 Ga0068853_100001544 3300005539 Bacteria 16734
72 Ga0070672_100023678 3300005543 Bacteria 4529
73 Ga0070672_100029057 3300005543 Bacteria 4142
74 Ga0070686_100000005 3300005544 Bacteria 248346
75 Ga0070695_100001873 3300005545 Bacteria 11885
76 Ga0070695_100002060 3300005545 Bacteria 11494
77 Ga0070695_100003497 3300005545 Bacteria 9168
78 Ga0070695_100004592 3300005545 Bacteria 8103
79 Ga0070696_100001217 3300005546 Bacteria 16726
80 Ga0070696_100162211 3300005546 Bacteria 1648
81 Ga0070693_100000018 3300005547 Bacteria 62344
82 Ga0070693_100045130 3300005547 Bacteria 2497
83 Ga0070704_100012918 3300005549 Bacteria 5166
84 Ga0070704_100015621 3300005549 Bacteria 4774
85 Ga0070704_100069128 3300005549 Bacteria 2557
86 Ga0068855_100000233 3300005563 Bacteria 70757
87 Ga0070664_100001518 3300005564 Bacteria 18521
88 Ga0068857_100024893 3300005577 Bacteria 5272
89 Ga0068857_100094110 3300005577 Bacteria 2683
90 Ga0068854_100000372 3300005578 Bacteria 28633
91 Ga0068856_100000806 3300005614 Bacteria 33848
92 Ga0068859_100003308 3300005617 Bacteria 16381
93 Ga0068864_100004417 3300005618 Bacteria 11548
94 Ga0068864_100032781 3300005618 Bacteria 4416
95 Ga0068861_100184408 3300005719 Bacteria 1739
96 Ga0068870_10000059 3300005840 Bacteria 34564
97 Ga0068870_10003266 3300005840 Bacteria 6845
98 Ga0068863_100041774 3300005841 Bacteria 4360
99 Ga0068863_100249167 3300005841 Bacteria 1715
100 Ga0068858_100026041 3300005842 Bacteria 5439
101 Ga0068860_100003577 3300005843 Bacteria 15976
102 Ga0068860_100017134 3300005843 Bacteria 7063
103 Ga0068860_100075469 3300005843 Bacteria 3207
104 Ga0068862_100004793 3300005844 Bacteria 11385
105 Ga0068862_100096325 3300005844 Bacteria 2583
106 Ga0068862_100127188 3300005844 Bacteria 2251
107 Ga0081455_10001251 3300005937 Bacteria 31750
108 Ga0081455_10040979 3300005937 Bacteria 4079
109 Ga0081538_10003971 3300005981 Bacteria 13780
110 Ga0081540_1016094 3300005983 Bacteria 4703
111 Ga0081539_10000092 3300005985 Bacteria 208968
112 Ga0070712_100001609 3300006175 Bacteria 13807
113 Ga0068871_100046576 3300006358 Bacteria 3493
114 Ga0075428_100000421 3300006844 Bacteria 42169
115 Ga0075428_100001299 3300006844 Bacteria 26507
116 Ga0075428_100002483 3300006844 Bacteria 20019
117 Ga0075428_100007223 3300006844 Bacteria 12303
118 Ga0075428_100019738 3300006844 Bacteria 7457
119 Ga0075428_100023192 3300006844 Bacteria 6864
120 Ga0075428_100030256 3300006844 Bacteria 5989
121 Ga0075430_100000103 3300006846 Bacteria 51038
122 Ga0075430_100000301 3300006846 Bacteria 34954
123 Ga0075430_100000341 3300006846 Bacteria 33734
124 Ga0075430_100002061 3300006846 Bacteria 16580
125 Ga0075430_100011035 3300006846 Bacteria 7656
126 Ga0075430_100039423 3300006846 Bacteria 4000
127 Ga0075430_100098720 3300006846 Bacteria 2439
128 Ga0075431_100000072 3300006847 Bacteria 58754
129 Ga0075431_100000339 3300006847 Bacteria 36926
130 Ga0075431_100000470 3300006847 Bacteria 33363
131 Ga0075431_100002219 3300006847 Bacteria 18607
132 Ga0075431_100002902 3300006847 Bacteria 16586
133 Ga0075431_100004853 3300006847 Bacteria 13244
134 Ga0075431_100005382 3300006847 Bacteria 12638
135 Ga0075431_100014905 3300006847 Bacteria 7870
136 Ga0075433_10000783 3300006852 Bacteria 21957
137 Ga0075433_10003027 3300006852 Bacteria 12915
138 Ga0075433_10005303 3300006852 Bacteria 10112
139 Ga0075433_10009022 3300006852 Bacteria 7964
140 Ga0075433_10015010 3300006852 Bacteria 6342
141 Ga0075433_10054172 3300006852 Bacteria 3499
142 Ga0075433_10067896 3300006852 Bacteria 3129
143 Ga0075433_10157932 3300006852 Bacteria 2018
144 Ga0075434_100001918 3300006871 Bacteria 18027
145 Ga0075434_100003368 3300006871 Bacteria 14308
146 Ga0075434_100014433 3300006871 Bacteria 7551
147 Ga0075434_100016705 3300006871 Bacteria 7059
148 Ga0075434_100023882 3300006871 Bacteria 5967
149 Ga0075434_100025611 3300006871 Bacteria 5772
150 Ga0075434_100031771 3300006871 Bacteria 5206
151 Ga0075434_100063510 3300006871 Bacteria 3675
152 Ga0075434_100074923 3300006871 Bacteria 3378
153 Ga0075434_100080694 3300006871 Bacteria 3250
154 Ga0075429_100000014 3300006880 Bacteria 79603
155 Ga0075429_100000169 3300006880 Bacteria 41871
156 Ga0075429_100000305 3300006880 Bacteria 34736
157 Ga0075429_100010608 3300006880 Bacteria 7971
158 Ga0075429_100047570 3300006880 Bacteria 3731
159 Ga0075429_100098795 3300006880 Bacteria 2547
160 Ga0075436_100001117 3300006914 Bacteria 18139
161 Ga0075436_100020775 3300006914 Bacteria 4505
162 Ga0097620_100003308 3300006931 Bacteria 16381
163 Ga0075435_100000798 3300007076 Bacteria 19609
164 Ga0075435_100010585 3300007076 Bacteria 6750
165 Ga0075435_100026498 3300007076 Bacteria 4524
166 Ga0075435_100030401 3300007076 Bacteria 4246
167 Ga0075435_100046221 3300007076 Bacteria 3491
168 Ga0075435_100226040 3300007076 Bacteria 1590
169 Ga0099794_10002669 3300007265 Bacteria 6641
170 Ga0099794_10006698 3300007265 Bacteria 4681
171 Ga0111539_10000557 3300009094 Bacteria 47767
172 Ga0111539_10008896 3300009094 Bacteria 12713
173 Ga0111539_10013419 3300009094 Bacteria 10242
174 Ga0111539_10159564 3300009094 Bacteria 2638
175 Ga0111539_10166243 3300009094 Bacteria 2579
176 Ga0105247_10025279 3300009101 Bacteria 3582
177 Ga0114129_10000704 3300009147 Bacteria 42132
178 Ga0114129_10000726 3300009147 Bacteria 41775
179 Ga0114129_10001085 3300009147 Bacteria 35711
180 Ga0114129_10002365 3300009147 Bacteria 26178
181 Ga0114129_10006119 3300009147 Bacteria 17065
182 Ga0114129_10009632 3300009147 Bacteria 13784
183 Ga0114129_10027225 3300009147 Bacteria 8094
184 Ga0114129_10030802 3300009147 Bacteria 7587
185 Ga0114129_10034435 3300009147 Bacteria 7153
186 Ga0114129_10039569 3300009147 Bacteria 6648
187 Ga0114129_10046202 3300009147 Bacteria 6121
188 Ga0114129_10083058 3300009147 Bacteria 4451
189 Ga0114129_10294797 3300009147 Bacteria 2163
190 Ga0114129_10418542 3300009147 Bacteria 1763
191 Ga0105243_10005054 3300009148 Bacteria 10351
192 Ga0105241_10002337 3300009174 Bacteria 14247
193 Ga0105241_10133394 3300009174 Bacteria 2013
194 Ga0105248_10153001 3300009177 Bacteria 2603
195 Ga0105248_10294887 3300009177 Bacteria 1826
196 Ga0105237_10139440 3300009545 Bacteria 2419
197 Ga0105238_10000013 3300009551 Bacteria 257248
198 Ga0105239_10056136 3300010375 Bacteria 4319
199 Ga0157373_10007582 3300013100 Bacteria 8065
200 Ga0157373_10093046 3300013100 Bacteria 2123
201 Ga0157371_10036447 3300013102 Bacteria 3522
202 Ga0157370_10104620 3300013104 Bacteria 2650
203 Ga0157378_10056755 3300013297 Bacteria 3490
204 Ga0157378_10262644 3300013297 Bacteria 1657
205 Ga0163162_10037969 3300013306 Bacteria 4807
206 Ga0157375_10221895 3300013308 Bacteria 2048
207 Ga0163163_10017157 3300014325 Bacteria 6746
208 Ga0207653_10000836 3300025885 Bacteria 10267
209 Ga0207688_10033944 3300025901 Bacteria 2823
210 Ga0207647_10055210 3300025904 Bacteria 2441
211 Ga0207645_10000340 3300025907 Bacteria 39096
212 Ga0207645_10108854 3300025907 Bacteria 1793
213 Ga0207643_10000105 3300025908 Bacteria 57132
214 Ga0207684_10000242 3300025910 Bacteria 81735
215 Ga0207684_10007913 3300025910 Bacteria 9500
216 Ga0207684_10015825 3300025910 Bacteria 6485
217 Ga0207684_10023335 3300025910 Bacteria 5282
218 Ga0207684_10065669 3300025910 Bacteria 3081
219 Ga0207684_10075817 3300025910 Bacteria 2858
220 Ga0207684_10084029 3300025910 Bacteria 2711
221 Ga0207684_10089683 3300025910 Bacteria 2620
222 Ga0207684_10100792 3300025910 Bacteria 2468
223 Ga0207684_10145131 3300025910 Bacteria 2041
224 Ga0207684_10257066 3300025910 Bacteria 1507
225 Ga0207707_10000034 3300025912 Bacteria 152677
226 Ga0207707_10095175 3300025912 Bacteria 2603
227 Ga0207693_10019184 3300025915 Bacteria 5442
228 Ga0207660_10001489 3300025917 Bacteria 15764
229 Ga0207660_10017413 3300025917 Bacteria 4774
230 Ga0207660_10018530 3300025917 Bacteria 4642
231 Ga0207660_10075616 3300025917 Bacteria 2461
232 Ga0207662_10012480 3300025918 Bacteria 4731
233 Ga0207657_10000066 3300025919 Bacteria 98663
234 Ga0207649_10003921 3300025920 Bacteria 8118
235 Ga0207652_10000740 3300025921 Bacteria 31505
236 Ga0207646_10000574 3300025922 Bacteria 48122
237 Ga0207646_10004220 3300025922 Bacteria 15726
238 Ga0207646_10008590 3300025922 Bacteria 10208
239 Ga0207646_10045524 3300025922 Bacteria 3939
240 Ga0207646_10067055 3300025922 Bacteria 3204
241 Ga0207646_10081770 3300025922 Bacteria 2888
242 Ga0207646_10181986 3300025922 Bacteria 1898
243 Ga0207681_10013079 3300025923 Bacteria 5132
244 Ga0207694_10000026 3300025924 Bacteria 257192
245 Ga0207650_10042574 3300025925 Bacteria 3331
246 Ga0207690_10001729 3300025932 Bacteria 13423
247 Ga0207686_10036827 3300025934 Bacteria 2949
248 Ga0207709_10039249 3300025935 Bacteria 2827
249 Ga0207670_10000227 3300025936 Bacteria 36201
250 Ga0207670_10009664 3300025936 Bacteria 5514
251 Ga0207670_10055904 3300025936 Bacteria 2669
252 Ga0207665_10004527 3300025939 Bacteria 9220
253 Ga0207691_10026319 3300025940 Bacteria 5460
254 Ga0207691_10047273 3300025940 Bacteria 3949
255 Ga0207689_10000365 3300025942 Bacteria 42716
256 Ga0207689_10004878 3300025942 Bacteria 12094
257 Ga0207689_10009184 3300025942 Bacteria 8556
258 Ga0207679_10000248 3300025945 Bacteria 41174
259 Ga0207651_10033513 3300025960 Bacteria 3314
260 Ga0207651_10106548 3300025960 Bacteria 2093
261 Ga0207712_10014025 3300025961 Bacteria 5144
262 Ga0207640_10003855 3300025981 Bacteria 8092
263 Ga0207677_10021867 3300026023 Bacteria 3919
264 Ga0207703_10017210 3300026035 Bacteria 5640
265 Ga0207678_10002576 3300026067 Bacteria 16517
266 Ga0207702_10002703 3300026078 Bacteria 16651
267 Ga0207641_10060699 3300026088 Bacteria 3223
268 Ga0207641_10081442 3300026088 Bacteria 2811
269 Ga0207641_10109755 3300026088 Bacteria 2444
270 Ga0207648_10000856 3300026089 Bacteria 34281
271 Ga0207648_10057155 3300026089 Bacteria 3404
272 Ga0207648_10144012 3300026089 Bacteria 2102
273 Ga0207676_10013750 3300026095 Bacteria 5811
274 Ga0207676_10111649 3300026095 Bacteria 2288
275 Ga0207676_10158536 3300026095 Bacteria 1958
276 Ga0207674_10000050 3300026116 Bacteria 116782
277 Ga0207674_10091008 3300026116 Bacteria 3042
278 Ga0207675_100059243 3300026118 Bacteria 3573
279 Ga0209973_1000647 3300027252 Bacteria 2727
280 Ga0209996_1002066 3300027395 Bacteria 2476
281 Ga0209995_1000625 3300027471 Bacteria 5452
282 Ga0209970_1001083 3300027614 Bacteria 4806
283 Ga0210002_1001659 3300027617 Bacteria 3172
284 Ga0209983_1000978 3300027665 Bacteria 6293
285 Ga0209971_1000128 3300027682 Bacteria 22582
286 Ga0209966_1000071 3300027695 Bacteria 45482
287 Ga0209998_10000113 3300027717 Bacteria 32266
288 Ga0209974_10003286 3300027876 Bacteria 5845
289 Ga0207428_10000033 3300027907 Bacteria 232081
290 Ga0207428_10000054 3300027907 Bacteria 175237
291 Ga0207428_10000213 3300027907 Bacteria 80079
292 Ga0207428_10008425 3300027907 Bacteria 9309
293 Ga0207428_10040774 3300027907 Bacteria 3762
294 Ga0268265_10127253 3300028380 Bacteria 2110
295 Ga0268264_10004690 3300028381 Bacteria 11621
296 Ga0268264_10029403 3300028381 Bacteria 4500
297 Ga0265326_10002394 3300028558 Bacteria 6325
298 Ga0265319_1000340 3300028563 Bacteria 34215
299 Ga0265319_1002588 3300028563 Bacteria 9755
300 Ga0265334_10003273 3300028573 Bacteria 7393
301 Ga0265318_10002166 3300028577 Bacteria 10647
302 Ga0265323_10001268 3300028653 Bacteria 12645
303 Ga0265322_10001951 3300028654 Bacteria 6523
304 Ga0265336_10000109 3300028666 Bacteria 62807
305 Ga0265338_10001759 3300028800 Bacteria 34223
306 Ga0265338_10015892 3300028800 Bacteria 8236
307 Ga0265324_10001359 3300029957 Bacteria 14225
308 Ga0265330_10004782 3300031235 Bacteria 6836
309 Ga0265332_10001135 3300031238 Bacteria 15461
310 Ga0265320_10007425 3300031240 Bacteria 6801
311 Ga0265320_10028634 3300031240 Bacteria 2890
312 Ga0265325_10007958 3300031241 Bacteria 6295
313 Ga0265329_10002540 3300031242 Bacteria 8236
314 Ga0265339_10001023 3300031249 Bacteria 21319
315 Ga0265331_10006936 3300031250 Bacteria 6615
316 Ga0265316_10011778 3300031344 Bacteria 7866
317 Ga0265316_10021430 3300031344 Bacteria 5473
318 Ga0307408_100020223 3300031548 Bacteria 4490
319 Ga0307408_100056849 3300031548 Bacteria 2838
320 Ga0265313_10000728 3300031595 Bacteria 33869
321 Ga0265314_10005079 3300031711 Bacteria 11994
322 Ga0265342_10005224 3300031712 Bacteria 9964
323 Ga0307405_10023338 3300031731 Bacteria 3515
324 Ga0307410_10161391 3300031852 Bacteria 1680
325 Ga0307409_100028659 3300031995 Bacteria 3972
326 Ga0307411_10056470 3300032005 Bacteria 2588
327 Ga0373959_0000126 3300034820 Bacteria 16941
328 Ga0373959_0005494 3300034820 Bacteria 2078
329 Ga0373940_0001138 3300035088 Bacteria 4653
330 Ga0373940_0009158 3300035088 Bacteria 2295
331 Ga0373949_0002486 3300035090 Bacteria 4717
332 Ga0373932_0021798 3300035112 Bacteria 1695
333 Ga0373941_0025243 3300035115 Bacteria 1715
334 Ga0373960_0005764 3300035121 Bacteria 2881
335 Ga0373942_0007939 3300035207 Bacteria 2467
336 Ga0373961_0013609 3300035241 Bacteria 2054
337 Ga0373931_0001032 3300035691 Bacteria 11771
338 Ga0373933_0038008 3300035724 Bacteria 2827
339 Ga0395900_0003509 3300037418 Bacteria 16929
340 Ga0395900_0005123 3300037418 Bacteria 13764
341 Ga0395900_0038364 3300037418 Bacteria 4937
342 Ga0395898_0176777 3300037466 Bacteria 2040
343 Ga0395898_0191618 3300037466 Bacteria 1953
344 Ga0395905_0032970 3300037471 Bacteria 4869
345 Ga0395905_0188914 3300037471 Bacteria 1933
346 Ga0436364_1507082 3300037853 Bacteria 10580
347 Ga0395901_0001380 3300038443 Bacteria 25404
348 Ga0395901_0008385 3300038443 Bacteria 10447
349 Ga0395901_0011843 3300038443 Bacteria 8842
350 Ga0395901_0022100 3300038443 Bacteria 6518
351 Ga0242420_006184 3300038996 Bacteria 1884
352 Ga0439450_004526 3300042008 Bacteria 2381
353 Ga0439455_0007607 3300042012 Bacteria 2297
354 Ga0450889_004869 3300042144 Bacteria 1330
355 Ga0439464_0008575 3300042439 Bacteria 2679
356 Ga0439460_0004618 3300042461 Bacteria 3361
357 Ga0453683_0018255 3300044673 Bacteria 4505
358 Ga0453683_0038740 3300044673 Bacteria 2997
359 Ga0453683_0048876 3300044673 Bacteria 2652
360 Ga0466961_0003380 3300044693 Bacteria 9962
361 Ga0453684_0025528 3300044712 Bacteria 8575
362 Ga0453684_0099104 3300044712 Bacteria 3571
363 Ga0451576_0005487 3300045051 Bacteria 15871
364 Ga0451576_0012143 3300045051 Bacteria 9711
365 Ga0451576_0033448 3300045051 Bacteria 5465
366 Ga0451576_0038895 3300045051 Bacteria 5035
367 Ga0451576_0092310 3300045051 Bacteria 3149
368 Ga0451576_0199194 3300045051 Bacteria 2091
369 Ga0451576_0209941 3300045051 Bacteria 2033
370 Ga0495603_0151421 3300046455 Bacteria 1347
371 Ga0495580_0023796 3300046472 Bacteria 4492
372 Ga0495580_0046572 3300046472 Bacteria 3076
373 Ga0495584_0029594 3300046491 Bacteria 2777
374 Ga0495618_0000568 3300046514 Bacteria 26224
375 Ga0495628_0017705 3300046516 Bacteria 5922
376 Ga0495643_0000144 3300046522 Bacteria 114698
377 Ga0495642_0013888 3300046528 Bacteria 3119
378 Ga0495587_0011898 3300046536 Bacteria 5501
379 Ga0495600_0046920 3300046809 Bacteria 2818
380 Ga0496102_0014983 3300048905 Bacteria 6748
381 Ga0496102_0044734 3300048905 Bacteria 4019
382 Ga0496106_0166736 3300048909 Bacteria 1744
383 Ga0496108_0138779 3300048911 Bacteria 2094
384 Ga0496108_0223056 3300048911 Bacteria 1638
385 Ga0496110_0044500 3300048913 Bacteria 3877
386 Ga0501033_0009404 3300049570 Bacteria 7527
387 Ga0501033_0018150 3300049570 Bacteria 5316
388 Ga0501034_0065130 3300049571 Bacteria 3657
389 Ga0501036_0129057 3300049572 Bacteria 2135
390 Ga0501036_0166351 3300049572 Bacteria 1859
391 Ga0501037_0140631 3300049573 Bacteria 1728
392 Ga0501038_0048782 3300049574 Bacteria 3663
393 Ga0501038_0142387 3300049574 Bacteria 1961
394 Ga0501039_0012773 3300049575 Bacteria 6419
395 Ga0501039_0114173 3300049575 Bacteria 2113
396 Ga0501040_0012627 3300049576 Bacteria 5540
397 Ga0501040_0159816 3300049576 Bacteria 1592
398 Ga0501041_0001796 3300049577 Bacteria 12024
399 Ga0501042_0008891 3300049578 Bacteria 6661
400 Ga0501042_0059543 3300049578 Bacteria 2727
401 Ga0501046_0009916 3300049580 Bacteria 8207
402 Ga0501046_0050119 3300049580 Bacteria 3299
403 Ga0501046_0090523 3300049580 Bacteria 2354
404 Ga0501047_0001551 3300049581 Bacteria 22489
405 Ga0501047_0015428 3300049581 Bacteria 7278
406 Ga0501047_0020029 3300049581 Bacteria 6424
407 Ga0501067_0020043 3300049583 Bacteria 3701
408 Ga0501071_0046897 3300049587 Bacteria 3104
409 Ga0501071_0075474 3300049587 Bacteria 2461
410 Ga0501072_0018367 3300049588 Bacteria 5383
411 Ga0501072_0026081 3300049588 Bacteria 4554
412 Ga0501072_0088006 3300049588 Bacteria 2464
413 Ga0501074_0002552 3300049590 Bacteria 12706
414 Ga0501075_0000742 3300049591 Bacteria 20270
415 Ga0501075_0020507 3300049591 Bacteria 4810
416 Ga0501075_0024846 3300049591 Bacteria 4398
417 Ga0501075_0037146 3300049591 Bacteria 3638
418 Ga0501075_0068867 3300049591 Bacteria 2674
419 Ga0501075_0111618 3300049591 Bacteria 2079
420 Ga0501076_0002350 3300049592 Bacteria 12941
421 Ga0501076_0002927 3300049592 Bacteria 11839
422 Ga0501076_0043690 3300049592 Bacteria 3532
423 Ga0501076_0226640 3300049592 Bacteria 1528
424 Ga0501077_0096914 3300049593 Bacteria 1869
425 Ga0501079_0000847 3300049741 Bacteria 20853
426 Ga0501079_0001826 3300049741 Bacteria 15236
427 Ga0501079_0007619 3300049741 Bacteria 8199
428 Ga0501079_0010075 3300049741 Bacteria 7177
429 Ga0501081_0003354 3300049743 Bacteria 10189
430 Ga0501081_0003988 3300049743 Bacteria 9456
431 Ga0501081_0007247 3300049743 Bacteria 7209
432 Ga0501081_0009320 3300049743 Bacteria 6396
433 Ga0501081_0012977 3300049743 Bacteria 5481
434 Ga0501081_0112150 3300049743 Bacteria 1936
435 Ga0501083_0003803 3300049744 Bacteria 10601
436 Ga0501035_0000352 3300049822 Bacteria 52889
437 Ga0501044_0002748 3300049823 Bacteria 20018
438 Ga0501044_0047301 3300049823 Bacteria 4449
439 Ga0501045_0001154 3300049824 Bacteria 17499
440 Ga0501045_0010020 3300049824 Bacteria 6629
441 Ga0501045_0044819 3300049824 Bacteria 3222
442 nmdc:mga05p37_11107_c1 3300050507 Bacteria 10702
443 nmdc:mga05p37_132342_c1 3300050507 Bacteria 3060
444 nmdc:mga05p37_16568_c1 3300050507 Bacteria 8878
445 nmdc:mga05p37_18659_c1 3300050507 Bacteria 8384
446 nmdc:mga05p37_20033_c1 3300050507 Bacteria 8094
447 nmdc:mga05p37_20869_c1 3300050507 Bacteria 7928
448 nmdc:mga05p37_21239_c1 3300050507 Bacteria 7859
449 nmdc:mga05p37_25637_c1 3300050507 Bacteria 7172
450 nmdc:mga05p37_293005_c1 3300050507 Bacteria 1936
451 nmdc:mga05p37_320782_c1 3300050507 Bacteria 1834
452 nmdc:mga05p37_37004_c1 3300050507 Bacteria 5986
453 nmdc:mga05p37_4529_c1 3300050507 Bacteria 16242
454 nmdc:mga05p37_4740_c1 3300050507 Bacteria 15888
455 nmdc:mga05p37_4991_c1 3300050507 Bacteria 15553
456 nmdc:mga05p37_571_c1 3300050507 Bacteria 40489
457 nmdc:mga05p37_58063_c1 3300050507 Bacteria 4766
458 nmdc:mga05p37_58080_c1 3300050507 Bacteria 4765
459 nmdc:mga05p37_64990_c1 3300050507 Bacteria 4490
460 nmdc:mga05p37_99662_c1 3300050507 Bacteria 3578
461 nmdc:mga09592_112151_c1 3300050508 Bacteria 2340
462 nmdc:mga09592_116180_c1 3300050508 Bacteria 2296
463 nmdc:mga09592_22323_c1 3300050508 Bacteria 5223
464 nmdc:mga09592_2684_c1 3300050508 Bacteria 14393
465 nmdc:mga09592_39801_c1 3300050508 Bacteria 3949
466 nmdc:mga09592_45364_c1 3300050508 Bacteria 3703
467 nmdc:mga09592_5004_c1 3300050508 Bacteria 10743
468 nmdc:mga09592_5510_c1 3300050508 Bacteria 10298
469 nmdc:mga09592_56_c1 3300050508 Bacteria 62143
470 nmdc:mga09592_596_c1 3300050508 Bacteria 27392
471 nmdc:mga09592_84099_c1 3300050508 Bacteria 2713
472 nmdc:mga0qj67_10290_c1 3300050509 Bacteria 6985
473 nmdc:mga0qj67_143391_c1 3300050509 Bacteria 1937
474 nmdc:mga0qj67_40400_c1 3300050509 Bacteria 3666
475 nmdc:mga0qj67_54404_c1 3300050509 Bacteria 3169
476 nmdc:mga0qj67_711_c1 3300050509 Bacteria 22648
477 nmdc:mga0qj67_761_c1 3300050509 Bacteria 21944
478 nmdc:mga06r32_1136_c1 3300050510 Bacteria 23891
479 nmdc:mga06r32_132_c1 3300050510 Bacteria 54848
480 nmdc:mga06r32_14962_c1 3300050510 Bacteria 7043
481 nmdc:mga06r32_16935_c1 3300050510 Bacteria 6649
482 nmdc:mga06r32_414_c1 3300050510 Bacteria 35862
483 nmdc:mga06r32_42468_c1 3300050510 Bacteria 4323
484 nmdc:mga06r32_4664_c1 3300050510 Bacteria 12301
485 nmdc:mga06r32_51433_c1 3300050510 Bacteria 3943
486 nmdc:mga06r32_739_c1 3300050510 Bacteria 28672
487 nmdc:mga06r32_8388_c1 3300050510 Bacteria 9306
488 nmdc:mga08y16_324528_c1 3300050511 Bacteria 1584
489 nmdc:mga08y16_3353_c1 3300050511 Bacteria 16592
490 nmdc:mga08y16_569_c1 3300050511 Bacteria 34274
491 nmdc:mga08y16_61998_c1 3300050511 Bacteria 3905
492 nmdc:mga08y16_751_c1 3300050511 Bacteria 30845
493 nmdc:mga08y16_9111_c1 3300050511 Bacteria 10423
494 nmdc:mga0n895_191_c1 3300050512 Bacteria 38035
495 nmdc:mga0n895_228983_c1 3300050512 Bacteria 1887
496 nmdc:mga0n895_23889_c1 3300050512 Bacteria 5753
497 nmdc:mga0n895_247213_c1 3300050512 Bacteria 1810
498 nmdc:mga0n895_26_c1 3300050512 Bacteria 89958
499 nmdc:mga0n895_33499_c1 3300050512 Bacteria 4938
500 nmdc:mga0n895_33747_c1 3300050512 Bacteria 4920
501 nmdc:mga0n895_34226_c1 3300050512 Bacteria 4888
502 nmdc:mga0n895_67872_c1 3300050512 Bacteria 3532
503 nmdc:mga0n895_9325_c1 3300050512 Bacteria 8577
504 nmdc:mga0n895_99867_c1 3300050512 Bacteria 2911
505 nmdc:mga0rr50_10638_c1 3300050513 Bacteria 5849
506 nmdc:mga0rr50_176309_c1 3300050513 Bacteria 1745
507 nmdc:mga0rr50_8223_c1 3300050513 Bacteria 6482
508 nmdc:mga08x19_18789_c1 3300050514 Bacteria 4237
509 nmdc:mga08x19_399_c1 3300050514 Bacteria 30610
510 nmdc:mga0a205_10976_c1 3300050515 Bacteria 8337
511 nmdc:mga0a205_131694_c1 3300050515 Bacteria 2401
512 nmdc:mga0a205_19323_c1 3300050515 Bacteria 6423
513 nmdc:mga0a205_32_c1 3300050515 Bacteria 79060
514 nmdc:mga0a205_33741_c1 3300050515 Bacteria 4908
515 nmdc:mga0a205_43821_c1 3300050515 Bacteria 4313
516 nmdc:mga0a205_50762_c1 3300050515 Bacteria 4005
517 nmdc:mga0a205_5347_c1 3300050515 Bacteria 11573
518 nmdc:mga0a205_55533_c1 3300050515 Bacteria 3825
519 nmdc:mga0a205_57716_c1 3300050515 Bacteria 3748
520 nmdc:mga0a205_65327_c1 3300050515 Bacteria 3515
521 Ga0500628_001016 3300053129 Bacteria 4903
522 Ga0501084_0000494 3300054114 Bacteria 30250
523 Ga0501084_0004153 3300054114 Bacteria 11804
524 Ga0501084_0008622 3300054114 Bacteria 8428
525 Ga0501084_0012477 3300054114 Bacteria 7041
526 Ga0501084_0055866 3300054114 Bacteria 3304
527 Ga0501084_0139170 3300054114 Bacteria 2044
528 Ga0501082_0000376 3300060353 Bacteria 39540
529 Ga0501082_0005247 3300060353 Bacteria 11261
530 Ga0501082_0012779 3300060353 Bacteria 7216
531 Ga0501082_0016069 3300060353 Bacteria 6439
532 Ga0501082_0043237 3300060353 Bacteria 3884
533 Ga0530510_0035303 3300061734 Bacteria 3603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0065130 Ga0501034_0065130_79_1389 360
2 3300045051 Ga0451576_0209941 Ga0451576_0209941_875_2023 370
3 3300042144 Ga0450889_004869 Ga0450889_004869_157_1311 374
4 3300049576 Ga0501040_0159816 Ga0501040_0159816_413_1570 374
5 3300046455 Ga0495603_0151421 Ga0495603_0151421_11_1171 375
6 3300009094 Ga0111539_10013419 Ga0111539_100134195 378
7 3300006844 Ga0075428_100030256 Ga0075428_1000302564 379
8 3300006847 Ga0075431_100002219 Ga0075431_10000221916 379
9 3300006880 Ga0075429_100047570 Ga0075429_1000475702 379
10 3300009147 Ga0114129_10046202 Ga0114129_100462022 379
11 3300050507 nmdc:mga05p37_4529_c1 nmdc:mga05p37_4529_c1_2636_3997 379
12 3300050508 nmdc:mga09592_39801_c1 nmdc:mga09592_39801_c1_61_1422 379
13 3300050510 nmdc:mga06r32_8388_c1 nmdc:mga06r32_8388_c1_955_2316 379
14 3300038996 Ga0242420_006184 Ga0242420_006184_19_1203 381
15 3300049583 Ga0501067_0020043 Ga0501067_0020043_37_1338 381
16 3300006852 Ga0075433_10054172 Ga0075433_100541723 383
17 3300050515 nmdc:mga0a205_131694_c1 nmdc:mga0a205_131694_c1_558_1859 384
18 3300037418 Ga0395900_0005123 Ga0395900_0005123_528_1820 385
19 3300037466 Ga0395898_0191618 Ga0395898_0191618_417_1709 385
20 3300038443 Ga0395901_0001380 Ga0395901_0001380_14002_15294 385
21 3300048911 Ga0496108_0223056 Ga0496108_0223056_340_1605 387
22 3300049591 Ga0501075_0068867 Ga0501075_0068867_1410_2657 387
23 3300049578 Ga0501042_0059543 Ga0501042_0059543_1452_2702 389
24 3300009094 Ga0111539_10159564 Ga0111539_101595643 390
25 3300027907 Ga0207428_10008425 Ga0207428_100084253 390
26 3300049570 Ga0501033_0009404 Ga0501033_0009404_1096_2526 390
27 3300049580 Ga0501046_0050119 Ga0501046_0050119_156_1586 390
28 3300049581 Ga0501047_0001551 Ga0501047_0001551_7588_9018 390
29 3300049581 Ga0501047_0015428 Ga0501047_0015428_222_1652 390
30 3300049822 Ga0501035_0000352 Ga0501035_0000352_42345_43775 390
31 3300049823 Ga0501044_0002748 Ga0501044_0002748_2716_4146 390
32 3300049823 Ga0501044_0047301 Ga0501044_0047301_2466_3896 390
33 3300050511 nmdc:mga08y16_9111_c1 nmdc:mga08y16_9111_c1_3270_4658 390
34 3300006846 Ga0075430_100039423 Ga0075430_1000394234 391
35 3300006847 Ga0075431_100014905 Ga0075431_1000149054 391
36 3300050507 nmdc:mga05p37_37004_c1 nmdc:mga05p37_37004_c1_2172_3527 391
37 3300050508 nmdc:mga09592_5510_c1 nmdc:mga09592_5510_c1_1140_2495 391
38 3300050509 nmdc:mga0qj67_40400_c1 nmdc:mga0qj67_40400_c1_1777_3132 391
39 3300050510 nmdc:mga06r32_16935_c1 nmdc:mga06r32_16935_c1_4152_5507 391
40 3300035724 Ga0373933_0038008 Ga0373933_0038008_478_1860 392
41 3300046516 Ga0495628_0017705 Ga0495628_0017705_2104_3474 392
42 3300046536 Ga0495587_0011898 Ga0495587_0011898_3486_4868 392
43 3300046809 Ga0495600_0046920 Ga0495600_0046920_921_2303 392
44 3300037853 Ga0436364_1507082 Ga0436364_1507082_3131_4549 393
45 3300006844 Ga0075428_100007223 Ga0075428_1000072234 394
46 3300006846 Ga0075430_100000301 Ga0075430_10000030127 394
47 3300006847 Ga0075431_100000339 Ga0075431_10000033915 394
48 3300006880 Ga0075429_100000014 Ga0075429_10000001426 394
49 3300006844 Ga0075428_100019738 Ga0075428_1000197386 395
50 3300050507 nmdc:mga05p37_320782_c1 nmdc:mga05p37_320782_c1_495_1799 396
51 3300044693 Ga0466961_0003380 Ga0466961_0003380_4042_5463 399
52 3300005330 Ga0070690_100033631 Ga0070690_1000336312 400
53 3300005471 Ga0070698_100132543 Ga0070698_1001325431 400
54 3300005937 Ga0081455_10040979 Ga0081455_100409794 400
55 3300037466 Ga0395898_0176777 Ga0395898_0176777_189_1622 400
56 3300037471 Ga0395905_0032970 Ga0395905_0032970_2985_4418 400
57 3300038443 Ga0395901_0008385 Ga0395901_0008385_6126_7559 400
58 3300009147 Ga0114129_10039569 Ga0114129_100395695 401
59 3300050507 nmdc:mga05p37_11107_c1 nmdc:mga05p37_11107_c1_4106_5506 401
60 3300050508 nmdc:mga09592_596_c1 nmdc:mga09592_596_c1_3787_5187 401
61 3300050510 nmdc:mga06r32_414_c1 nmdc:mga06r32_414_c1_26247_27647 401
62 3300053129 Ga0500628_001016 Ga0500628_001016_2376_3809 403
63 3300005466 Ga0070685_10002669 Ga0070685_100026693 404
64 3300005544 Ga0070686_100000005 Ga0070686_100000005211 404
65 3300006852 Ga0075433_10000783 Ga0075433_100007832 404
66 3300006871 Ga0075434_100023882 Ga0075434_1000238822 404
67 3300006914 Ga0075436_100001117 Ga0075436_1000011172 404
68 3300007076 Ga0075435_100030401 Ga0075435_1000304012 404
69 3300009147 Ga0114129_10006119 Ga0114129_100061197 404
70 3300009551 Ga0105238_10000013 Ga0105238_1000001338 404
71 3300025910 Ga0207684_10257066 Ga0207684_102570662 404
72 3300025918 Ga0207662_10012480 Ga0207662_100124804 404
73 3300025924 Ga0207694_10000026 Ga0207694_10000026207 404
74 3300031731 Ga0307405_10023338 Ga0307405_100233382 404
75 3300034820 Ga0373959_0000126 Ga0373959_0000126_12899_14347 404
76 3300050507 nmdc:mga05p37_571_c1 nmdc:mga05p37_571_c1_18949_20325 404
77 3300050512 nmdc:mga0n895_26_c1 nmdc:mga0n895_26_c1_64692_66068 404
78 3300050514 nmdc:mga08x19_399_c1 nmdc:mga08x19_399_c1_14492_15868 404
79 3300006852 Ga0075433_10067896 Ga0075433_100678963 405
80 3300005985 Ga0081539_10000092 Ga0081539_10000092116 406
81 3300050511 nmdc:mga08y16_324528_c1 nmdc:mga08y16_324528_c1_132_1490 406
82 3300013100 Ga0157373_10093046 Ga0157373_100930461 407
83 3300006846 Ga0075430_100000103 Ga0075430_10000010328 408
84 3300006847 Ga0075431_100005382 Ga0075431_10000538212 408
85 3300006880 Ga0075429_100098795 Ga0075429_1000987953 408
86 3300009147 Ga0114129_10009632 Ga0114129_1000963211 408
87 3300042008 Ga0439450_004526 Ga0439450_004526_233_1585 408
88 3300042439 Ga0439464_0008575 Ga0439464_0008575_558_1910 408
89 3300042461 Ga0439460_0004618 Ga0439460_0004618_1636_2988 408
90 3300046514 Ga0495618_0000568 Ga0495618_0000568_1344_2729 408
91 3300046522 Ga0495643_0000144 Ga0495643_0000144_109481_110890 408
92 3300049570 Ga0501033_0018150 Ga0501033_0018150_1453_2805 408
93 3300049572 Ga0501036_0166351 Ga0501036_0166351_149_1501 408
94 3300049575 Ga0501039_0012773 Ga0501039_0012773_3013_4365 408
95 3300049576 Ga0501040_0012627 Ga0501040_0012627_3162_4514 408
96 3300049577 Ga0501041_0001796 Ga0501041_0001796_1365_2717 408
97 3300049578 Ga0501042_0008891 Ga0501042_0008891_3174_4526 408
98 3300049580 Ga0501046_0009916 Ga0501046_0009916_3638_4990 408
99 3300049581 Ga0501047_0020029 Ga0501047_0020029_4151_5503 408
100 3300049587 Ga0501071_0046897 Ga0501071_0046897_420_1772 408
101 3300049590 Ga0501074_0002552 Ga0501074_0002552_1018_2370 408
102 3300049591 Ga0501075_0020507 Ga0501075_0020507_753_2105 408
103 3300049592 Ga0501076_0002927 Ga0501076_0002927_5642_6994 408
104 3300049741 Ga0501079_0001826 Ga0501079_0001826_2049_3401 408
105 3300049741 Ga0501079_0007619 Ga0501079_0007619_1337_2689 408
106 3300049743 Ga0501081_0003354 Ga0501081_0003354_8657_10009 408
107 3300049743 Ga0501081_0003988 Ga0501081_0003988_5396_6748 408
108 3300049744 Ga0501083_0003803 Ga0501083_0003803_945_2297 408
109 3300049824 Ga0501045_0001154 Ga0501045_0001154_2476_3828 408
110 3300049824 Ga0501045_0010020 Ga0501045_0010020_662_2014 408
111 3300050507 nmdc:mga05p37_58080_c1 nmdc:mga05p37_58080_c1_2429_3757 408
112 3300050508 nmdc:mga09592_84099_c1 nmdc:mga09592_84099_c1_337_1665 408
113 3300050509 nmdc:mga0qj67_10290_c1 nmdc:mga0qj67_10290_c1_2114_3442 408
114 3300050510 nmdc:mga06r32_14962_c1 nmdc:mga06r32_14962_c1_30_1358 408
115 3300054114 Ga0501084_0000494 Ga0501084_0000494_8598_9950 408
116 3300054114 Ga0501084_0012477 Ga0501084_0012477_673_2025 408
117 3300060353 Ga0501082_0000376 Ga0501082_0000376_20746_22098 408
118 3300060353 Ga0501082_0005247 Ga0501082_0005247_4200_5552 408
119 3300005467 Ga0070706_100111998 Ga0070706_1001119982 409
120 3300025910 Ga0207684_10089683 Ga0207684_100896832 409
121 3300049593 Ga0501077_0096914 Ga0501077_0096914_241_1593 409
122 3300061734 Ga0530510_0035303 Ga0530510_0035303_2080_3432 409
123 3300007265 Ga0099794_10002669 Ga0099794_100026694 410
124 3300050508 nmdc:mga09592_116180_c1 nmdc:mga09592_116180_c1_708_2048 410
125 3300006871 Ga0075434_100016705 Ga0075434_1000167056 411
126 3300028558 Ga0265326_10002394 Ga0265326_100023942 411
127 3300028563 Ga0265319_1000340 Ga0265319_10003405 411
128 3300028563 Ga0265319_1002588 Ga0265319_10025887 411
129 3300028573 Ga0265334_10003273 Ga0265334_100032735 411
130 3300028577 Ga0265318_10002166 Ga0265318_100021668 411
131 3300028653 Ga0265323_10001268 Ga0265323_100012689 411
132 3300028654 Ga0265322_10001951 Ga0265322_100019513 411
133 3300028666 Ga0265336_10000109 Ga0265336_100001096 411
134 3300028800 Ga0265338_10001759 Ga0265338_1000175926 411
135 3300028800 Ga0265338_10015892 Ga0265338_100158926 411
136 3300029957 Ga0265324_10001359 Ga0265324_100013599 411
137 3300031235 Ga0265330_10004782 Ga0265330_100047826 411
138 3300031238 Ga0265332_10001135 Ga0265332_100011359 411
139 3300031240 Ga0265320_10007425 Ga0265320_100074251 411
140 3300031240 Ga0265320_10028634 Ga0265320_100286342 411
141 3300031241 Ga0265325_10007958 Ga0265325_100079582 411
142 3300031242 Ga0265329_10002540 Ga0265329_100025406 411
143 3300031249 Ga0265339_10001023 Ga0265339_1000102315 411
144 3300031250 Ga0265331_10006936 Ga0265331_100069366 411
145 3300031344 Ga0265316_10011778 Ga0265316_100117787 411
146 3300031344 Ga0265316_10021430 Ga0265316_100214303 411
147 3300031595 Ga0265313_10000728 Ga0265313_100007285 411
148 3300031711 Ga0265314_10005079 Ga0265314_100050797 411
149 3300031712 Ga0265342_10005224 Ga0265342_100052249 411
150 3300037471 Ga0395905_0188914 Ga0395905_0188914_566_1891 411
151 3300050507 nmdc:mga05p37_293005_c1 nmdc:mga05p37_293005_c1_24_1370 411
152 3300027907 Ga0207428_10000213 Ga0207428_1000021322 412
153 3300049588 Ga0501072_0026081 Ga0501072_0026081_2870_4222 412
154 3300050511 nmdc:mga08y16_569_c1 nmdc:mga08y16_569_c1_9870_11243 412
155 3300050515 nmdc:mga0a205_65327_c1 nmdc:mga0a205_65327_c1_1360_2733 412
156 3300005444 Ga0070694_100003625 Ga0070694_1000036255 413
157 3300025912 Ga0207707_10095175 Ga0207707_100951752 413
158 3300025917 Ga0207660_10018530 Ga0207660_100185302 413
159 3300044712 Ga0453684_0099104 Ga0453684_0099104_880_2235 413
160 3300007076 Ga0075435_100026498 Ga0075435_1000264982 414
161 3300035115 Ga0373941_0025243 Ga0373941_0025243_252_1658 414
162 3300037418 Ga0395900_0003509 Ga0395900_0003509_12970_14361 415
163 3300038443 Ga0395901_0011843 Ga0395901_0011843_7176_8567 415
164 3300049741 Ga0501079_0010075 Ga0501079_0010075_4202_5560 415
165 3300054114 Ga0501084_0004153 Ga0501084_0004153_3392_4750 415
166 3300060353 Ga0501082_0016069 Ga0501082_0016069_3264_4622 415
167 3300005536 Ga0070697_100016067 Ga0070697_1000160672 416
168 3300009177 Ga0105248_10294887 Ga0105248_102948872 416
169 3300013297 Ga0157378_10056755 Ga0157378_100567552 416
170 3300026088 Ga0207641_10109755 Ga0207641_101097553 416
171 3300050513 nmdc:mga0rr50_176309_c1 nmdc:mga0rr50_176309_c1_386_1717 416
172 3300005445 Ga0070708_100053641 Ga0070708_1000536412 417
173 3300005471 Ga0070698_100013773 Ga0070698_1000137735 417
174 3300005518 Ga0070699_100074234 Ga0070699_1000742342 417
175 3300005536 Ga0070697_100004341 Ga0070697_1000043419 417
176 3300005545 Ga0070695_100004592 Ga0070695_1000045925 417
177 3300006844 Ga0075428_100002483 Ga0075428_10000248314 417
178 3300006846 Ga0075430_100098720 Ga0075430_1000987202 417
179 3300006880 Ga0075429_100000169 Ga0075429_1000001698 417
180 3300009147 Ga0114129_10001085 Ga0114129_100010857 417
181 3300009147 Ga0114129_10294797 Ga0114129_102947972 417
182 3300009147 Ga0114129_10418542 Ga0114129_104185421 417
183 3300025910 Ga0207684_10007913 Ga0207684_100079133 417
184 3300025922 Ga0207646_10004220 Ga0207646_1000422011 417
185 3300044673 Ga0453683_0048876 Ga0453683_0048876_288_1643 417
186 3300045051 Ga0451576_0092310 Ga0451576_0092310_98_1486 417
187 3300045051 Ga0451576_0199194 Ga0451576_0199194_59_1450 417
188 3300049591 Ga0501075_0111618 Ga0501075_0111618_101_1456 417
189 3300050507 nmdc:mga05p37_25637_c1 nmdc:mga05p37_25637_c1_567_1940 417
190 3300050508 nmdc:mga09592_2684_c1 nmdc:mga09592_2684_c1_10624_11994 417
191 3300050509 nmdc:mga0qj67_54404_c1 nmdc:mga0qj67_54404_c1_889_2286 417
192 3300050510 nmdc:mga06r32_51433_c1 nmdc:mga06r32_51433_c1_22_1395 417
193 3300005295 Ga0065707_10094603 Ga0065707_100946032 418
194 3300005331 Ga0070670_100057854 Ga0070670_1000578542 418
195 3300005340 Ga0070689_100151087 Ga0070689_1001510871 418
196 3300005364 Ga0070673_100102458 Ga0070673_1001024581 418
197 3300005365 Ga0070688_100009871 Ga0070688_1000098712 418
198 3300005440 Ga0070705_100086402 Ga0070705_1000864022 418
199 3300005468 Ga0070707_100106664 Ga0070707_1001066643 418
200 3300005546 Ga0070696_100162211 Ga0070696_1001622112 418
201 3300005577 Ga0068857_100094110 Ga0068857_1000941102 418
202 3300005719 Ga0068861_100184408 Ga0068861_1001844081 418
203 3300005843 Ga0068860_100075469 Ga0068860_1000754694 418
204 3300005844 Ga0068862_100096325 Ga0068862_1000963252 418
205 3300006852 Ga0075433_10005303 Ga0075433_100053035 418
206 3300006871 Ga0075434_100001918 Ga0075434_1000019188 418
207 3300006871 Ga0075434_100063510 Ga0075434_1000635102 418
208 3300006880 Ga0075429_100010608 Ga0075429_1000106086 418
209 3300007265 Ga0099794_10006698 Ga0099794_100066982 418
210 3300009094 Ga0111539_10008896 Ga0111539_100088965 418
211 3300009094 Ga0111539_10166243 Ga0111539_101662432 418
212 3300009101 Ga0105247_10025279 Ga0105247_100252794 418
213 3300009147 Ga0114129_10002365 Ga0114129_1000236516 418
214 3300009147 Ga0114129_10034435 Ga0114129_100344355 418
215 3300009177 Ga0105248_10153001 Ga0105248_101530012 418
216 3300025910 Ga0207684_10084029 Ga0207684_100840292 418
217 3300025910 Ga0207684_10145131 Ga0207684_101451312 418
218 3300025922 Ga0207646_10181986 Ga0207646_101819862 418
219 3300025925 Ga0207650_10042574 Ga0207650_100425742 418
220 3300025936 Ga0207670_10055904 Ga0207670_100559041 418
221 3300025960 Ga0207651_10106548 Ga0207651_101065483 418
222 3300025961 Ga0207712_10014025 Ga0207712_100140254 418
223 3300026089 Ga0207648_10057155 Ga0207648_100571554 418
224 3300026095 Ga0207676_10158536 Ga0207676_101585362 418
225 3300026116 Ga0207674_10091008 Ga0207674_100910083 418
226 3300026118 Ga0207675_100059243 Ga0207675_1000592432 418
227 3300027907 Ga0207428_10000033 Ga0207428_1000003330 418
228 3300028380 Ga0268265_10127253 Ga0268265_101272531 418
229 3300035088 Ga0373940_0001138 Ga0373940_0001138_748_2088 418
230 3300046472 Ga0495580_0023796 Ga0495580_0023796_790_2130 418
231 3300046528 Ga0495642_0013888 Ga0495642_0013888_787_2127 418
232 3300050507 nmdc:mga05p37_16568_c1 nmdc:mga05p37_16568_c1_2638_3978 418
233 3300050507 nmdc:mga05p37_18659_c1 nmdc:mga05p37_18659_c1_209_1549 418
234 3300050507 nmdc:mga05p37_4740_c1 nmdc:mga05p37_4740_c1_8807_10150 418
235 3300050507 nmdc:mga05p37_64990_c1 nmdc:mga05p37_64990_c1_1215_2555 418
236 3300050508 nmdc:mga09592_112151_c1 nmdc:mga09592_112151_c1_347_1687 418
237 3300050508 nmdc:mga09592_45364_c1 nmdc:mga09592_45364_c1_1063_2403 418
238 3300050508 nmdc:mga09592_5004_c1 nmdc:mga09592_5004_c1_3289_4632 418
239 3300050511 nmdc:mga08y16_3353_c1 nmdc:mga08y16_3353_c1_13213_14553 418
240 3300050512 nmdc:mga0n895_33499_c1 nmdc:mga0n895_33499_c1_2614_3954 418
241 3300050512 nmdc:mga0n895_33747_c1 nmdc:mga0n895_33747_c1_174_1517 418
242 3300050512 nmdc:mga0n895_9325_c1 nmdc:mga0n895_9325_c1_4812_6152 418
243 3300050514 nmdc:mga08x19_18789_c1 nmdc:mga08x19_18789_c1_1111_2451 418
244 3300050515 nmdc:mga0a205_19323_c1 nmdc:mga0a205_19323_c1_2679_4019 418
245 3300050515 nmdc:mga0a205_32_c1 nmdc:mga0a205_32_c1_21398_22741 418
246 3300050515 nmdc:mga0a205_55533_c1 nmdc:mga0a205_55533_c1_2127_3467 418
247 3300005334 Ga0068869_100002372 Ga0068869_1000023727 419
248 3300005340 Ga0070689_100001844 Ga0070689_1000018442 419
249 3300005341 Ga0070691_10014674 Ga0070691_100146742 419
250 3300005343 Ga0070687_100001960 Ga0070687_1000019604 419
251 3300005345 Ga0070692_10002417 Ga0070692_100024172 419
252 3300005365 Ga0070688_100000685 Ga0070688_10000068510 419
253 3300005406 Ga0070703_10028752 Ga0070703_100287522 419
254 3300005438 Ga0070701_10000434 Ga0070701_1000043410 419
255 3300005438 Ga0070701_10043040 Ga0070701_100430402 419
256 3300005459 Ga0068867_100118067 Ga0068867_1001180672 419
257 3300005518 Ga0070699_100007122 Ga0070699_1000071225 419
258 3300005518 Ga0070699_100022592 Ga0070699_1000225921 419
259 3300005545 Ga0070695_100003497 Ga0070695_1000034978 419
260 3300005547 Ga0070693_100045130 Ga0070693_1000451302 419
261 3300005549 Ga0070704_100015621 Ga0070704_1000156214 419
262 3300005549 Ga0070704_100069128 Ga0070704_1000691283 419
263 3300005618 Ga0068864_100032781 Ga0068864_1000327813 419
264 3300005840 Ga0068870_10003266 Ga0068870_100032664 419
265 3300005841 Ga0068863_100249167 Ga0068863_1002491672 419
266 3300006871 Ga0075434_100074923 Ga0075434_1000749234 419
267 3300009148 Ga0105243_10005054 Ga0105243_100050543 419
268 3300009174 Ga0105241_10133394 Ga0105241_101333942 419
269 3300013308 Ga0157375_10221895 Ga0157375_102218952 419
270 3300025907 Ga0207645_10108854 Ga0207645_101088542 419
271 3300025910 Ga0207684_10023335 Ga0207684_100233352 419
272 3300025917 Ga0207660_10017413 Ga0207660_100174132 419
273 3300025922 Ga0207646_10081770 Ga0207646_100817702 419
274 3300025934 Ga0207686_10036827 Ga0207686_100368272 419
275 3300025935 Ga0207709_10039249 Ga0207709_100392492 419
276 3300025936 Ga0207670_10000227 Ga0207670_1000022722 419
277 3300025936 Ga0207670_10009664 Ga0207670_100096644 419
278 3300025939 Ga0207665_10004527 Ga0207665_100045276 419
279 3300025942 Ga0207689_10004878 Ga0207689_100048788 419
280 3300025942 Ga0207689_10009184 Ga0207689_100091843 419
281 3300026088 Ga0207641_10081442 Ga0207641_100814422 419
282 3300026089 Ga0207648_10144012 Ga0207648_101440122 419
283 3300026095 Ga0207676_10111649 Ga0207676_101116492 419
284 3300044673 Ga0453683_0038740 Ga0453683_0038740_955_2319 419
285 3300045051 Ga0451576_0005487 Ga0451576_0005487_14070_15434 419
286 3300046472 Ga0495580_0046572 Ga0495580_0046572_1440_2804 419
287 3300049574 Ga0501038_0142387 Ga0501038_0142387_44_1402 419
288 3300050507 nmdc:mga05p37_20869_c1 nmdc:mga05p37_20869_c1_4339_5703 419
289 3300050512 nmdc:mga0n895_67872_c1 nmdc:mga0n895_67872_c1_570_1958 419
290 3300005467 Ga0070706_100002480 Ga0070706_10000248010 420
291 3300005468 Ga0070707_100004480 Ga0070707_10000448010 420
292 3300025910 Ga0207684_10015825 Ga0207684_100158252 420
293 3300025922 Ga0207646_10008590 Ga0207646_100085904 420
294 3300031852 Ga0307410_10161391 Ga0307410_101613912 420
295 3300031995 Ga0307409_100028659 Ga0307409_1000286592 420
296 3300032005 Ga0307411_10056470 Ga0307411_100564701 420
297 3300045051 Ga0451576_0033448 Ga0451576_0033448_2270_3670 420
298 3300046491 Ga0495584_0029594 Ga0495584_0029594_353_1717 420
299 3300049572 Ga0501036_0129057 Ga0501036_0129057_579_1937 420
300 3300049591 Ga0501075_0024846 Ga0501075_0024846_2680_4038 420
301 3300005445 Ga0070708_100110492 Ga0070708_1001104922 421
302 3300005467 Ga0070706_100038669 Ga0070706_1000386695 421
303 3300005468 Ga0070707_100029700 Ga0070707_1000297004 421
304 3300005471 Ga0070698_100015432 Ga0070698_1000154322 421
305 3300005518 Ga0070699_100028896 Ga0070699_1000288965 421
306 3300005518 Ga0070699_100059410 Ga0070699_1000594102 421
307 3300005536 Ga0070697_100060234 Ga0070697_1000602344 421
308 3300005536 Ga0070697_100076471 Ga0070697_1000764712 421
309 3300005844 Ga0068862_100127188 Ga0068862_1001271882 421
310 3300005981 Ga0081538_10003971 Ga0081538_1000397110 421
311 3300005983 Ga0081540_1016094 Ga0081540_10160942 421
312 3300006175 Ga0070712_100001609 Ga0070712_10000160912 421
313 3300006852 Ga0075433_10003027 Ga0075433_100030278 421
314 3300006852 Ga0075433_10015010 Ga0075433_100150102 421
315 3300006871 Ga0075434_100003368 Ga0075434_10000336810 421
316 3300006871 Ga0075434_100025611 Ga0075434_1000256113 421
317 3300006871 Ga0075434_100031771 Ga0075434_1000317715 421
318 3300007076 Ga0075435_100000798 Ga0075435_1000007984 421
319 3300007076 Ga0075435_100046221 Ga0075435_1000462214 421
320 3300009094 Ga0111539_10000557 Ga0111539_100005578 421
321 3300025910 Ga0207684_10075817 Ga0207684_100758174 421
322 3300025915 Ga0207693_10019184 Ga0207693_100191845 421
323 3300025922 Ga0207646_10045524 Ga0207646_100455244 421
324 3300027907 Ga0207428_10000054 Ga0207428_10000054116 421
325 3300044673 Ga0453683_0018255 Ga0453683_0018255_402_1751 421
326 3300044712 Ga0453684_0025528 Ga0453684_0025528_5055_6404 421
327 3300050511 nmdc:mga08y16_751_c1 nmdc:mga08y16_751_c1_530_1879 421
328 3300050512 nmdc:mga0n895_191_c1 nmdc:mga0n895_191_c1_27824_29188 421
329 3300050512 nmdc:mga0n895_228983_c1 nmdc:mga0n895_228983_c1_195_1544 421
330 3300050512 nmdc:mga0n895_23889_c1 nmdc:mga0n895_23889_c1_3614_4960 421
331 3300050513 nmdc:mga0rr50_8223_c1 nmdc:mga0rr50_8223_c1_666_2030 421
332 3300050515 nmdc:mga0a205_10976_c1 nmdc:mga0a205_10976_c1_5033_6382 421
333 3300050515 nmdc:mga0a205_33741_c1 nmdc:mga0a205_33741_c1_3105_4454 421
334 3300050515 nmdc:mga0a205_5347_c1 nmdc:mga0a205_5347_c1_2869_4233 421
335 3300006844 Ga0075428_100001299 Ga0075428_10000129917 422
336 3300006846 Ga0075430_100000341 Ga0075430_10000034115 422
337 3300006846 Ga0075430_100002061 Ga0075430_10000206113 422
338 3300006846 Ga0075430_100011035 Ga0075430_1000110354 422
339 3300006847 Ga0075431_100000072 Ga0075431_1000000722 422
340 3300006847 Ga0075431_100000470 Ga0075431_10000047030 422
341 3300006847 Ga0075431_100002902 Ga0075431_10000290213 422
342 3300006852 Ga0075433_10009022 Ga0075433_100090227 422
343 3300006871 Ga0075434_100080694 Ga0075434_1000806944 422
344 3300006880 Ga0075429_100000305 Ga0075429_10000030511 422
345 3300007076 Ga0075435_100226040 Ga0075435_1002260402 422
346 3300009147 Ga0114129_10000726 Ga0114129_1000072627 422
347 3300009147 Ga0114129_10027225 Ga0114129_100272255 422
348 3300009147 Ga0114129_10030802 Ga0114129_100308024 422
349 3300025922 Ga0207646_10067055 Ga0207646_100670552 422
350 3300031548 Ga0307408_100020223 Ga0307408_1000202234 422
351 3300031548 Ga0307408_100056849 Ga0307408_1000568492 422
352 3300037418 Ga0395900_0038364 Ga0395900_0038364_1349_2707 422
353 3300038443 Ga0395901_0022100 Ga0395901_0022100_2961_4319 422
354 3300048909 Ga0496106_0166736 Ga0496106_0166736_219_1586 422
355 3300049588 Ga0501072_0018367 Ga0501072_0018367_37_1416 422
356 3300049591 Ga0501075_0037146 Ga0501075_0037146_1221_2600 422
357 3300049592 Ga0501076_0043690 Ga0501076_0043690_368_1747 422
358 3300049743 Ga0501081_0012977 Ga0501081_0012977_1933_3285 422
359 3300050507 nmdc:mga05p37_20033_c1 nmdc:mga05p37_20033_c1_4127_5506 422
360 3300050507 nmdc:mga05p37_21239_c1 nmdc:mga05p37_21239_c1_1964_3352 422
361 3300050507 nmdc:mga05p37_58063_c1 nmdc:mga05p37_58063_c1_1523_2887 422
362 3300050508 nmdc:mga09592_22323_c1 nmdc:mga09592_22323_c1_1882_3246 422
363 3300050508 nmdc:mga09592_56_c1 nmdc:mga09592_56_c1_58915_60303 422
364 3300050509 nmdc:mga0qj67_143391_c1 nmdc:mga0qj67_143391_c1_385_1737 422
365 3300050509 nmdc:mga0qj67_711_c1 nmdc:mga0qj67_711_c1_12159_13547 422
366 3300050509 nmdc:mga0qj67_761_c1 nmdc:mga0qj67_761_c1_6991_8370 422
367 3300050510 nmdc:mga06r32_1136_c1 nmdc:mga06r32_1136_c1_13397_14785 422
368 3300050510 nmdc:mga06r32_4664_c1 nmdc:mga06r32_4664_c1_6863_8242 422
369 3300050510 nmdc:mga06r32_739_c1 nmdc:mga06r32_739_c1_26379_27740 422
370 3300050512 nmdc:mga0n895_34226_c1 nmdc:mga0n895_34226_c1_409_1770 422
371 3300050512 nmdc:mga0n895_99867_c1 nmdc:mga0n895_99867_c1_1210_2589 422
372 3300050515 nmdc:mga0a205_43821_c1 nmdc:mga0a205_43821_c1_1613_2977 422
373 3300050515 nmdc:mga0a205_50762_c1 nmdc:mga0a205_50762_c1_1240_2601 422
374 3300054114 Ga0501084_0139170 Ga0501084_0139170_333_1721 422
375 3300003371 JGI26145J50221_1000569 JGI26145J50221_10005694 423
376 3300005290 Ga0065712_10078073 Ga0065712_100780734 423
377 3300005293 Ga0065715_10002243 Ga0065715_100022432 423
378 3300005328 Ga0070676_10020004 Ga0070676_100200044 423
379 3300005331 Ga0070670_100017109 Ga0070670_1000171092 423
380 3300005334 Ga0068869_100000454 Ga0068869_1000004547 423
381 3300005336 Ga0070680_100000745 Ga0070680_1000007452 423
382 3300005336 Ga0070680_100170009 Ga0070680_1001700092 423
383 3300005337 Ga0070682_100000164 Ga0070682_10000016439 423
384 3300005338 Ga0068868_100011970 Ga0068868_1000119704 423
385 3300005339 Ga0070660_100001192 Ga0070660_10000119216 423
386 3300005341 Ga0070691_10005084 Ga0070691_100050842 423
387 3300005344 Ga0070661_100008371 Ga0070661_1000083715 423
388 3300005345 Ga0070692_10000185 Ga0070692_1000018515 423
389 3300005353 Ga0070669_100021415 Ga0070669_1000214154 423
390 3300005364 Ga0070673_100075603 Ga0070673_1000756031 423
391 3300005366 Ga0070659_100000169 Ga0070659_1000001698 423
392 3300005438 Ga0070701_10024538 Ga0070701_100245382 423
393 3300005440 Ga0070705_100018069 Ga0070705_1000180692 423
394 3300005444 Ga0070694_100000153 Ga0070694_10000015316 423
395 3300005444 Ga0070694_100000394 Ga0070694_1000003948 423
396 3300005444 Ga0070694_100037165 Ga0070694_1000371652 423
397 3300005444 Ga0070694_100041527 Ga0070694_1000415271 423
398 3300005445 Ga0070708_100030956 Ga0070708_1000309565 423
399 3300005458 Ga0070681_10030371 Ga0070681_100303712 423
400 3300005458 Ga0070681_10042257 Ga0070681_100422574 423
401 3300005459 Ga0068867_100003177 Ga0068867_1000031778 423
402 3300005467 Ga0070706_100049561 Ga0070706_1000495612 423
403 3300005471 Ga0070698_100002229 Ga0070698_1000022298 423
404 3300005530 Ga0070679_100000780 Ga0070679_1000007805 423
405 3300005536 Ga0070697_100011711 Ga0070697_1000117115 423
406 3300005539 Ga0068853_100001544 Ga0068853_10000154413 423
407 3300005543 Ga0070672_100023678 Ga0070672_1000236782 423
408 3300005543 Ga0070672_100029057 Ga0070672_1000290572 423
409 3300005545 Ga0070695_100001873 Ga0070695_1000018738 423
410 3300005545 Ga0070695_100002060 Ga0070695_1000020607 423
411 3300005546 Ga0070696_100001217 Ga0070696_10000121713 423
412 3300005547 Ga0070693_100000018 Ga0070693_10000001833 423
413 3300005549 Ga0070704_100012918 Ga0070704_1000129183 423
414 3300005563 Ga0068855_100000233 Ga0068855_10000023330 423
415 3300005564 Ga0070664_100001518 Ga0070664_10000151816 423
416 3300005577 Ga0068857_100024893 Ga0068857_1000248932 423
417 3300005578 Ga0068854_100000372 Ga0068854_10000037232 423
418 3300005614 Ga0068856_100000806 Ga0068856_10000080624 423
419 3300005617 Ga0068859_100003308 Ga0068859_10000330814 423
420 3300005618 Ga0068864_100004417 Ga0068864_10000441710 423
421 3300005840 Ga0068870_10000059 Ga0068870_1000005911 423
422 3300005841 Ga0068863_100041774 Ga0068863_1000417743 423
423 3300005842 Ga0068858_100026041 Ga0068858_1000260412 423
424 3300005843 Ga0068860_100003577 Ga0068860_10000357715 423
425 3300005843 Ga0068860_100017134 Ga0068860_1000171342 423
426 3300005844 Ga0068862_100004793 Ga0068862_1000047939 423
427 3300005937 Ga0081455_10001251 Ga0081455_1000125129 423
428 3300006358 Ga0068871_100046576 Ga0068871_1000465764 423
429 3300006844 Ga0075428_100000421 Ga0075428_10000042116 423
430 3300006844 Ga0075428_100023192 Ga0075428_1000231929 423
431 3300006847 Ga0075431_100004853 Ga0075431_1000048536 423
432 3300006852 Ga0075433_10157932 Ga0075433_101579322 423
433 3300006871 Ga0075434_100014433 Ga0075434_1000144338 423
434 3300006914 Ga0075436_100020775 Ga0075436_1000207752 423
435 3300006931 Ga0097620_100003308 Ga0097620_10000330814 423
436 3300007076 Ga0075435_100010585 Ga0075435_1000105856 423
437 3300009147 Ga0114129_10000704 Ga0114129_1000070416 423
438 3300009147 Ga0114129_10083058 Ga0114129_100830582 423
439 3300009174 Ga0105241_10002337 Ga0105241_100023377 423
440 3300009545 Ga0105237_10139440 Ga0105237_101394403 423
441 3300010375 Ga0105239_10056136 Ga0105239_100561364 423
442 3300013100 Ga0157373_10007582 Ga0157373_100075822 423
443 3300013102 Ga0157371_10036447 Ga0157371_100364472 423
444 3300013104 Ga0157370_10104620 Ga0157370_101046202 423
445 3300013297 Ga0157378_10262644 Ga0157378_102626441 423
446 3300013306 Ga0163162_10037969 Ga0163162_100379692 423
447 3300014325 Ga0163163_10017157 Ga0163163_100171577 423
448 3300025885 Ga0207653_10000836 Ga0207653_100008363 423
449 3300025901 Ga0207688_10033944 Ga0207688_100339442 423
450 3300025904 Ga0207647_10055210 Ga0207647_100552102 423
451 3300025907 Ga0207645_10000340 Ga0207645_1000034036 423
452 3300025908 Ga0207643_10000105 Ga0207643_1000010517 423
453 3300025910 Ga0207684_10000242 Ga0207684_1000024219 423
454 3300025910 Ga0207684_10065669 Ga0207684_100656694 423
455 3300025910 Ga0207684_10100792 Ga0207684_101007922 423
456 3300025912 Ga0207707_10000034 Ga0207707_10000034145 423
457 3300025917 Ga0207660_10001489 Ga0207660_100014894 423
458 3300025917 Ga0207660_10075616 Ga0207660_100756162 423
459 3300025919 Ga0207657_10000066 Ga0207657_1000006681 423
460 3300025920 Ga0207649_10003921 Ga0207649_100039215 423
461 3300025921 Ga0207652_10000740 Ga0207652_1000074024 423
462 3300025922 Ga0207646_10000574 Ga0207646_1000057444 423
463 3300025923 Ga0207681_10013079 Ga0207681_100130794 423
464 3300025932 Ga0207690_10001729 Ga0207690_1000172911 423
465 3300025940 Ga0207691_10026319 Ga0207691_100263192 423
466 3300025940 Ga0207691_10047273 Ga0207691_100472732 423
467 3300025942 Ga0207689_10000365 Ga0207689_1000036531 423
468 3300025945 Ga0207679_10000248 Ga0207679_1000024830 423
469 3300025960 Ga0207651_10033513 Ga0207651_100335134 423
470 3300025981 Ga0207640_10003855 Ga0207640_100038555 423
471 3300026023 Ga0207677_10021867 Ga0207677_100218674 423
472 3300026035 Ga0207703_10017210 Ga0207703_100172102 423
473 3300026067 Ga0207678_10002576 Ga0207678_100025767 423
474 3300026078 Ga0207702_10002703 Ga0207702_1000270311 423
475 3300026088 Ga0207641_10060699 Ga0207641_100606992 423
476 3300026089 Ga0207648_10000856 Ga0207648_1000085625 423
477 3300026095 Ga0207676_10013750 Ga0207676_100137502 423
478 3300026116 Ga0207674_10000050 Ga0207674_10000050100 423
479 3300027252 Ga0209973_1000647 Ga0209973_10006472 423
480 3300027395 Ga0209996_1002066 Ga0209996_10020663 423
481 3300027471 Ga0209995_1000625 Ga0209995_10006252 423
482 3300027614 Ga0209970_1001083 Ga0209970_10010833 423
483 3300027617 Ga0210002_1001659 Ga0210002_10016593 423
484 3300027665 Ga0209983_1000978 Ga0209983_10009785 423
485 3300027682 Ga0209971_1000128 Ga0209971_100012819 423
486 3300027695 Ga0209966_1000071 Ga0209966_100007131 423
487 3300027717 Ga0209998_10000113 Ga0209998_1000011319 423
488 3300027876 Ga0209974_10003286 Ga0209974_100032865 423
489 3300027907 Ga0207428_10040774 Ga0207428_100407744 423
490 3300028381 Ga0268264_10004690 Ga0268264_1000469011 423
491 3300028381 Ga0268264_10029403 Ga0268264_100294034 423
492 3300034820 Ga0373959_0005494 Ga0373959_0005494_101_1453 423
493 3300035088 Ga0373940_0009158 Ga0373940_0009158_420_1772 423
494 3300035090 Ga0373949_0002486 Ga0373949_0002486_1184_2536 423
495 3300035112 Ga0373932_0021798 Ga0373932_0021798_142_1533 423
496 3300035121 Ga0373960_0005764 Ga0373960_0005764_419_1771 423
497 3300035207 Ga0373942_0007939 Ga0373942_0007939_940_2292 423
498 3300035241 Ga0373961_0013609 Ga0373961_0013609_296_1648 423
499 3300035691 Ga0373931_0001032 Ga0373931_0001032_1788_3179 423
500 3300042012 Ga0439455_0007607 Ga0439455_0007607_119_1471 423
501 3300045051 Ga0451576_0012143 Ga0451576_0012143_4298_5650 423
502 3300045051 Ga0451576_0038895 Ga0451576_0038895_2748_4100 423
503 3300048905 Ga0496102_0014983 Ga0496102_0014983_1671_3062 423
504 3300048905 Ga0496102_0044734 Ga0496102_0044734_1738_3090 423
505 3300048911 Ga0496108_0138779 Ga0496108_0138779_140_1492 423
506 3300048913 Ga0496110_0044500 Ga0496110_0044500_1095_2447 423
507 3300049573 Ga0501037_0140631 Ga0501037_0140631_301_1659 423
508 3300049574 Ga0501038_0048782 Ga0501038_0048782_599_1954 423
509 3300049575 Ga0501039_0114173 Ga0501039_0114173_166_1521 423
510 3300049580 Ga0501046_0090523 Ga0501046_0090523_309_1664 423
511 3300049587 Ga0501071_0075474 Ga0501071_0075474_458_1813 423
512 3300049588 Ga0501072_0088006 Ga0501072_0088006_361_1716 423
513 3300049591 Ga0501075_0000742 Ga0501075_0000742_18020_19375 423
514 3300049592 Ga0501076_0002350 Ga0501076_0002350_7028_8383 423
515 3300049592 Ga0501076_0226640 Ga0501076_0226640_87_1439 423
516 3300049741 Ga0501079_0000847 Ga0501079_0000847_17303_18658 423
517 3300049743 Ga0501081_0007247 Ga0501081_0007247_339_1694 423
518 3300049743 Ga0501081_0009320 Ga0501081_0009320_3872_5227 423
519 3300049743 Ga0501081_0112150 Ga0501081_0112150_41_1396 423
520 3300049824 Ga0501045_0044819 Ga0501045_0044819_1756_3111 423
521 3300050507 nmdc:mga05p37_132342_c1 nmdc:mga05p37_132342_c1_1360_2715 423
522 3300050507 nmdc:mga05p37_4991_c1 nmdc:mga05p37_4991_c1_3512_4888 423
523 3300050507 nmdc:mga05p37_99662_c1 nmdc:mga05p37_99662_c1_764_2116 423
524 3300050510 nmdc:mga06r32_132_c1 nmdc:mga06r32_132_c1_4567_5943 423
525 3300050510 nmdc:mga06r32_42468_c1 nmdc:mga06r32_42468_c1_724_2079 423
526 3300050511 nmdc:mga08y16_61998_c1 nmdc:mga08y16_61998_c1_783_2165 423
527 3300050512 nmdc:mga0n895_247213_c1 nmdc:mga0n895_247213_c1_183_1559 423
528 3300050513 nmdc:mga0rr50_10638_c1 nmdc:mga0rr50_10638_c1_3410_4765 423
529 3300050515 nmdc:mga0a205_57716_c1 nmdc:mga0a205_57716_c1_348_1700 423
530 3300054114 Ga0501084_0008622 Ga0501084_0008622_2325_3680 423
531 3300054114 Ga0501084_0055866 Ga0501084_0055866_1859_3214 423
532 3300060353 Ga0501082_0012779 Ga0501082_0012779_1865_3220 423
533 3300060353 Ga0501082_0043237 Ga0501082_0043237_307_1662 423

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03916

NrfD

Polysulphide reductase, NrfD

67

397

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_C cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.8264 12 409
6btm-assembly1.cif.gz_C structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.8188 9 409
6f0k-assembly1.cif.gz_C alternative complex iii 0.817 12 416
6f0k-assembly1.cif.gz_C alternative complex iii 0.783 12 416
6loe-assembly1.cif.gz_C cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.7795 12 409
ID Description Score Start End Superfamily
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.7117 44 350 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6991 44 350 1.20.1630.10
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6911 29 353 1.20.1630.10
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6566 29 353 1.20.1630.10
af_Q9Y4G6_789_912_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5459 232 346 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A3B8WBV6-F1-model_v4 Hydrogenase 0.9914 231 351 GO:0016020
AF-A0A3B8WBV6-F1-model_v4 Hydrogenase 0.9676 231 351 GO:0016020
AF-A0A382YI40-F1-model_v4 Hydrogenase 0.9202 142 350 GO:0005886
AF-A0A382YI40-F1-model_v4 Hydrogenase 0.9078 142 350 GO:0005886
AF-A0A350PIB3-F1-model_v4 Hydrogenase 0.8928 180 409 GO:0005886

Feature Viewer

pLDDT pTM Quality
66.43 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map