F460426

General Info

Members Datasets Scaffolds Average Seq Length
533 285 1066 291

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100004098|Ga0307409_1000040983
Length 351
Sequence MPPRQLVTRHGTARDGLSANENIPHGEILMSTTDISARLHPRRALLVLSLLECHFAAYRVGAMSQWTAADLPSFAGRTVIVTGANSGLGLITARELARVGAKTILAVRNTAKGDEAAASIGGDVEVRKLDLQDLASVRTFADGVDSVDVLVNNAGIMAVPYAQTVDGFESQIGTNHLGHFALTNLLLPKITDRVVTVSSGMHLIGQINLDDLNWKARPYSPWRAYGQSKLANLLFTSELQRRLDAAGSPLKAHAAHPGYSATNLQGNTGRKVGDALMTFGNKLATNADFGARQTLYAVAKDLPGDSFIGPQFAMWGPTGRTPLRSPLARDAKKAVGLWELSEQLTDTKFGL

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
154 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
160 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
163 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
164 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
165 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
257 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
260 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
261 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
262 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
263 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
264 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
270 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
271 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
272 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
273 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
274 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
275 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
276 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
277 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
278 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
279 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
280 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
281 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
282 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
283 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
284 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
285 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97
Metatranscriptomes 0
Isolates 3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.63
Nodule 0.19
Rhizoplane 12.57
Rhizosphere 65.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100004098 3300031995 Bacteria 8112
2 JGI24745J21846_1000885 3300002073 Bacteria 2782
3 JGI24744J21845_10002910 3300002077 Bacteria 3500
4 JGI24742J22300_10002859 3300002244 Bacteria 2790
5 Ga0055528_1023167 3300003790 Bacteria 1905
6 Ga0055540_1000043 3300003792 Bacteria 155228
7 Ga0055540_1004226 3300003792 Bacteria 6598
8 Ga0070690_100223356 3300005330 Bacteria 1321
9 Ga0068869_100019489 3300005334 Bacteria 4637
10 Ga0070666_10093788 3300005335 Bacteria 2064
11 Ga0070666_10123147 3300005335 Bacteria 1799
12 Ga0070682_100003080 3300005337 Bacteria 9232
13 Ga0068868_100001163 3300005338 Bacteria 18048
14 Ga0068868_100162543 3300005338 Bacteria 1845
15 Ga0070691_10010543 3300005341 Bacteria 4219
16 Ga0070687_100044972 3300005343 Bacteria 2252
17 Ga0070668_100001540 3300005347 Bacteria 16632
18 Ga0070668_100162205 3300005347 Bacteria 1814
19 Ga0070669_100018910 3300005353 Bacteria 4924
20 Ga0070669_100020428 3300005353 Bacteria 4730
21 Ga0070671_100043005 3300005355 Bacteria 3756
22 Ga0070671_100227223 3300005355 Bacteria 1583
23 Ga0070673_100071196 3300005364 Bacteria 2793
24 Ga0070659_100206786 3300005366 Bacteria 1617
25 Ga0070667_100000791 3300005367 Bacteria 29649
26 Ga0070667_100013169 3300005367 Bacteria 6836
27 Ga0070667_100013973 3300005367 Bacteria 6635
28 Ga0070667_100027611 3300005367 Bacteria 4723
29 Ga0070709_10012808 3300005434 Bacteria 4700
30 Ga0070714_100512386 3300005435 Bacteria 1145
31 Ga0070710_10000690 3300005437 Bacteria 16057
32 Ga0070710_10003060 3300005437 Bacteria 7951
33 Ga0070711_100000160 3300005439 Bacteria 36517
34 Ga0070711_100007595 3300005439 Bacteria 6597
35 Ga0070711_100271820 3300005439 Bacteria 1338
36 Ga0070705_100149966 3300005440 Bacteria 1545
37 Ga0070694_100061108 3300005444 Bacteria 2571
38 Ga0070663_100032577 3300005455 Bacteria 3594
39 Ga0070678_100000117 3300005456 Bacteria 31126
40 Ga0070662_100016792 3300005457 Bacteria 4921
41 Ga0068867_100004067 3300005459 Bacteria 10296
42 Ga0068867_100028527 3300005459 Bacteria 4020
43 Ga0070706_100341411 3300005467 Bacteria 1396
44 Ga0070707_100003125 3300005468 Bacteria 15664
45 Ga0070684_100097128 3300005535 Bacteria 2627
46 Ga0068853_100023310 3300005539 Bacteria 5180
47 Ga0068853_100023917 3300005539 Bacteria 5120
48 Ga0070672_100067944 3300005543 Bacteria 2825
49 Ga0070686_100065306 3300005544 Bacteria 2363
50 Ga0070686_100097616 3300005544 Bacteria 1978
51 Ga0070695_100103507 3300005545 Bacteria 1921
52 Ga0070696_100010017 3300005546 Bacteria 6339
53 Ga0070693_100070126 3300005547 Bacteria 2062
54 Ga0070665_100006373 3300005548 Bacteria 12030
55 Ga0070665_100009409 3300005548 Bacteria 9888
56 Ga0070665_100029759 3300005548 Bacteria 5495
57 Ga0068855_100263352 3300005563 Bacteria 1920
58 Ga0070664_100230222 3300005564 Bacteria 1661
59 Ga0068854_100009069 3300005578 Bacteria 6411
60 Ga0068854_100277711 3300005578 Bacteria 1347
61 Ga0068859_100001042 3300005617 Bacteria 28409
62 Ga0068859_100077098 3300005617 Bacteria 3374
63 Ga0068864_100534163 3300005618 Bacteria 1132
64 Ga0068866_10000441 3300005718 Bacteria 19171
65 Ga0068866_10043910 3300005718 Bacteria 2233
66 Ga0068861_100003820 3300005719 Bacteria 10055
67 Ga0068863_100001025 3300005841 Bacteria 27909
68 Ga0068863_100012259 3300005841 Bacteria 8277
69 Ga0068863_100089781 3300005841 Bacteria 2914
70 Ga0068858_100004832 3300005842 Bacteria 13203
71 Ga0068858_100014666 3300005842 Bacteria 7378
72 Ga0068858_100016818 3300005842 Bacteria 6869
73 Ga0068860_100000087 3300005843 Bacteria 158242
74 Ga0068860_100008728 3300005843 Bacteria 10094
75 Ga0068862_100000077 3300005844 Bacteria 116781
76 Ga0068862_100022465 3300005844 Bacteria 5276
77 Ga0068862_100281044 3300005844 Bacteria 1525
78 Ga0081455_10048103 3300005937 Bacteria 3688
79 Ga0081455_10050617 3300005937 Bacteria 3571
80 Ga0081455_10321411 3300005937 Bacteria 1102
81 Ga0070717_10283194 3300006028 Bacteria 1470
82 Ga0075365_10008384 3300006038 Bacteria 5862
83 Ga0075365_10021990 3300006038 Bacteria 3987
84 Ga0075365_10066664 3300006038 Bacteria 2416
85 Ga0075365_10178984 3300006038 Bacteria 1482
86 Ga0075363_100008437 3300006048 Bacteria 4796
87 Ga0075363_100047538 3300006048 Bacteria 2279
88 Ga0075363_100050105 3300006048 Bacteria 2224
89 Ga0075363_100055659 3300006048 Bacteria 2119
90 Ga0075364_10050924 3300006051 Bacteria 2703
91 Ga0075364_10073962 3300006051 Bacteria 2246
92 Ga0075364_10111675 3300006051 Bacteria 1824
93 Ga0075364_10205962 3300006051 Bacteria 1334
94 Ga0070716_100009944 3300006173 Bacteria 4757
95 Ga0070716_100025451 3300006173 Bacteria 3158
96 Ga0070712_100000846 3300006175 Bacteria 18192
97 Ga0070712_100002348 3300006175 Bacteria 11656
98 Ga0075362_10049670 3300006177 Bacteria 1874
99 Ga0075362_10120917 3300006177 Bacteria 1239
100 Ga0075367_10225707 3300006178 Bacteria 1173
101 Ga0075369_10004544 3300006186 Bacteria 5137
102 Ga0075369_10006368 3300006186 Bacteria 4461
103 Ga0075369_10014594 3300006186 Bacteria 3142
104 Ga0075369_10057821 3300006186 Bacteria 1688
105 Ga0075369_10144026 3300006186 Bacteria 1087
106 Ga0097621_100150291 3300006237 Bacteria 1997
107 Ga0075370_10053304 3300006353 Bacteria 2296
108 Ga0075370_10055517 3300006353 Bacteria 2250
109 Ga0075370_10069734 3300006353 Bacteria 2010
110 Ga0068871_100048970 3300006358 Bacteria 3414
111 Ga0075428_100071233 3300006844 Bacteria 3799
112 Ga0075433_10255974 3300006852 Bacteria 1553
113 Ga0068865_100401689 3300006881 Bacteria 1122
114 Ga0075436_100087314 3300006914 Bacteria 2166
115 Ga0097620_100001042 3300006931 Bacteria 28409
116 Ga0097620_100077087 3300006931 Bacteria 3374
117 Ga0075435_100133462 3300007076 Bacteria 2078
118 Ga0105250_10037242 3300009092 Bacteria 1952
119 Ga0111539_10328257 3300009094 Bacteria 1781
120 Ga0111539_10916898 3300009094 Bacteria 1019
121 Ga0105245_10008338 3300009098 Bacteria 9053
122 Ga0105245_10035982 3300009098 Bacteria 4396
123 Ga0105245_10059620 3300009098 Bacteria 3437
124 Ga0105247_10000007 3300009101 Bacteria 409490
125 Ga0105247_10000060 3300009101 Bacteria 127879
126 Ga0105247_10000298 3300009101 Bacteria 44765
127 Ga0114129_10212142 3300009147 Bacteria 2617
128 Ga0114129_10424682 3300009147 Bacteria 1748
129 Ga0105243_10000700 3300009148 Bacteria 32410
130 Ga0105243_10045903 3300009148 Bacteria 3435
131 Ga0105243_10333689 3300009148 Bacteria 1386
132 Ga0105242_10001954 3300009176 Bacteria 16221
133 Ga0105242_10242373 3300009176 Bacteria 1621
134 Ga0105248_10000050 3300009177 Bacteria 152667
135 Ga0105248_10003516 3300009177 Bacteria 17379
136 Ga0105248_10056751 3300009177 Bacteria 4393
137 Ga0105248_10145708 3300009177 Bacteria 2672
138 Ga0105237_10006011 3300009545 Bacteria 13581
139 Ga0105237_10011826 3300009545 Bacteria 9231
140 Ga0105237_10027144 3300009545 Bacteria 5848
141 Ga0105238_10676479 3300009551 Bacteria 1043
142 Ga0105249_10000042 3300009553 Bacteria 195242
143 Ga0105249_10000470 3300009553 Bacteria 37482
144 Ga0105249_10052537 3300009553 Bacteria 3722
145 Ga0105239_10016841 3300010375 Bacteria 8078
146 Ga0105239_10024596 3300010375 Bacteria 6634
147 Ga0105239_10082818 3300010375 Bacteria 3533
148 Ga0157369_10448544 3300013105 Bacteria 1336
149 Ga0157374_10032490 3300013296 Bacteria 4752
150 Ga0157378_10292006 3300013297 Bacteria 1575
151 Ga0157372_10048234 3300013307 Bacteria 4734
152 Ga0157375_10078003 3300013308 Bacteria 3344
153 Ga0157375_10317825 3300013308 Bacteria 1721
154 Ga0157375_10502654 3300013308 Bacteria 1376
155 Ga0163163_10094418 3300014325 Bacteria 3009
156 Ga0157380_10010166 3300014326 Bacteria 6763
157 Ga0157377_10180592 3300014745 Bacteria 1327
158 Ga0157379_10002499 3300014968 Bacteria 15398
159 Ga0157379_10052574 3300014968 Bacteria 3639
160 Ga0157379_10061838 3300014968 Bacteria 3349
161 Ga0157376_10161575 3300014969 Bacteria 2031
162 Ga0163161_10027061 3300017792 Bacteria 4066
163 Ga0163161_10041561 3300017792 Bacteria 3303
164 Ga0213876_10005625 3300021384 Bacteria 6880
165 Ga0213876_10062567 3300021384 Bacteria 1965
166 Ga0209673_1013931 3300025273 Bacteria 3143
167 Ga0209051_1000108 3300025303 Bacteria 155280
168 Ga0209051_1001345 3300025303 Bacteria 21360
169 Ga0209051_1003362 3300025303 Bacteria 10530
170 Ga0209051_1010755 3300025303 Bacteria 4581
171 Ga0209051_1024750 3300025303 Bacteria 2461
172 Ga0209051_1036090 3300025303 Bacteria 1830
173 Ga0207692_10007732 3300025898 Bacteria 4417
174 Ga0207642_10036329 3300025899 Bacteria 2113
175 Ga0207710_10000010 3300025900 Bacteria 482087
176 Ga0207710_10000013 3300025900 Bacteria 409402
177 Ga0207688_10021558 3300025901 Bacteria 3522
178 Ga0207688_10158374 3300025901 Bacteria 1341
179 Ga0207680_10014842 3300025903 Bacteria 4047
180 Ga0207647_10013370 3300025904 Bacteria 5693
181 Ga0207647_10102217 3300025904 Bacteria 1700
182 Ga0207685_10014881 3300025905 Bacteria 2448
183 Ga0207699_10005382 3300025906 Bacteria 6135
184 Ga0207699_10142454 3300025906 Bacteria 1577
185 Ga0207645_10070834 3300025907 Bacteria 2231
186 Ga0207684_10007648 3300025910 Bacteria 9693
187 Ga0207654_10169896 3300025911 Bacteria 1415
188 Ga0207654_10232315 3300025911 Bacteria 1229
189 Ga0207671_10007606 3300025914 Bacteria 9375
190 Ga0207671_10074011 3300025914 Bacteria 2545
191 Ga0207671_10234914 3300025914 Bacteria 1439
192 Ga0207693_10000754 3300025915 Bacteria 29034
193 Ga0207693_10003890 3300025915 Bacteria 12718
194 Ga0207693_10192297 3300025915 Bacteria 1605
195 Ga0207663_10004087 3300025916 Bacteria 7234
196 Ga0207663_10254197 3300025916 Bacteria 1295
197 Ga0207662_10020192 3300025918 Bacteria 3800
198 Ga0207646_10006984 3300025922 Bacteria 11567
199 Ga0207646_10041901 3300025922 Bacteria 4114
200 Ga0207681_10001782 3300025923 Bacteria 13828
201 Ga0207681_10002155 3300025923 Bacteria 12552
202 Ga0207681_10025217 3300025923 Bacteria 3822
203 Ga0207694_10477201 3300025924 Bacteria 1043
204 Ga0207687_10016666 3300025927 Bacteria 4829
205 Ga0207644_10026466 3300025931 Bacteria 3997
206 Ga0207690_10052045 3300025932 Bacteria 2741
207 Ga0207690_10221592 3300025932 Bacteria 1447
208 Ga0207706_10019289 3300025933 Bacteria 6133
209 Ga0207706_10021979 3300025933 Bacteria 5726
210 Ga0207686_10002494 3300025934 Bacteria 9999
211 Ga0207709_10007107 3300025935 Bacteria 6252
212 Ga0207709_10246775 3300025935 Bacteria 1302
213 Ga0207709_10486915 3300025935 Bacteria 960
214 Ga0207669_10001189 3300025937 Bacteria 11053
215 Ga0207669_10021180 3300025937 Bacteria 3426
216 Ga0207704_10083181 3300025938 Bacteria 2076
217 Ga0207665_10009094 3300025939 Bacteria 6524
218 Ga0207691_10055981 3300025940 Bacteria 3594
219 Ga0207711_10001406 3300025941 Bacteria 22551
220 Ga0207711_10032792 3300025941 Bacteria 4394
221 Ga0207711_10033441 3300025941 Bacteria 4350
222 Ga0207711_10320052 3300025941 Bacteria 1433
223 Ga0207651_10062166 3300025960 Bacteria 2601
224 Ga0207712_10000010 3300025961 Bacteria 455972
225 Ga0207712_10001196 3300025961 Bacteria 17936
226 Ga0207668_10002892 3300025972 Bacteria 10073
227 Ga0207640_10009045 3300025981 Bacteria 5558
228 Ga0207658_10000677 3300025986 Bacteria 29704
229 Ga0207658_10001961 3300025986 Bacteria 15354
230 Ga0207658_10061168 3300025986 Bacteria 2813
231 Ga0207703_10009823 3300026035 Bacteria 7505
232 Ga0207703_10028562 3300026035 Bacteria 4397
233 Ga0207703_10074184 3300026035 Bacteria 2816
234 Ga0207703_10549154 3300026035 Bacteria 1089
235 Ga0207639_10007030 3300026041 Bacteria 7672
236 Ga0207639_10016712 3300026041 Bacteria 5198
237 Ga0207678_10009360 3300026067 Bacteria 8622
238 Ga0207678_10016046 3300026067 Bacteria 6578
239 Ga0207708_10016479 3300026075 Bacteria 5557
240 Ga0207641_10000849 3300026088 Bacteria 32380
241 Ga0207641_10005077 3300026088 Bacteria 11285
242 Ga0207641_10026225 3300026088 Bacteria 4809
243 Ga0207648_10014199 3300026089 Bacteria 7367
244 Ga0207648_10114857 3300026089 Bacteria 2366
245 Ga0207676_10426590 3300026095 Bacteria 1245
246 Ga0207675_100007850 3300026118 Bacteria 10069
247 Ga0207675_100063261 3300026118 Bacteria 3457
248 Ga0207683_10000984 3300026121 Bacteria 26143
249 Ga0207683_10058440 3300026121 Bacteria 3386
250 Ga0207698_10250822 3300026142 Bacteria 1619
251 Ga0268266_10030548 3300028379 Bacteria 4577
252 Ga0268266_10139805 3300028379 Bacteria 2172
253 Ga0268266_10238385 3300028379 Bacteria 1678
254 Ga0268265_10000014 3300028380 Bacteria 330186
255 Ga0268265_10128264 3300028380 Bacteria 2103
256 Ga0268264_10000150 3300028381 Bacteria 158263
257 Ga0268264_10027397 3300028381 Bacteria 4655
258 Ga0307511_10104160 3300030521 Bacteria 1844
259 Ga0265327_10002508 3300031251 Bacteria 19190
260 Ga0307405_10040394 3300031731 Bacteria 2826
261 Ga0307413_10213759 3300031824 Bacteria 1403
262 Ga0307410_10078120 3300031852 Bacteria 2316
263 Ga0307407_10024118 3300031903 Bacteria 3185
264 Ga0307412_10221481 3300031911 Bacteria 1451
265 Ga0307409_100039873 3300031995 Bacteria 3490
266 Ga0307411_10092790 3300032005 Bacteria 2112
267 Ga0307415_100077296 3300032126 Bacteria 2363
268 Ga0307415_100131120 3300032126 Bacteria 1898
269 Ga0307415_100339556 3300032126 Bacteria 1260
270 Ga0373939_0005374 3300035114 Bacteria 3050
271 Ga0316582_0116046 3300036647 Bacteria 1787
272 Ga0316584_0017797 3300036712 Bacteria 5117
273 Ga0395900_0006721 3300037418 Bacteria 11939
274 Ga0436364_1308388 3300037853 Bacteria 35210
275 Ga0436365_0052028 3300039437 Bacteria 2431
276 Ga0436365_0056280 3300039437 Bacteria 18059
277 Ga0436365_1443134 3300039437 Bacteria 4214
278 Ga0436362_1156483 3300039453 Bacteria 1696
279 Ga0439461_0000950 3300041410 Bacteria 4341
280 Ga0439461_0008037 3300041410 Bacteria 1883
281 Ga0439466_0009584 3300041411 Bacteria 3620
282 Ga0439466_0010268 3300041411 Bacteria 3480
283 Ga0439466_0023180 3300041411 Bacteria 2185
284 Ga0439465_0002866 3300041413 Bacteria 5645
285 Ga0439465_0002904 3300041413 Bacteria 5617
286 Ga0439465_0054227 3300041413 Bacteria 1318
287 Ga0451793_1722364 3300041452 Bacteria 2293
288 Ga0451843_1031485 3300041509 Bacteria 1779
289 Ga0439431_0008285 3300041997 Bacteria 2334
290 Ga0439431_0041265 3300041997 Bacteria 1176
291 Ga0439445_0018743 3300042004 Bacteria 1720
292 Ga0439434_0004459 3300042435 Bacteria 4093
293 Ga0439434_0030735 3300042435 Bacteria 1631
294 Ga0466969_0056737 3300044656 Bacteria 1911
295 Ga0466972_0008599 3300044658 Bacteria 5121
296 Ga0466972_0019835 3300044658 Bacteria 3361
297 Ga0466972_0031739 3300044658 Bacteria 2597
298 Ga0466965_0000697 3300044683 Bacteria 12460
299 Ga0466965_0002661 3300044683 Bacteria 7643
300 Ga0466965_0010937 3300044683 Bacteria 4243
301 Ga0466965_0047754 3300044683 Bacteria 2120
302 Ga0466965_0149834 3300044683 Bacteria 1219
303 Ga0466966_0120765 3300044684 Bacteria 1610
304 Ga0466966_0156281 3300044684 Bacteria 1389
305 Ga0466961_0061691 3300044693 Bacteria 2383
306 Ga0466961_0126180 3300044693 Bacteria 1605
307 Ga0466963_0058225 3300044694 Bacteria 2576
308 Ga0466963_0199824 3300044694 Bacteria 1398
309 Ga0466971_0012321 3300044719 Bacteria 3745
310 Ga0466971_0013054 3300044719 Bacteria 3644
311 Ga0466971_0079129 3300044719 Bacteria 1498
312 Ga0466971_0104012 3300044719 Bacteria 1306
313 Ga0466968_0004379 3300044735 Bacteria 5273
314 Ga0466968_0010033 3300044735 Bacteria 3660
315 Ga0466970_0106292 3300044765 Bacteria 1531
316 Ga0466970_0141703 3300044765 Bacteria 1325
317 Ga0466957_0003667 3300044842 Bacteria 8475
318 Ga0466957_0020307 3300044842 Bacteria 3909
319 Ga0466957_0051256 3300044842 Bacteria 2512
320 Ga0466957_0152596 3300044842 Bacteria 1495
321 Ga0466957_0175988 3300044842 Bacteria 1395
322 Ga0466960_0000225 3300044901 Bacteria 19643
323 Ga0466960_0000319 3300044901 Bacteria 16503
324 Ga0466960_0002911 3300044901 Bacteria 6510
325 Ga0466960_0050599 3300044901 Bacteria 2004
326 Ga0466959_0046101 3300045049 Bacteria 3208
327 Ga0466959_0049823 3300045049 Bacteria 3076
328 Ga0466958_0019127 3300045836 Bacteria 3984
329 Ga0466958_0080665 3300045836 Bacteria 2002
330 Ga0466958_0088296 3300045836 Bacteria 1915
331 Ga0466967_0001792 3300045976 Bacteria 12861
332 Ga0466967_0081127 3300045976 Bacteria 2929
333 Ga0466967_0165525 3300045976 Bacteria 2078
334 Ga0466967_0285203 3300045976 Bacteria 1585
335 Ga0495603_0023983 3300046455 Bacteria 3690
336 Ga0495603_0093866 3300046455 Bacteria 1753
337 Ga0495629_0050017 3300046459 Bacteria 2928
338 Ga0495638_0014063 3300046460 Bacteria 5422
339 Ga0495638_0017830 3300046460 Bacteria 4725
340 Ga0495641_0142080 3300046461 Bacteria 1072
341 Ga0495582_0098732 3300046473 Bacteria 1634
342 Ga0495639_0048277 3300046475 Bacteria 1930
343 Ga0495662_0140875 3300046476 Bacteria 1187
344 Ga0495606_0027733 3300046507 Bacteria 4009
345 Ga0495608_0271078 3300046511 Bacteria 1055
346 Ga0495630_0336482 3300046517 Bacteria 1155
347 Ga0495666_0044409 3300046526 Bacteria 2146
348 Ga0495645_0011604 3300046543 Bacteria 6205
349 Ga0495668_0294949 3300046616 Bacteria 889
350 Ga0495635_0211791 3300046663 Bacteria 1312
351 Ga0495624_0110327 3300046690 Bacteria 1692
352 Ga0495674_0196475 3300047319 Bacteria 1675
353 Ga0495672_0174774 3300047320 Bacteria 1092
354 Ga0495676_0068721 3300047321 Bacteria 2736
355 Ga0495686_0001660 3300047472 Bacteria 23180
356 Ga0495602_0207077 3300048088 Bacteria 1492
357 Ga0496100_0000084 3300048903 Bacteria 53649
358 Ga0496100_0001148 3300048903 Bacteria 12879
359 Ga0496100_0001530 3300048903 Bacteria 11346
360 Ga0496100_0058895 3300048903 Bacteria 2522
361 Ga0496100_0077155 3300048903 Bacteria 2239
362 Ga0496100_0125224 3300048903 Bacteria 1803
363 Ga0496100_0154376 3300048903 Bacteria 1640
364 Ga0496100_0281107 3300048903 Bacteria 1241
365 Ga0496101_0000100 3300048904 Bacteria 89811
366 Ga0496101_0000110 3300048904 Bacteria 85776
367 Ga0496101_0001605 3300048904 Bacteria 13597
368 Ga0496101_0007060 3300048904 Bacteria 7261
369 Ga0496101_0123677 3300048904 Bacteria 1958
370 Ga0496101_0320118 3300048904 Bacteria 1217
371 Ga0496102_0000006 3300048905 Bacteria 471494
372 Ga0496102_0001053 3300048905 Bacteria 25521
373 Ga0496102_0003241 3300048905 Bacteria 13802
374 Ga0496102_0008322 3300048905 Bacteria 8887
375 Ga0496102_0031183 3300048905 Bacteria 4780
376 Ga0496102_0054500 3300048905 Bacteria 3646
377 Ga0496102_0238279 3300048905 Bacteria 1716
378 Ga0496103_0000006 3300048906 Bacteria 470539
379 Ga0496103_0000400 3300048906 Bacteria 38628
380 Ga0496103_0000504 3300048906 Bacteria 32265
381 Ga0496103_0000700 3300048906 Bacteria 24863
382 Ga0496103_0019049 3300048906 Bacteria 4121
383 Ga0496103_0134697 3300048906 Bacteria 1578
384 Ga0496104_0021173 3300048907 Bacteria 5967
385 Ga0496104_0028678 3300048907 Bacteria 5159
386 Ga0496104_0075523 3300048907 Bacteria 3209
387 Ga0496104_0165194 3300048907 Bacteria 2123
388 Ga0496105_0017040 3300048908 Bacteria 5816
389 Ga0496105_0188078 3300048908 Bacteria 1689
390 Ga0496105_0322161 3300048908 Bacteria 1239
391 Ga0496106_0000164 3300048909 Bacteria 47996
392 Ga0496106_0011222 3300048909 Bacteria 6630
393 Ga0496106_0029818 3300048909 Bacteria 4067
394 Ga0496106_0074760 3300048909 Bacteria 2594
395 Ga0496107_0010183 3300048910 Bacteria 6522
396 Ga0496107_0053113 3300048910 Bacteria 2923
397 Ga0496107_0077210 3300048910 Bacteria 2426
398 Ga0496107_0238721 3300048910 Bacteria 1352
399 Ga0496108_0006114 3300048911 Bacteria 9741
400 Ga0496108_0016810 3300048911 Bacteria 5977
401 Ga0496108_0038048 3300048911 Bacteria 4008
402 Ga0496108_0189634 3300048911 Bacteria 1782
403 Ga0496109_0000356 3300048912 Bacteria 42608
404 Ga0496109_0002673 3300048912 Bacteria 14964
405 Ga0496109_0070109 3300048912 Bacteria 3216
406 Ga0496109_0078789 3300048912 Bacteria 3034
407 Ga0496109_0371886 3300048912 Bacteria 1350
408 Ga0496109_0446142 3300048912 Bacteria 1222
409 Ga0496110_0009262 3300048913 Bacteria 7960
410 Ga0496111_0045234 3300048914 Bacteria 3167
411 Ga0496112_0012895 3300048915 Bacteria 7697
412 Ga0496112_0063898 3300048915 Bacteria 3631
413 Ga0496113_0249855 3300048916 Bacteria 1416
414 Ga0496113_0494599 3300048916 Bacteria 982
415 Ga0496114_0000164 3300048917 Bacteria 47093
416 Ga0496114_0000522 3300048917 Bacteria 28253
417 Ga0496114_0013077 3300048917 Bacteria 6649
418 Ga0496114_0056611 3300048917 Bacteria 3273
419 Ga0496114_0148045 3300048917 Bacteria 2036
420 Ga0496115_0002348 3300048918 Bacteria 13572
421 Ga0496115_0014536 3300048918 Bacteria 5960
422 Ga0496115_0129879 3300048918 Bacteria 2076
423 Ga0496116_0000025 3300048919 Bacteria 470539
424 Ga0496116_0002215 3300048919 Bacteria 20684
425 Ga0496117_0000006 3300048920 Bacteria 758420
426 Ga0496117_0001137 3300048920 Bacteria 40112
427 Ga0496117_0042120 3300048920 Bacteria 3336
428 Ga0496118_0000004 3300048921 Bacteria 758420
429 Ga0496118_0001770 3300048921 Bacteria 31255
430 Ga0496119_0000035 3300048922 Bacteria 217007
431 Ga0496119_0004129 3300048922 Bacteria 14622
432 Ga0496119_0027109 3300048922 Bacteria 3950
433 Ga0496119_0053852 3300048922 Bacteria 2454
434 Ga0496119_0060289 3300048922 Bacteria 2273
435 Ga0496120_0000079 3300048923 Bacteria 160413
436 Ga0496120_0021588 3300048923 Bacteria 4067
437 Ga0496120_0077933 3300048923 Bacteria 1803
438 Ga0496121_0000004 3300048924 Bacteria 1139011
439 Ga0496121_0000090 3300048924 Bacteria 217920
440 Ga0496121_0000172 3300048924 Bacteria 143849
441 Ga0496121_0010052 3300048924 Bacteria 10737
442 Ga0496122_0000805 3300048925 Bacteria 60172
443 Ga0496123_0003575 3300048926 Bacteria 17241
444 Ga0496124_0000221 3300048927 Bacteria 110879
445 Ga0496125_0000003 3300048928 Bacteria 1189767
446 Ga0496125_0056347 3300048928 Bacteria 3192
447 Ga0496125_0076005 3300048928 Bacteria 2595
448 Ga0496125_0171220 3300048928 Bacteria 1459
449 Ga0496126_0000001 3300048929 Bacteria 1139011
450 Ga0496126_0000180 3300048929 Bacteria 142694
451 Ga0496126_0004091 3300048929 Bacteria 17671
452 Ga0496126_0006264 3300048929 Bacteria 13290
453 Ga0496126_0030158 3300048929 Bacteria 5142
454 Ga0501033_0022381 3300049570 Bacteria 4768
455 Ga0501033_0035503 3300049570 Bacteria 3738
456 Ga0501034_0026741 3300049571 Bacteria 5871
457 Ga0501036_0024129 3300049572 Bacteria 5127
458 Ga0501038_0075693 3300049574 Bacteria 2844
459 Ga0501039_0000929 3300049575 Bacteria 21375
460 Ga0501039_0055032 3300049575 Bacteria 3081
461 Ga0501043_0002664 3300049579 Bacteria 14997
462 Ga0501046_0006675 3300049580 Bacteria 10192
463 Ga0501047_0009645 3300049581 Bacteria 9125
464 Ga0501047_0322714 3300049581 Bacteria 1384
465 Ga0501048_0005296 3300049582 Bacteria 9825
466 Ga0501070_0025716 3300049586 Bacteria 4938
467 Ga0501070_0103101 3300049586 Bacteria 2359
468 Ga0501073_0049629 3300049589 Bacteria 2942
469 Ga0501073_0150544 3300049589 Bacteria 1613
470 Ga0501075_0107293 3300049591 Bacteria 2123
471 Ga0501079_0058162 3300049741 Bacteria 2983
472 Ga0501080_0083453 3300049742 Bacteria 2968
473 Ga0501080_0303899 3300049742 Bacteria 1446
474 Ga0501081_0028923 3300049743 Bacteria 3743
475 Ga0501035_0010269 3300049822 Bacteria 8686
476 Ga0501044_0018505 3300049823 Bacteria 7463
477 nmdc:mga03n38_43584_c1 3300050490 Bacteria 1967
478 nmdc:mga03n38_53666_c1 3300050490 Bacteria 1808
479 nmdc:mga03n38_60191_c1 3300050490 Bacteria 1726
480 nmdc:mga03n38_61461_c1 3300050490 Bacteria 1711
481 nmdc:mga03n38_82661_c1 3300050490 Bacteria 1512
482 nmdc:mga00v17_133045_c1 3300050491 Bacteria 1590
483 nmdc:mga00v17_331261_c1 3300050491 Bacteria 989
484 nmdc:mga00v17_38075_c1 3300050491 Bacteria 2874
485 nmdc:mga00v17_64182_c1 3300050491 Bacteria 2263
486 nmdc:mga0yw44_126100_c1 3300050492 Bacteria 1653
487 nmdc:mga0yw44_152941_c1 3300050492 Bacteria 1506
488 nmdc:mga0yw44_2784_c1 3300050492 Bacteria 7572
489 nmdc:mga07m45_210493_c1 3300050496 Bacteria 1131
490 nmdc:mga07m45_32818_c1 3300050496 Bacteria 2880
491 nmdc:mga05p37_142997_c1 3300050507 Bacteria 2930
492 nmdc:mga0qj67_77017_c1 3300050509 Bacteria 2668
493 nmdc:mga08y16_285981_c1 3300050511 Bacteria 1700
494 nmdc:mga08y16_326120_c1 3300050511 Bacteria 1580
495 nmdc:mga0n895_113382_c1 3300050512 Bacteria 2728
496 nmdc:mga0rr50_195971_c1 3300050513 Bacteria 1658
497 nmdc:mga08x19_94882_c1 3300050514 Bacteria 1973
498 nmdc:mga0sz30_2321_c1 3300050516 Bacteria 6793
499 nmdc:mga0sz30_50650_c1 3300050516 Bacteria 1760
500 nmdc:mga0sz30_64240_c1 3300050516 Bacteria 1572
501 Ga0500610_0034630 3300053079 Bacteria 2586
502 Ga0500635_0026764 3300053080 Bacteria 1828
503 Ga0495619_0083373 3300053085 Bacteria 2156
504 Ga0500643_003561 3300053087 Bacteria 7411
505 Ga0500641_0102452 3300053096 Bacteria 1228
506 Ga0500556_0002920 3300053104 Bacteria 5180
507 Ga0500562_013662 3300053108 Bacteria 2076
508 Ga0500595_075720 3300053119 Bacteria 992
509 Ga0500652_002083 3300053131 Bacteria 6013
510 Ga0500652_166275 3300053131 Bacteria 909
511 Ga0500616_0007285 3300053153 Bacteria 7057
512 Ga0500645_000490 3300053730 Bacteria 26762
513 Ga0500645_035419 3300053730 Bacteria 1487
514 Ga0501084_0113303 3300054114 Bacteria 2280
515 Ga0466962_0012658 3300061719 Bacteria 4059
516 Ga0466962_0146243 3300061719 Bacteria 1146
517 Ga0530510_0015859 3300061734 Bacteria 5327
518 2644490707 2643221687 Bacteria 6500351
519 2738668355 2738541264 Bacteria 5935393
520 2738706939 2738541274 Bacteria 6909446
521 2739147425 2738541356 Bacteria 5935017
522 2739333644 2738543028 Bacteria 6917070
523 2811848167 2808606982 Bacteria 7791042
524 2842139269 2842134933 Bacteria 5847019
525 2899361303 2899359706 Bacteria 10940472
526 2902798708 2902792274 Bacteria 7270173
527 2902800575 2902799365 Bacteria 5419524
528 2902814898 2902810491 Bacteria 6794147
529 2902838479 2902837492 Bacteria 6697721
530 2917744540 2917736166 Bacteria 9690793
531 2929217423 2929212328 Bacteria 7708288
532 2939584660 2939582691 Bacteria 7088898
533 2990089908 2990088156 Bacteria 6657676
534 Ga0307409_100004098
535 JGI24745J21846_1000885
536 JGI24744J21845_10002910
537 JGI24742J22300_10002859
538 Ga0055528_1023167
539 Ga0055540_1000043
540 Ga0055540_1004226
541 Ga0070690_100223356
542 Ga0068869_100019489
543 Ga0070666_10093788
544 Ga0070666_10123147
545 Ga0070682_100003080
546 Ga0068868_100001163
547 Ga0068868_100162543
548 Ga0070691_10010543
549 Ga0070687_100044972
550 Ga0070668_100001540
551 Ga0070668_100162205
552 Ga0070669_100018910
553 Ga0070669_100020428
554 Ga0070671_100043005
555 Ga0070671_100227223
556 Ga0070673_100071196
557 Ga0070659_100206786
558 Ga0070667_100000791
559 Ga0070667_100013169
560 Ga0070667_100013973
561 Ga0070667_100027611
562 Ga0070709_10012808
563 Ga0070714_100512386
564 Ga0070710_10000690
565 Ga0070710_10003060
566 Ga0070711_100000160
567 Ga0070711_100007595
568 Ga0070711_100271820
569 Ga0070705_100149966
570 Ga0070694_100061108
571 Ga0070663_100032577
572 Ga0070678_100000117
573 Ga0070662_100016792
574 Ga0068867_100004067
575 Ga0068867_100028527
576 Ga0070706_100341411
577 Ga0070707_100003125
578 Ga0070684_100097128
579 Ga0068853_100023310
580 Ga0068853_100023917
581 Ga0070672_100067944
582 Ga0070686_100065306
583 Ga0070686_100097616
584 Ga0070695_100103507
585 Ga0070696_100010017
586 Ga0070693_100070126
587 Ga0070665_100006373
588 Ga0070665_100009409
589 Ga0070665_100029759
590 Ga0068855_100263352
591 Ga0070664_100230222
592 Ga0068854_100009069
593 Ga0068854_100277711
594 Ga0068859_100001042
595 Ga0068859_100077098
596 Ga0068864_100534163
597 Ga0068866_10000441
598 Ga0068866_10043910
599 Ga0068861_100003820
600 Ga0068863_100001025
601 Ga0068863_100012259
602 Ga0068863_100089781
603 Ga0068858_100004832
604 Ga0068858_100014666
605 Ga0068858_100016818
606 Ga0068860_100000087
607 Ga0068860_100008728
608 Ga0068862_100000077
609 Ga0068862_100022465
610 Ga0068862_100281044
611 Ga0081455_10048103
612 Ga0081455_10050617
613 Ga0081455_10321411
614 Ga0070717_10283194
615 Ga0075365_10008384
616 Ga0075365_10021990
617 Ga0075365_10066664
618 Ga0075365_10178984
619 Ga0075363_100008437
620 Ga0075363_100047538
621 Ga0075363_100050105
622 Ga0075363_100055659
623 Ga0075364_10050924
624 Ga0075364_10073962
625 Ga0075364_10111675
626 Ga0075364_10205962
627 Ga0070716_100009944
628 Ga0070716_100025451
629 Ga0070712_100000846
630 Ga0070712_100002348
631 Ga0075362_10049670
632 Ga0075362_10120917
633 Ga0075367_10225707
634 Ga0075369_10004544
635 Ga0075369_10006368
636 Ga0075369_10014594
637 Ga0075369_10057821
638 Ga0075369_10144026
639 Ga0097621_100150291
640 Ga0075370_10053304
641 Ga0075370_10055517
642 Ga0075370_10069734
643 Ga0068871_100048970
644 Ga0075428_100071233
645 Ga0075433_10255974
646 Ga0068865_100401689
647 Ga0075436_100087314
648 Ga0097620_100001042
649 Ga0097620_100077087
650 Ga0075435_100133462
651 Ga0105250_10037242
652 Ga0111539_10328257
653 Ga0111539_10916898
654 Ga0105245_10008338
655 Ga0105245_10035982
656 Ga0105245_10059620
657 Ga0105247_10000007
658 Ga0105247_10000060
659 Ga0105247_10000298
660 Ga0114129_10212142
661 Ga0114129_10424682
662 Ga0105243_10000700
663 Ga0105243_10045903
664 Ga0105243_10333689
665 Ga0105242_10001954
666 Ga0105242_10242373
667 Ga0105248_10000050
668 Ga0105248_10003516
669 Ga0105248_10056751
670 Ga0105248_10145708
671 Ga0105237_10006011
672 Ga0105237_10011826
673 Ga0105237_10027144
674 Ga0105238_10676479
675 Ga0105249_10000042
676 Ga0105249_10000470
677 Ga0105249_10052537
678 Ga0105239_10016841
679 Ga0105239_10024596
680 Ga0105239_10082818
681 Ga0157369_10448544
682 Ga0157374_10032490
683 Ga0157378_10292006
684 Ga0157372_10048234
685 Ga0157375_10078003
686 Ga0157375_10317825
687 Ga0157375_10502654
688 Ga0163163_10094418
689 Ga0157380_10010166
690 Ga0157377_10180592
691 Ga0157379_10002499
692 Ga0157379_10052574
693 Ga0157379_10061838
694 Ga0157376_10161575
695 Ga0163161_10027061
696 Ga0163161_10041561
697 Ga0213876_10005625
698 Ga0213876_10062567
699 Ga0209673_1013931
700 Ga0209051_1000108
701 Ga0209051_1001345
702 Ga0209051_1003362
703 Ga0209051_1010755
704 Ga0209051_1024750
705 Ga0209051_1036090
706 Ga0207692_10007732
707 Ga0207642_10036329
708 Ga0207710_10000010
709 Ga0207710_10000013
710 Ga0207688_10021558
711 Ga0207688_10158374
712 Ga0207680_10014842
713 Ga0207647_10013370
714 Ga0207647_10102217
715 Ga0207685_10014881
716 Ga0207699_10005382
717 Ga0207699_10142454
718 Ga0207645_10070834
719 Ga0207684_10007648
720 Ga0207654_10169896
721 Ga0207654_10232315
722 Ga0207671_10007606
723 Ga0207671_10074011
724 Ga0207671_10234914
725 Ga0207693_10000754
726 Ga0207693_10003890
727 Ga0207693_10192297
728 Ga0207663_10004087
729 Ga0207663_10254197
730 Ga0207662_10020192
731 Ga0207646_10006984
732 Ga0207646_10041901
733 Ga0207681_10001782
734 Ga0207681_10002155
735 Ga0207681_10025217
736 Ga0207694_10477201
737 Ga0207687_10016666
738 Ga0207644_10026466
739 Ga0207690_10052045
740 Ga0207690_10221592
741 Ga0207706_10019289
742 Ga0207706_10021979
743 Ga0207686_10002494
744 Ga0207709_10007107
745 Ga0207709_10246775
746 Ga0207709_10486915
747 Ga0207669_10001189
748 Ga0207669_10021180
749 Ga0207704_10083181
750 Ga0207665_10009094
751 Ga0207691_10055981
752 Ga0207711_10001406
753 Ga0207711_10032792
754 Ga0207711_10033441
755 Ga0207711_10320052
756 Ga0207651_10062166
757 Ga0207712_10000010
758 Ga0207712_10001196
759 Ga0207668_10002892
760 Ga0207640_10009045
761 Ga0207658_10000677
762 Ga0207658_10001961
763 Ga0207658_10061168
764 Ga0207703_10009823
765 Ga0207703_10028562
766 Ga0207703_10074184
767 Ga0207703_10549154
768 Ga0207639_10007030
769 Ga0207639_10016712
770 Ga0207678_10009360
771 Ga0207678_10016046
772 Ga0207708_10016479
773 Ga0207641_10000849
774 Ga0207641_10005077
775 Ga0207641_10026225
776 Ga0207648_10014199
777 Ga0207648_10114857
778 Ga0207676_10426590
779 Ga0207675_100007850
780 Ga0207675_100063261
781 Ga0207683_10000984
782 Ga0207683_10058440
783 Ga0207698_10250822
784 Ga0268266_10030548
785 Ga0268266_10139805
786 Ga0268266_10238385
787 Ga0268265_10000014
788 Ga0268265_10128264
789 Ga0268264_10000150
790 Ga0268264_10027397
791 Ga0307511_10104160
792 Ga0265327_10002508
793 Ga0307405_10040394
794 Ga0307413_10213759
795 Ga0307410_10078120
796 Ga0307407_10024118
797 Ga0307412_10221481
798 Ga0307409_100039873
799 Ga0307411_10092790
800 Ga0307415_100077296
801 Ga0307415_100131120
802 Ga0307415_100339556
803 Ga0373939_0005374
804 Ga0316582_0116046
805 Ga0316584_0017797
806 Ga0395900_0006721
807 Ga0436364_1308388
808 Ga0436365_0052028
809 Ga0436365_0056280
810 Ga0436365_1443134
811 Ga0436362_1156483
812 Ga0439461_0000950
813 Ga0439461_0008037
814 Ga0439466_0009584
815 Ga0439466_0010268
816 Ga0439466_0023180
817 Ga0439465_0002866
818 Ga0439465_0002904
819 Ga0439465_0054227
820 Ga0451793_1722364
821 Ga0451843_1031485
822 Ga0439431_0008285
823 Ga0439431_0041265
824 Ga0439445_0018743
825 Ga0439434_0004459
826 Ga0439434_0030735
827 Ga0466969_0056737
828 Ga0466972_0008599
829 Ga0466972_0019835
830 Ga0466972_0031739
831 Ga0466965_0000697
832 Ga0466965_0002661
833 Ga0466965_0010937
834 Ga0466965_0047754
835 Ga0466965_0149834
836 Ga0466966_0120765
837 Ga0466966_0156281
838 Ga0466961_0061691
839 Ga0466961_0126180
840 Ga0466963_0058225
841 Ga0466963_0199824
842 Ga0466971_0012321
843 Ga0466971_0013054
844 Ga0466971_0079129
845 Ga0466971_0104012
846 Ga0466968_0004379
847 Ga0466968_0010033
848 Ga0466970_0106292
849 Ga0466970_0141703
850 Ga0466957_0003667
851 Ga0466957_0020307
852 Ga0466957_0051256
853 Ga0466957_0152596
854 Ga0466957_0175988
855 Ga0466960_0000225
856 Ga0466960_0000319
857 Ga0466960_0002911
858 Ga0466960_0050599
859 Ga0466959_0046101
860 Ga0466959_0049823
861 Ga0466958_0019127
862 Ga0466958_0080665
863 Ga0466958_0088296
864 Ga0466967_0001792
865 Ga0466967_0081127
866 Ga0466967_0165525
867 Ga0466967_0285203
868 Ga0495603_0023983
869 Ga0495603_0093866
870 Ga0495629_0050017
871 Ga0495638_0014063
872 Ga0495638_0017830
873 Ga0495641_0142080
874 Ga0495582_0098732
875 Ga0495639_0048277
876 Ga0495662_0140875
877 Ga0495606_0027733
878 Ga0495608_0271078
879 Ga0495630_0336482
880 Ga0495666_0044409
881 Ga0495645_0011604
882 Ga0495668_0294949
883 Ga0495635_0211791
884 Ga0495624_0110327
885 Ga0495674_0196475
886 Ga0495672_0174774
887 Ga0495676_0068721
888 Ga0495686_0001660
889 Ga0495602_0207077
890 Ga0496100_0000084
891 Ga0496100_0001148
892 Ga0496100_0001530
893 Ga0496100_0058895
894 Ga0496100_0077155
895 Ga0496100_0125224
896 Ga0496100_0154376
897 Ga0496100_0281107
898 Ga0496101_0000100
899 Ga0496101_0000110
900 Ga0496101_0001605
901 Ga0496101_0007060
902 Ga0496101_0123677
903 Ga0496101_0320118
904 Ga0496102_0000006
905 Ga0496102_0001053
906 Ga0496102_0003241
907 Ga0496102_0008322
908 Ga0496102_0031183
909 Ga0496102_0054500
910 Ga0496102_0238279
911 Ga0496103_0000006
912 Ga0496103_0000400
913 Ga0496103_0000504
914 Ga0496103_0000700
915 Ga0496103_0019049
916 Ga0496103_0134697
917 Ga0496104_0021173
918 Ga0496104_0028678
919 Ga0496104_0075523
920 Ga0496104_0165194
921 Ga0496105_0017040
922 Ga0496105_0188078
923 Ga0496105_0322161
924 Ga0496106_0000164
925 Ga0496106_0011222
926 Ga0496106_0029818
927 Ga0496106_0074760
928 Ga0496107_0010183
929 Ga0496107_0053113
930 Ga0496107_0077210
931 Ga0496107_0238721
932 Ga0496108_0006114
933 Ga0496108_0016810
934 Ga0496108_0038048
935 Ga0496108_0189634
936 Ga0496109_0000356
937 Ga0496109_0002673
938 Ga0496109_0070109
939 Ga0496109_0078789
940 Ga0496109_0371886
941 Ga0496109_0446142
942 Ga0496110_0009262
943 Ga0496111_0045234
944 Ga0496112_0012895
945 Ga0496112_0063898
946 Ga0496113_0249855
947 Ga0496113_0494599
948 Ga0496114_0000164
949 Ga0496114_0000522
950 Ga0496114_0013077
951 Ga0496114_0056611
952 Ga0496114_0148045
953 Ga0496115_0002348
954 Ga0496115_0014536
955 Ga0496115_0129879
956 Ga0496116_0000025
957 Ga0496116_0002215
958 Ga0496117_0000006
959 Ga0496117_0001137
960 Ga0496117_0042120
961 Ga0496118_0000004
962 Ga0496118_0001770
963 Ga0496119_0000035
964 Ga0496119_0004129
965 Ga0496119_0027109
966 Ga0496119_0053852
967 Ga0496119_0060289
968 Ga0496120_0000079
969 Ga0496120_0021588
970 Ga0496120_0077933
971 Ga0496121_0000004
972 Ga0496121_0000090
973 Ga0496121_0000172
974 Ga0496121_0010052
975 Ga0496122_0000805
976 Ga0496123_0003575
977 Ga0496124_0000221
978 Ga0496125_0000003
979 Ga0496125_0056347
980 Ga0496125_0076005
981 Ga0496125_0171220
982 Ga0496126_0000001
983 Ga0496126_0000180
984 Ga0496126_0004091
985 Ga0496126_0006264
986 Ga0496126_0030158
987 Ga0501033_0022381
988 Ga0501033_0035503
989 Ga0501034_0026741
990 Ga0501036_0024129
991 Ga0501038_0075693
992 Ga0501039_0000929
993 Ga0501039_0055032
994 Ga0501043_0002664
995 Ga0501046_0006675
996 Ga0501047_0009645
997 Ga0501047_0322714
998 Ga0501048_0005296
999 Ga0501070_0025716
1000 Ga0501070_0103101
1001 Ga0501073_0049629
1002 Ga0501073_0150544
1003 Ga0501075_0107293
1004 Ga0501079_0058162
1005 Ga0501080_0083453
1006 Ga0501080_0303899
1007 Ga0501081_0028923
1008 Ga0501035_0010269
1009 Ga0501044_0018505
1010 nmdc:mga03n38_43584_c1
1011 nmdc:mga03n38_53666_c1
1012 nmdc:mga03n38_60191_c1
1013 nmdc:mga03n38_61461_c1
1014 nmdc:mga03n38_82661_c1
1015 nmdc:mga00v17_133045_c1
1016 nmdc:mga00v17_331261_c1
1017 nmdc:mga00v17_38075_c1
1018 nmdc:mga00v17_64182_c1
1019 nmdc:mga0yw44_126100_c1
1020 nmdc:mga0yw44_152941_c1
1021 nmdc:mga0yw44_2784_c1
1022 nmdc:mga07m45_210493_c1
1023 nmdc:mga07m45_32818_c1
1024 nmdc:mga05p37_142997_c1
1025 nmdc:mga0qj67_77017_c1
1026 nmdc:mga08y16_285981_c1
1027 nmdc:mga08y16_326120_c1
1028 nmdc:mga0n895_113382_c1
1029 nmdc:mga0rr50_195971_c1
1030 nmdc:mga08x19_94882_c1
1031 nmdc:mga0sz30_2321_c1
1032 nmdc:mga0sz30_50650_c1
1033 nmdc:mga0sz30_64240_c1
1034 Ga0500610_0034630
1035 Ga0500635_0026764
1036 Ga0495619_0083373
1037 Ga0500643_003561
1038 Ga0500641_0102452
1039 Ga0500556_0002920
1040 Ga0500562_013662
1041 Ga0500595_075720
1042 Ga0500652_002083
1043 Ga0500652_166275
1044 Ga0500616_0007285
1045 Ga0500645_000490
1046 Ga0500645_035419
1047 Ga0501084_0113303
1048 Ga0466962_0012658
1049 Ga0466962_0146243
1050 Ga0530510_0015859
1051 2644490707
1052 2738668355
1053 2738706939
1054 2739147425
1055 2739333644
1056 2811848167
1057 2842139269
1058 2899361303
1059 2902798708
1060 2902800575
1061 2902814898
1062 2902838479
1063 2917744540
1064 2929217423
1065 2939584660
1066 2990089908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08659

KR

KR domain

77

211

0.89

PF00106

adh_short

short chain dehydrogenase

77

273

0.85

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

83

216

0.84

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

79

246

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.9801 2 289
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.9765 2 289
6l1h-assembly1.cif.gz_A crystal structure of light-dependent protochlorophyllide oxidoreductase from thermosynechococcus elongatus 0.8525 15 284
6l1h-assembly2.cif.gz_B crystal structure of light-dependent protochlorophyllide oxidoreductase from thermosynechococcus elongatus 0.8311 15 284
6r48-assembly2.cif.gz_B crystal structure of lpor (synechocystis) complexed with nadph at 1.87a resolution. 0.8242 15 284
ID Description Score Start End Superfamily
3rd5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9801 2 289 3.40.50.720
3rd5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9765 2 289 3.40.50.720
af_O53726_7_311_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.966 1 289 3.40.50.720
af_O53726_7_311_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9627 1 289 3.40.50.720
af_A0A368UI72_22_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9462 6 80 3.40.50.720
ID Description Score Start End GO Terms
AF-X8C4F2-F1-model_v4 deleted 1.005 4 98
AF-A0A2S8MLU2-F1-model_v4 deleted 1.002 1 114
AF-X8B0A6-F1-model_v4 deleted 0.9997 1 126
AF-X8AI62-F1-model_v4 Short chain dehydrogenase family protein 0.9994 16 151 GO:0016491
AF-A0A1T3W6V6-F1-model_v4 Oxidoreductase 0.9941 1 200 GO:0016491

Map