F460428

General Info

Members Datasets Scaffolds Average Seq Length
533 257 1066 166

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10622216|Ga0307411_106222162
Length 186
Sequence MKVSTLNRLVSFLASIGAGMATQCSFDITSNVDLQEVDNALNQARKEVAQRYDFKGSKANIEFNAQESLLTLVADDEFKLNALWDIVQTRLVRRNVPVRNLSRGTVTPAGNSTVRQEITLQQGIPSDKARDIVKFLKDSKLKKVQASIQSDQLRVTSASRDELQEVMRLLREADFGVALQFGNYRG

Samples

Sample ID Description Type Environment
1 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
160 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
161 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
162 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
165 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
189 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
190 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
191 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
192 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
193 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
194 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
195 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
196 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.69
Rhizosphere 94.56
Stem 0
Stem Tuber 0
Unclassified 18.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307411_10622216 3300032005 Unclassified 931
2 JGI24752J21851_1017845 3300001976 Bacteria 925
3 JGI24743J22301_10044847 3300001991 Bacteria 893
4 JGI24035J26624_1013255 3300002126 Bacteria 836
5 JGI24033J26618_1048326 3300002155 Bacteria 606
6 Ga0065714_10086660 3300005288 Bacteria 2091
7 Ga0065712_10000335 3300005290 Bacteria 16916
8 Ga0065712_10075678 3300005290 Bacteria 3809
9 Ga0065712_10095238 3300005290 Bacteria 2225
10 Ga0065712_10202405 3300005290 Bacteria 1103
11 Ga0065715_10089702 3300005293 Bacteria 8856
12 Ga0065715_10121073 3300005293 Unclassified 2240
13 Ga0065715_10736574 3300005293 Bacteria 636
14 Ga0065707_10085540 3300005295 Bacteria 6082
15 Ga0065707_10113162 3300005295 Bacteria 2336
16 Ga0065707_10200187 3300005295 Bacteria 1314
17 Ga0065707_10471111 3300005295 Viruses 782
18 Ga0070658_10116204 3300005327 Bacteria 2220
19 Ga0070676_10031201 3300005328 Bacteria 3044
20 Ga0070676_11221527 3300005328 Unclassified 572
21 Ga0070690_100119177 3300005330 Bacteria 1770
22 Ga0070690_100247626 3300005330 Bacteria 1259
23 Ga0070690_100542502 3300005330 Bacteria 876
24 Ga0070670_100001399 3300005331 Bacteria 19350
25 Ga0070670_100036246 3300005331 Bacteria 4245
26 Ga0070670_100080683 3300005331 Unclassified 2795
27 Ga0070677_10049726 3300005333 Bacteria 1690
28 Ga0070677_10110744 3300005333 Unclassified 1225
29 Ga0070677_10326369 3300005333 Unclassified 788
30 Ga0068869_100006770 3300005334 Bacteria 7286
31 Ga0068869_100482803 3300005334 Bacteria 1032
32 Ga0070666_10160327 3300005335 Bacteria 1572
33 Ga0070680_100016497 3300005336 Bacteria 5812
34 Ga0070680_100229675 3300005336 Bacteria 1567
35 Ga0068868_100048055 3300005338 Bacteria 3346
36 Ga0068868_100107118 3300005338 Bacteria 2268
37 Ga0068868_100184999 3300005338 Unclassified 1730
38 Ga0068868_100638408 3300005338 Bacteria 947
39 Ga0068868_101088903 3300005338 Bacteria 735
40 Ga0070660_100001206 3300005339 Bacteria 17544
41 Ga0070689_100120144 3300005340 Unclassified 2098
42 Ga0070689_101291718 3300005340 Bacteria 657
43 Ga0070691_10113755 3300005341 Bacteria 1356
44 Ga0070661_100570785 3300005344 Bacteria 912
45 Ga0070668_100401147 3300005347 Bacteria 1171
46 Ga0070669_100057915 3300005353 Bacteria 2844
47 Ga0070669_100227573 3300005353 Bacteria 1476
48 Ga0070669_100271802 3300005353 Bacteria 1355
49 Ga0070669_100681215 3300005353 Bacteria 867
50 Ga0070675_100000848 3300005354 Bacteria 21689
51 Ga0070675_100000879 3300005354 Bacteria 21370
52 Ga0070675_100004522 3300005354 Bacteria 10618
53 Ga0070675_100018808 3300005354 Bacteria 5499
54 Ga0070675_100027350 3300005354 Unclassified 4582
55 Ga0070675_100057425 3300005354 Bacteria 3209
56 Ga0070675_100059280 3300005354 Bacteria 3158
57 Ga0070675_100242177 3300005354 Bacteria 1576
58 Ga0070675_100448384 3300005354 Unclassified 1157
59 Ga0070675_101297837 3300005354 Bacteria 671
60 Ga0070671_100001814 3300005355 Bacteria 16246
61 Ga0070671_100117324 3300005355 Bacteria 2238
62 Ga0070671_100496924 3300005355 Unclassified 1049
63 Ga0070671_101220525 3300005355 Bacteria 662
64 Ga0070674_100004428 3300005356 Bacteria 8008
65 Ga0070674_100017045 3300005356 Bacteria 4560
66 Ga0070674_100069308 3300005356 Bacteria 2488
67 Ga0070674_101306366 3300005356 Bacteria 647
68 Ga0070673_100016335 3300005364 Bacteria 5246
69 Ga0070673_100032117 3300005364 Unclassified 3948
70 Ga0070673_100038042 3300005364 Unclassified 3671
71 Ga0070688_100191585 3300005365 Bacteria 1425
72 Ga0070688_100235594 3300005365 Bacteria 1297
73 Ga0070659_100350690 3300005366 Bacteria 1238
74 Ga0070667_100124430 3300005367 Bacteria 2246
75 Ga0070667_100190206 3300005367 Unclassified 1818
76 Ga0070667_100271164 3300005367 Unclassified 1522
77 Ga0070667_100540823 3300005367 Unclassified 1070
78 Ga0070667_100781986 3300005367 Bacteria 886
79 Ga0070701_10024256 3300005438 Bacteria 2933
80 Ga0070701_10163814 3300005438 Unclassified 1290
81 Ga0070701_10180157 3300005438 Bacteria 1236
82 Ga0070701_10212234 3300005438 Bacteria 1150
83 Ga0070700_100027222 3300005441 Bacteria 3387
84 Ga0070663_100154883 3300005455 Bacteria 1760
85 Ga0070663_100644546 3300005455 Bacteria 895
86 Ga0070678_100028787 3300005456 Bacteria 3794
87 Ga0070678_100109310 3300005456 Bacteria 2160
88 Ga0070678_100199097 3300005456 Bacteria 1652
89 Ga0070678_100456093 3300005456 Bacteria 1120
90 Ga0070662_100171848 3300005457 Bacteria 1702
91 Ga0070662_100537628 3300005457 Bacteria 978
92 Ga0070681_10017786 3300005458 Bacteria 7103
93 Ga0070681_11619720 3300005458 Unclassified 573
94 Ga0068867_100020761 3300005459 Bacteria 4682
95 Ga0068867_100157281 3300005459 Bacteria 1790
96 Ga0070698_100033937 3300005471 Bacteria 5286
97 Ga0070679_100035309 3300005530 Bacteria 4960
98 Ga0070679_100045000 3300005530 Bacteria 4397
99 Ga0070684_100279019 3300005535 Unclassified 1531
100 Ga0070684_100410617 3300005535 Bacteria 1249
101 Ga0068853_100570634 3300005539 Bacteria 1073
102 Ga0070672_100025553 3300005543 Bacteria 4382
103 Ga0070672_100046730 3300005543 Bacteria 3355
104 Ga0070672_100365081 3300005543 Bacteria 1233
105 Ga0070672_100845615 3300005543 Unclassified 807
106 Ga0070672_100850589 3300005543 Bacteria 804
107 Ga0070686_100099815 3300005544 Bacteria 1959
108 Ga0070686_100156044 3300005544 Bacteria 1603
109 Ga0070696_100716307 3300005546 Unclassified 817
110 Ga0070665_100011335 3300005548 Bacteria 9019
111 Ga0070665_100043766 3300005548 Bacteria 4498
112 Ga0070704_101371094 3300005549 Unclassified 648
113 Ga0068855_100013990 3300005563 Bacteria 9673
114 Ga0068855_100111944 3300005563 Bacteria 3133
115 Ga0070664_100008837 3300005564 Bacteria 8164
116 Ga0070664_100160492 3300005564 Bacteria 1989
117 Ga0070664_100522405 3300005564 Unclassified 1096
118 Ga0070664_100585604 3300005564 Bacteria 1034
119 Ga0070664_101012665 3300005564 Bacteria 781
120 Ga0068854_100125705 3300005578 Bacteria 1953
121 Ga0070702_100079284 3300005615 Bacteria 1962
122 Ga0068852_100801259 3300005616 Bacteria 956
123 Ga0068859_100007828 3300005617 Bacteria 10848
124 Ga0068859_100354700 3300005617 Bacteria 1561
125 Ga0068859_100627122 3300005617 Unclassified 1168
126 Ga0068859_100779963 3300005617 Bacteria 1044
127 Ga0068859_102396191 3300005617 Bacteria 582
128 Ga0068864_100008588 3300005618 Bacteria 8430
129 Ga0068864_100029481 3300005618 Bacteria 4649
130 Ga0068864_100070520 3300005618 Bacteria 3041
131 Ga0068864_100174241 3300005618 Bacteria 1963
132 Ga0068864_100617743 3300005618 Unclassified 1053
133 Ga0068866_10025466 3300005718 Unclassified 2781
134 Ga0068866_10134441 3300005718 Unclassified 1411
135 Ga0068866_10181432 3300005718 Bacteria 1244
136 Ga0068861_100042929 3300005719 Unclassified 3391
137 Ga0068861_101312412 3300005719 Unclassified 704
138 Ga0068851_10233218 3300005834 Bacteria 1038
139 Ga0068870_10067469 3300005840 Bacteria 1941
140 Ga0068870_10106513 3300005840 Bacteria 1593
141 Ga0068870_10176578 3300005840 Bacteria 1279
142 Ga0068863_100052903 3300005841 Bacteria 3848
143 Ga0068863_100096506 3300005841 Bacteria 2806
144 Ga0068863_101099269 3300005841 Bacteria 799
145 Ga0068858_100018858 3300005842 Bacteria 6456
146 Ga0068858_100022699 3300005842 Bacteria 5851
147 Ga0068858_100052066 3300005842 Bacteria 3788
148 Ga0068858_100629622 3300005842 Bacteria 1042
149 Ga0068860_100077050 3300005843 Bacteria 3171
150 Ga0068860_100238197 3300005843 Unclassified 1770
151 Ga0068860_100467416 3300005843 Bacteria 1256
152 Ga0068860_100551437 3300005843 Bacteria 1155
153 Ga0068860_100811911 3300005843 Bacteria 949
154 Ga0068860_101382211 3300005843 Unclassified 725
155 Ga0068862_100714201 3300005844 Bacteria 972
156 Ga0081538_10177086 3300005981 Bacteria 919
157 Ga0070715_10207949 3300006163 Bacteria 998
158 Ga0097621_100077114 3300006237 Bacteria 2766
159 Ga0097621_100106225 3300006237 Unclassified 2368
160 Ga0097621_100242495 3300006237 Bacteria 1576
161 Ga0068871_100032547 3300006358 Bacteria 4121
162 Ga0068871_100050315 3300006358 Bacteria 3370
163 Ga0068871_100718053 3300006358 Bacteria 917
164 Ga0068871_100865771 3300006358 Unclassified 836
165 Ga0075428_100008118 3300006844 Bacteria 11656
166 Ga0075430_100058098 3300006846 Unclassified 3252
167 Ga0075431_100008228 3300006847 Bacteria 10425
168 Ga0075434_100191994 3300006871 Bacteria 2063
169 Ga0075434_100217418 3300006871 Bacteria 1931
170 Ga0075434_100636862 3300006871 Bacteria 1085
171 Ga0068865_100068994 3300006881 Unclassified 2501
172 Ga0068865_100145081 3300006881 Bacteria 1794
173 Ga0075436_100588482 3300006914 Bacteria 819
174 Ga0097620_100007828 3300006931 Bacteria 10848
175 Ga0097620_100354698 3300006931 Bacteria 1561
176 Ga0097620_100627112 3300006931 Unclassified 1168
177 Ga0097620_100780065 3300006931 Bacteria 1044
178 Ga0097620_102396077 3300006931 Bacteria 582
179 Ga0075435_100004653 3300007076 Bacteria 9455
180 Ga0075435_100261067 3300007076 Bacteria 1476
181 Ga0105250_10229322 3300009092 Bacteria 789
182 Ga0105250_10230119 3300009092 Bacteria 788
183 Ga0105240_10340320 3300009093 Bacteria 1704
184 Ga0105240_10463977 3300009093 Bacteria 1414
185 Ga0111539_10000441 3300009094 Bacteria 52338
186 Ga0111539_10258174 3300009094 Unclassified 2029
187 Ga0111539_10304266 3300009094 Unclassified 1855
188 Ga0111539_10322386 3300009094 Bacteria 1798
189 Ga0111539_11491372 3300009094 Bacteria 784
190 Ga0105245_10087565 3300009098 Bacteria 2859
191 Ga0105245_10361262 3300009098 Bacteria 1441
192 Ga0105245_10505765 3300009098 Bacteria 1225
193 Ga0105247_10052338 3300009101 Bacteria 2517
194 Ga0105247_10075416 3300009101 Bacteria 2117
195 Ga0105247_11392059 3300009101 Unclassified 567
196 Ga0114129_10222131 3300009147 Bacteria 2548
197 Ga0114129_11065691 3300009147 Bacteria 1014
198 Ga0114129_12146883 3300009147 Bacteria 673
199 Ga0105243_10284056 3300009148 Bacteria 1492
200 Ga0105243_10380589 3300009148 Bacteria 1305
201 Ga0105243_11547227 3300009148 Bacteria 688
202 Ga0105243_12163028 3300009148 Unclassified 593
203 Ga0105241_10101338 3300009174 Unclassified 2289
204 Ga0105242_10004352 3300009176 Bacteria 11024
205 Ga0105242_10063490 3300009176 Bacteria 3041
206 Ga0105242_11811799 3300009176 Bacteria 649
207 Ga0105248_10009391 3300009177 Bacteria 10768
208 Ga0105248_10063913 3300009177 Bacteria 4132
209 Ga0105248_10090590 3300009177 Bacteria 3444
210 Ga0105248_10155899 3300009177 Bacteria 2577
211 Ga0105248_10397099 3300009177 Unclassified 1553
212 Ga0105248_10458161 3300009177 Bacteria 1437
213 Ga0105248_10652285 3300009177 Bacteria 1188
214 Ga0105248_10673234 3300009177 Bacteria 1167
215 Ga0105248_11002707 3300009177 Bacteria 943
216 Ga0105248_11060656 3300009177 Bacteria 916
217 Ga0105238_10053749 3300009551 Bacteria 4047
218 Ga0105238_12124134 3300009551 Unclassified 596
219 Ga0105249_10607822 3300009553 Bacteria 1148
220 Ga0105249_11619402 3300009553 Unclassified 720
221 Ga0105239_10172974 3300010375 Bacteria 2415
222 Ga0105246_10223415 3300011119 Bacteria 1478
223 Ga0105246_10445989 3300011119 Bacteria 1086
224 Ga0105246_10478337 3300011119 Bacteria 1053
225 Ga0157369_10724673 3300013105 Bacteria 1024
226 Ga0157374_10011305 3300013296 Bacteria 7721
227 Ga0157374_10657623 3300013296 Bacteria 1060
228 Ga0157374_11950610 3300013296 Bacteria 613
229 Ga0157378_10206068 3300013297 Bacteria 1862
230 Ga0163162_10352853 3300013306 Bacteria 1603
231 Ga0163162_11177626 3300013306 Bacteria 869
232 Ga0157375_10171016 3300013308 Bacteria 2320
233 Ga0157375_10211414 3300013308 Bacteria 2097
234 Ga0157375_10290787 3300013308 Bacteria 1797
235 Ga0157375_12945374 3300013308 Bacteria 569
236 Ga0163163_10015744 3300014325 Bacteria 7003
237 Ga0163163_10041587 3300014325 Bacteria 4495
238 Ga0163163_10203245 3300014325 Bacteria 2029
239 Ga0163163_10240633 3300014325 Bacteria 1859
240 Ga0163163_11351644 3300014325 Unclassified 774
241 Ga0157380_10010647 3300014326 Bacteria 6621
242 Ga0157380_10021980 3300014326 Bacteria 4792
243 Ga0157380_10297748 3300014326 Bacteria 1484
244 Ga0157380_10300980 3300014326 Bacteria 1477
245 Ga0157380_10334653 3300014326 Bacteria 1409
246 Ga0157377_10316937 3300014745 Unclassified 1035
247 Ga0157379_10033566 3300014968 Bacteria 4576
248 Ga0157379_10412110 3300014968 Bacteria 1243
249 Ga0157379_10928036 3300014968 Bacteria 827
250 Ga0157376_10125144 3300014969 Unclassified 2285
251 Ga0157376_10421415 3300014969 Bacteria 1295
252 Ga0157376_10665022 3300014969 Unclassified 1043
253 Ga0157376_12300107 3300014969 Bacteria 578
254 Ga0213876_10150935 3300021384 Unclassified 1236
255 Ga0213875_10002327 3300021388 Bacteria 11492
256 Ga0207666_1013666 3300025271 Bacteria 1142
257 Ga0207673_1003473 3300025290 Bacteria 1845
258 Ga0207697_10002929 3300025315 Bacteria 8628
259 Ga0207697_10035364 3300025315 Bacteria 2045
260 Ga0207697_10210040 3300025315 Bacteria 858
261 Ga0207682_10044287 3300025893 Bacteria 1824
262 Ga0207710_10127996 3300025900 Bacteria 1218
263 Ga0207710_10305617 3300025900 Bacteria 804
264 Ga0207688_10016773 3300025901 Bacteria 3976
265 Ga0207688_10052549 3300025901 Bacteria 2284
266 Ga0207688_10238057 3300025901 Bacteria 1100
267 Ga0207680_10185590 3300025903 Bacteria 1409
268 Ga0207680_10265586 3300025903 Unclassified 1189
269 Ga0207645_10005675 3300025907 Bacteria 9014
270 Ga0207643_10036324 3300025908 Bacteria 2763
271 Ga0207643_10149730 3300025908 Bacteria 1398
272 Ga0207705_10222412 3300025909 Bacteria 1434
273 Ga0207654_10082165 3300025911 Bacteria 1942
274 Ga0207707_10060901 3300025912 Bacteria 3284
275 Ga0207695_10202159 3300025913 Unclassified 1900
276 Ga0207695_10455643 3300025913 Unclassified 1162
277 Ga0207660_10419300 3300025917 Bacteria 1079
278 Ga0207662_10135703 3300025918 Bacteria 1555
279 Ga0207657_10000694 3300025919 Bacteria 35789
280 Ga0207657_10530878 3300025919 Bacteria 921
281 Ga0207649_10479012 3300025920 Bacteria 944
282 Ga0207652_10030604 3300025921 Bacteria 4509
283 Ga0207652_10050872 3300025921 Bacteria 3550
284 Ga0207681_10098528 3300025923 Bacteria 2103
285 Ga0207681_10147120 3300025923 Bacteria 1761
286 Ga0207681_10161204 3300025923 Unclassified 1691
287 Ga0207681_10294648 3300025923 Bacteria 1282
288 Ga0207681_10529879 3300025923 Bacteria 967
289 Ga0207681_10630042 3300025923 Bacteria 888
290 Ga0207694_10078255 3300025924 Bacteria 2592
291 Ga0207650_10002734 3300025925 Bacteria 12176
292 Ga0207650_10013429 3300025925 Bacteria 5671
293 Ga0207650_10033936 3300025925 Bacteria 3699
294 Ga0207650_10774805 3300025925 Bacteria 812
295 Ga0207659_10000095 3300025926 Bacteria 51635
296 Ga0207659_10001767 3300025926 Bacteria 12787
297 Ga0207659_10046964 3300025926 Bacteria 3052
298 Ga0207659_10157529 3300025926 Bacteria 1780
299 Ga0207659_10228965 3300025926 Bacteria 1498
300 Ga0207659_10334666 3300025926 Bacteria 1253
301 Ga0207659_10366578 3300025926 Bacteria 1198
302 Ga0207659_10411184 3300025926 Bacteria 1133
303 Ga0207687_10027017 3300025927 Bacteria 3847
304 Ga0207644_10190092 3300025931 Bacteria 1614
305 Ga0207706_10030743 3300025933 Bacteria 4789
306 Ga0207706_10064362 3300025933 Bacteria 3228
307 Ga0207706_10470673 3300025933 Bacteria 1086
308 Ga0207706_10683928 3300025933 Bacteria 877
309 Ga0207686_10008980 3300025934 Bacteria 5410
310 Ga0207686_10041586 3300025934 Bacteria 2804
311 Ga0207709_10039711 3300025935 Bacteria 2813
312 Ga0207670_10240429 3300025936 Bacteria 1395
313 Ga0207670_10488026 3300025936 Bacteria 999
314 Ga0207670_10954705 3300025936 Bacteria 720
315 Ga0207669_10003890 3300025937 Bacteria 6515
316 Ga0207669_10275830 3300025937 Bacteria 1265
317 Ga0207669_10468431 3300025937 Bacteria 1002
318 Ga0207669_11022971 3300025937 Bacteria 695
319 Ga0207704_10019074 3300025938 Bacteria 3595
320 Ga0207704_10432436 3300025938 Bacteria 1046
321 Ga0207704_11213042 3300025938 Unclassified 643
322 Ga0207691_10045953 3300025940 Bacteria 4014
323 Ga0207691_10085681 3300025940 Unclassified 2828
324 Ga0207691_10115200 3300025940 Bacteria 2387
325 Ga0207691_10499785 3300025940 Unclassified 1033
326 Ga0207711_10006364 3300025941 Bacteria 9951
327 Ga0207711_10183151 3300025941 Bacteria 1906
328 Ga0207711_10301631 3300025941 Bacteria 1477
329 Ga0207711_10351975 3300025941 Bacteria 1364
330 Ga0207711_10368492 3300025941 Unclassified 1332
331 Ga0207711_10651190 3300025941 Bacteria 983
332 Ga0207689_10002436 3300025942 Bacteria 17322
333 Ga0207689_10744154 3300025942 Unclassified 827
334 Ga0207689_10792685 3300025942 Unclassified 800
335 Ga0207661_10080863 3300025944 Bacteria 2683
336 Ga0207679_10049448 3300025945 Unclassified 3068
337 Ga0207679_10093351 3300025945 Bacteria 2334
338 Ga0207679_10636165 3300025945 Bacteria 964
339 Ga0207667_10037302 3300025949 Bacteria 5196
340 Ga0207651_10016904 3300025960 Bacteria 4292
341 Ga0207651_10289177 3300025960 Bacteria 1358
342 Ga0207651_10361029 3300025960 Archaea 1226
343 Ga0207651_10625853 3300025960 Unclassified 943
344 Ga0207651_10955296 3300025960 Bacteria 765
345 Ga0207712_10327757 3300025961 Bacteria 1266
346 Ga0207668_10580567 3300025972 Bacteria 974
347 Ga0207640_10088014 3300025981 Bacteria 2143
348 Ga0207640_10105188 3300025981 Bacteria 1988
349 Ga0207640_10432829 3300025981 Unclassified 1080
350 Ga0207658_10589257 3300025986 Bacteria 998
351 Ga0207658_10903664 3300025986 Unclassified 804
352 Ga0207677_10070464 3300026023 Bacteria 2464
353 Ga0207677_10124900 3300026023 Unclassified 1943
354 Ga0207677_10600837 3300026023 Bacteria 965
355 Ga0207677_11583290 3300026023 Bacteria 606
356 Ga0207703_10015112 3300026035 Bacteria 6025
357 Ga0207703_10038191 3300026035 Bacteria 3831
358 Ga0207703_10140651 3300026035 Bacteria 2094
359 Ga0207703_10428937 3300026035 Bacteria 1231
360 Ga0207703_10473809 3300026035 Unclassified 1172
361 Ga0207703_10623025 3300026035 Bacteria 1022
362 Ga0207678_10017189 3300026067 Bacteria 6350
363 Ga0207678_10046595 3300026067 Bacteria 3749
364 Ga0207678_10230167 3300026067 Bacteria 1587
365 Ga0207708_10007380 3300026075 Bacteria 8127
366 Ga0207702_10337430 3300026078 Bacteria 1439
367 Ga0207641_10097419 3300026088 Bacteria 2585
368 Ga0207641_10268675 3300026088 Bacteria 1600
369 Ga0207641_10517041 3300026088 Bacteria 1161
370 Ga0207641_10628854 3300026088 Bacteria 1053
371 Ga0207641_11358890 3300026088 Unclassified 711
372 Ga0207648_10001001 3300026089 Bacteria 31868
373 Ga0207648_10423010 3300026089 Unclassified 1210
374 Ga0207648_11632873 3300026089 Bacteria 606
375 Ga0207676_10005150 3300026095 Bacteria 9256
376 Ga0207676_10006246 3300026095 Bacteria 8411
377 Ga0207676_10016345 3300026095 Bacteria 5373
378 Ga0207676_10327598 3300026095 Bacteria 1408
379 Ga0207676_11165138 3300026095 Bacteria 763
380 Ga0207675_100123384 3300026118 Bacteria 2452
381 Ga0207675_100252833 3300026118 Bacteria 1706
382 Ga0207675_100479606 3300026118 Bacteria 1236
383 Ga0207675_100688823 3300026118 Bacteria 1030
384 Ga0207683_10024880 3300026121 Bacteria 5160
385 Ga0207683_10049043 3300026121 Bacteria 3695
386 Ga0207683_10218675 3300026121 Bacteria 1735
387 Ga0207683_10399100 3300026121 Unclassified 1265
388 Ga0207683_11540948 3300026121 Bacteria 613
389 Ga0207698_10238800 3300026142 Bacteria 1655
390 Ga0207698_10259803 3300026142 Unclassified 1595
391 Ga0207428_10006216 3300027907 Bacteria 11035
392 Ga0268266_10013630 3300028379 Bacteria 7001
393 Ga0268266_10040670 3300028379 Bacteria 3964
394 Ga0268266_10222013 3300028379 Bacteria 1737
395 Ga0268265_10363747 3300028380 Bacteria 1325
396 Ga0268265_10601307 3300028380 Bacteria 1051
397 Ga0268264_10069209 3300028381 Bacteria 2985
398 Ga0268264_10591666 3300028381 Unclassified 1092
399 Ga0268264_11344536 3300028381 Unclassified 725
400 Ga0268264_12304448 3300028381 Bacteria 545
401 Ga0307405_10199874 3300031731 Bacteria 1451
402 Ga0307416_100897507 3300032002 Bacteria 986
403 Ga0307411_10012978 3300032005 Bacteria 4575
404 Ga0373948_0001574 3300034817 Bacteria 3202
405 Ga0373950_0005808 3300034818 Bacteria 1856
406 Ga0373958_0000846 3300034819 Bacteria 3931
407 Ga0373959_0007999 3300034820 Bacteria 1787
408 Ga0373938_0002403 3300034957 Bacteria 3016
409 Ga0373928_0000340 3300035084 Bacteria 9366
410 Ga0373929_0005424 3300035085 Bacteria 2293
411 Ga0373934_0007074 3300035086 Bacteria 4164
412 Ga0373940_0003752 3300035088 Bacteria 3137
413 Ga0373949_0001722 3300035090 Bacteria 6050
414 Ga0373951_0001995 3300035091 Bacteria 5223
415 Ga0373952_0003843 3300035092 Bacteria 2721
416 Ga0373932_0001928 3300035112 Bacteria 5515
417 Ga0373939_0004081 3300035114 Bacteria 3439
418 Ga0373941_0005383 3300035115 Bacteria 3008
419 Ga0373953_0014978 3300035117 Bacteria 2800
420 Ga0373956_0021402 3300035119 Unclassified 2759
421 Ga0373960_0002996 3300035121 Bacteria 3820
422 Ga0373943_0655001 3300035170 Unclassified 621
423 Ga0373955_0019667 3300035172 Unclassified 3379
424 Ga0373942_0000829 3300035207 Bacteria 8534
425 Ga0373961_0016126 3300035241 Bacteria 1921
426 Ga0373962_0001558 3300035242 Bacteria 5438
427 Ga0373931_0000740 3300035691 Bacteria 13601
428 Ga0373937_0002572 3300036401 Bacteria 15097
429 Ga0436364_0919480 3300037853 Bacteria 92155
430 Ga0436360_0588627 3300039438 Unclassified 513
431 Ga0439453_0021945 3300041408 Bacteria 1154
432 Ga0451853_3533894 3300041512 Bacteria 1702
433 Ga0439433_0001472 3300041999 Bacteria 4866
434 Ga0439443_026664 3300042003 Unclassified 936
435 Ga0439449_0127135 3300042007 Unclassified 947
436 Ga0439449_0146889 3300042007 Bacteria 879
437 Ga0439450_022940 3300042008 Bacteria 1351
438 Ga0439462_0035000 3300042015 Unclassified 1334
439 Ga0450894_000437 3300042131 Bacteria 7174
440 Ga0450895_000673 3300042132 Bacteria 2087
441 Ga0450896_000820 3300042133 Bacteria 3520
442 Ga0439435_0002588 3300042436 Bacteria 3624
443 Ga0439464_0061935 3300042439 Bacteria 1096
444 Ga0439464_0167037 3300042439 Unclassified 693
445 Ga0439460_0120765 3300042461 Bacteria 857
446 Ga0439440_0022714 3300042993 Bacteria 1424
447 Ga0466963_0144552 3300044694 Bacteria 1649
448 Ga0451576_0015430 3300045051 Bacteria 8462
449 Ga0495592_0193702 3300046454 Unclassified 1376
450 Ga0495651_0046655 3300046462 Unclassified 3353
451 Ga0495640_0843032 3300046533 Bacteria 545
452 Ga0495586_0263252 3300046535 Bacteria 985
453 Ga0495645_0102628 3300046543 Bacteria 2033
454 Ga0495599_0074330 3300046678 Bacteria 2122
455 Ga0495623_0194227 3300046679 Unclassified 1171
456 Ga0495658_0239478 3300046683 Bacteria 1139
457 Ga0495658_0434823 3300046683 Bacteria 838
458 Ga0495613_0053522 3300046689 Bacteria 2970
459 Ga0495670_0171171 3300046691 Bacteria 1144
460 Ga0495670_0578139 3300046691 Bacteria 612
461 Ga0496100_0091439 3300048903 Bacteria 2077
462 Ga0496101_0251483 3300048904 Bacteria 1377
463 Ga0496104_0044451 3300048907 Bacteria 4173
464 Ga0496105_0179063 3300048908 Unclassified 1736
465 Ga0496106_0053477 3300048909 Bacteria 3050
466 Ga0496106_0108636 3300048909 Bacteria 2158
467 Ga0496106_0888280 3300048909 Bacteria 704
468 Ga0496107_0091293 3300048910 Bacteria 2226
469 Ga0496107_0405010 3300048910 Bacteria 1014
470 Ga0496108_0058962 3300048911 Bacteria 3228
471 Ga0496108_0147564 3300048911 Bacteria 2028
472 Ga0496108_0371031 3300048911 Bacteria 1249
473 Ga0496109_0023019 3300048912 Bacteria 5524
474 Ga0496109_0067709 3300048912 Bacteria 3272
475 Ga0496110_0030194 3300048913 Bacteria 4670
476 Ga0496110_0061287 3300048913 Bacteria 3320
477 Ga0496111_0113090 3300048914 Unclassified 2000
478 Ga0496111_0214135 3300048914 Bacteria 1431
479 Ga0496112_0004999 3300048915 Bacteria 11373
480 Ga0496112_0078827 3300048915 Bacteria 3257
481 Ga0496113_0015902 3300048916 Bacteria 5186
482 Ga0496113_0079948 3300048916 Unclassified 2503
483 Ga0496114_0694822 3300048917 Bacteria 892
484 Ga0496114_0934018 3300048917 Unclassified 749
485 Ga0496115_0017593 3300048918 Bacteria 5470
486 Ga0501033_0016796 3300049570 Bacteria 5535
487 Ga0501038_0407317 3300049574 Bacteria 1051
488 Ga0501039_0039958 3300049575 Unclassified 3622
489 Ga0501040_0000719 3300049576 Bacteria 20451
490 Ga0501040_0669066 3300049576 Unclassified 750
491 Ga0501041_0012341 3300049577 Bacteria 5061
492 Ga0501042_0003741 3300049578 Bacteria 9614
493 Ga0501046_0002475 3300049580 Bacteria 17314
494 Ga0501048_0015280 3300049582 Bacteria 5669
495 Ga0501067_0032159 3300049583 Bacteria 2912
496 Ga0501068_0083374 3300049584 Bacteria 1965
497 Ga0501068_0154908 3300049584 Bacteria 1442
498 Ga0501069_0376117 3300049585 Bacteria 839
499 Ga0501071_0418896 3300049587 Bacteria 1023
500 Ga0501072_0052584 3300049588 Unclassified 3207
501 Ga0501074_0026067 3300049590 Unclassified 4240
502 Ga0501075_0000043 3300049591 Bacteria 51143
503 Ga0501075_0314185 3300049591 Unclassified 1194
504 Ga0501075_0342866 3300049591 Unclassified 1139
505 Ga0501076_0009500 3300049592 Bacteria 7184
506 Ga0501077_0016563 3300049593 Unclassified 4644
507 Ga0501077_0408390 3300049593 Bacteria 868
508 Ga0501079_0001578 3300049741 Bacteria 16191
509 Ga0501079_1294022 3300049741 Bacteria 574
510 Ga0501080_0116387 3300049742 Unclassified 2478
511 Ga0501081_0002138 3300049743 Bacteria 12373
512 Ga0501083_0264763 3300049744 Bacteria 1118
513 Ga0501083_0351071 3300049744 Unclassified 959
514 Ga0501045_0105186 3300049824 Unclassified 2091
515 nmdc:mga09592_1272329_c1 3300050508 Bacteria 606
516 nmdc:mga06r32_1633342_c1 3300050510 Bacteria 582
517 nmdc:mga06r32_430210_c1 3300050510 Bacteria 1301
518 nmdc:mga08y16_3800_c1 3300050511 Bacteria 15726
519 nmdc:mga08y16_576739_c1 3300050511 Unclassified 1136
520 nmdc:mga0n895_198996_c1 3300050512 Bacteria 2035
521 nmdc:mga0n895_212718_c1 3300050512 Bacteria 1963
522 nmdc:mga0rr50_939_c1 3300050513 Bacteria 15765
523 nmdc:mga08x19_510714_c1 3300050514 Bacteria 849
524 Ga0501084_0023846 3300054114 Bacteria 5103
525 Ga0501084_0480776 3300054114 Bacteria 1050
526 Ga0501084_0809507 3300054114 Bacteria 789
527 Ga0501084_1174652 3300054114 Bacteria 644
528 Ga0590075_017198 3300059424 Bacteria 1782
529 Ga0590075_063572 3300059424 Bacteria 952
530 Ga0501082_0084383 3300060353 Unclassified 2739
531 Ga0501082_0951455 3300060353 Bacteria 751
532 Ga0530510_0006661 3300061734 Bacteria 8056
533 Ga0530510_0672240 3300061734 Unclassified 789
534 Ga0307411_10622216
535 JGI24752J21851_1017845
536 JGI24743J22301_10044847
537 JGI24035J26624_1013255
538 JGI24033J26618_1048326
539 Ga0065714_10086660
540 Ga0065712_10000335
541 Ga0065712_10075678
542 Ga0065712_10095238
543 Ga0065712_10202405
544 Ga0065715_10089702
545 Ga0065715_10121073
546 Ga0065715_10736574
547 Ga0065707_10085540
548 Ga0065707_10113162
549 Ga0065707_10200187
550 Ga0065707_10471111
551 Ga0070658_10116204
552 Ga0070676_10031201
553 Ga0070676_11221527
554 Ga0070690_100119177
555 Ga0070690_100247626
556 Ga0070690_100542502
557 Ga0070670_100001399
558 Ga0070670_100036246
559 Ga0070670_100080683
560 Ga0070677_10049726
561 Ga0070677_10110744
562 Ga0070677_10326369
563 Ga0068869_100006770
564 Ga0068869_100482803
565 Ga0070666_10160327
566 Ga0070680_100016497
567 Ga0070680_100229675
568 Ga0068868_100048055
569 Ga0068868_100107118
570 Ga0068868_100184999
571 Ga0068868_100638408
572 Ga0068868_101088903
573 Ga0070660_100001206
574 Ga0070689_100120144
575 Ga0070689_101291718
576 Ga0070691_10113755
577 Ga0070661_100570785
578 Ga0070668_100401147
579 Ga0070669_100057915
580 Ga0070669_100227573
581 Ga0070669_100271802
582 Ga0070669_100681215
583 Ga0070675_100000848
584 Ga0070675_100000879
585 Ga0070675_100004522
586 Ga0070675_100018808
587 Ga0070675_100027350
588 Ga0070675_100057425
589 Ga0070675_100059280
590 Ga0070675_100242177
591 Ga0070675_100448384
592 Ga0070675_101297837
593 Ga0070671_100001814
594 Ga0070671_100117324
595 Ga0070671_100496924
596 Ga0070671_101220525
597 Ga0070674_100004428
598 Ga0070674_100017045
599 Ga0070674_100069308
600 Ga0070674_101306366
601 Ga0070673_100016335
602 Ga0070673_100032117
603 Ga0070673_100038042
604 Ga0070688_100191585
605 Ga0070688_100235594
606 Ga0070659_100350690
607 Ga0070667_100124430
608 Ga0070667_100190206
609 Ga0070667_100271164
610 Ga0070667_100540823
611 Ga0070667_100781986
612 Ga0070701_10024256
613 Ga0070701_10163814
614 Ga0070701_10180157
615 Ga0070701_10212234
616 Ga0070700_100027222
617 Ga0070663_100154883
618 Ga0070663_100644546
619 Ga0070678_100028787
620 Ga0070678_100109310
621 Ga0070678_100199097
622 Ga0070678_100456093
623 Ga0070662_100171848
624 Ga0070662_100537628
625 Ga0070681_10017786
626 Ga0070681_11619720
627 Ga0068867_100020761
628 Ga0068867_100157281
629 Ga0070698_100033937
630 Ga0070679_100035309
631 Ga0070679_100045000
632 Ga0070684_100279019
633 Ga0070684_100410617
634 Ga0068853_100570634
635 Ga0070672_100025553
636 Ga0070672_100046730
637 Ga0070672_100365081
638 Ga0070672_100845615
639 Ga0070672_100850589
640 Ga0070686_100099815
641 Ga0070686_100156044
642 Ga0070696_100716307
643 Ga0070665_100011335
644 Ga0070665_100043766
645 Ga0070704_101371094
646 Ga0068855_100013990
647 Ga0068855_100111944
648 Ga0070664_100008837
649 Ga0070664_100160492
650 Ga0070664_100522405
651 Ga0070664_100585604
652 Ga0070664_101012665
653 Ga0068854_100125705
654 Ga0070702_100079284
655 Ga0068852_100801259
656 Ga0068859_100007828
657 Ga0068859_100354700
658 Ga0068859_100627122
659 Ga0068859_100779963
660 Ga0068859_102396191
661 Ga0068864_100008588
662 Ga0068864_100029481
663 Ga0068864_100070520
664 Ga0068864_100174241
665 Ga0068864_100617743
666 Ga0068866_10025466
667 Ga0068866_10134441
668 Ga0068866_10181432
669 Ga0068861_100042929
670 Ga0068861_101312412
671 Ga0068851_10233218
672 Ga0068870_10067469
673 Ga0068870_10106513
674 Ga0068870_10176578
675 Ga0068863_100052903
676 Ga0068863_100096506
677 Ga0068863_101099269
678 Ga0068858_100018858
679 Ga0068858_100022699
680 Ga0068858_100052066
681 Ga0068858_100629622
682 Ga0068860_100077050
683 Ga0068860_100238197
684 Ga0068860_100467416
685 Ga0068860_100551437
686 Ga0068860_100811911
687 Ga0068860_101382211
688 Ga0068862_100714201
689 Ga0081538_10177086
690 Ga0070715_10207949
691 Ga0097621_100077114
692 Ga0097621_100106225
693 Ga0097621_100242495
694 Ga0068871_100032547
695 Ga0068871_100050315
696 Ga0068871_100718053
697 Ga0068871_100865771
698 Ga0075428_100008118
699 Ga0075430_100058098
700 Ga0075431_100008228
701 Ga0075434_100191994
702 Ga0075434_100217418
703 Ga0075434_100636862
704 Ga0068865_100068994
705 Ga0068865_100145081
706 Ga0075436_100588482
707 Ga0097620_100007828
708 Ga0097620_100354698
709 Ga0097620_100627112
710 Ga0097620_100780065
711 Ga0097620_102396077
712 Ga0075435_100004653
713 Ga0075435_100261067
714 Ga0105250_10229322
715 Ga0105250_10230119
716 Ga0105240_10340320
717 Ga0105240_10463977
718 Ga0111539_10000441
719 Ga0111539_10258174
720 Ga0111539_10304266
721 Ga0111539_10322386
722 Ga0111539_11491372
723 Ga0105245_10087565
724 Ga0105245_10361262
725 Ga0105245_10505765
726 Ga0105247_10052338
727 Ga0105247_10075416
728 Ga0105247_11392059
729 Ga0114129_10222131
730 Ga0114129_11065691
731 Ga0114129_12146883
732 Ga0105243_10284056
733 Ga0105243_10380589
734 Ga0105243_11547227
735 Ga0105243_12163028
736 Ga0105241_10101338
737 Ga0105242_10004352
738 Ga0105242_10063490
739 Ga0105242_11811799
740 Ga0105248_10009391
741 Ga0105248_10063913
742 Ga0105248_10090590
743 Ga0105248_10155899
744 Ga0105248_10397099
745 Ga0105248_10458161
746 Ga0105248_10652285
747 Ga0105248_10673234
748 Ga0105248_11002707
749 Ga0105248_11060656
750 Ga0105238_10053749
751 Ga0105238_12124134
752 Ga0105249_10607822
753 Ga0105249_11619402
754 Ga0105239_10172974
755 Ga0105246_10223415
756 Ga0105246_10445989
757 Ga0105246_10478337
758 Ga0157369_10724673
759 Ga0157374_10011305
760 Ga0157374_10657623
761 Ga0157374_11950610
762 Ga0157378_10206068
763 Ga0163162_10352853
764 Ga0163162_11177626
765 Ga0157375_10171016
766 Ga0157375_10211414
767 Ga0157375_10290787
768 Ga0157375_12945374
769 Ga0163163_10015744
770 Ga0163163_10041587
771 Ga0163163_10203245
772 Ga0163163_10240633
773 Ga0163163_11351644
774 Ga0157380_10010647
775 Ga0157380_10021980
776 Ga0157380_10297748
777 Ga0157380_10300980
778 Ga0157380_10334653
779 Ga0157377_10316937
780 Ga0157379_10033566
781 Ga0157379_10412110
782 Ga0157379_10928036
783 Ga0157376_10125144
784 Ga0157376_10421415
785 Ga0157376_10665022
786 Ga0157376_12300107
787 Ga0213876_10150935
788 Ga0213875_10002327
789 Ga0207666_1013666
790 Ga0207673_1003473
791 Ga0207697_10002929
792 Ga0207697_10035364
793 Ga0207697_10210040
794 Ga0207682_10044287
795 Ga0207710_10127996
796 Ga0207710_10305617
797 Ga0207688_10016773
798 Ga0207688_10052549
799 Ga0207688_10238057
800 Ga0207680_10185590
801 Ga0207680_10265586
802 Ga0207645_10005675
803 Ga0207643_10036324
804 Ga0207643_10149730
805 Ga0207705_10222412
806 Ga0207654_10082165
807 Ga0207707_10060901
808 Ga0207695_10202159
809 Ga0207695_10455643
810 Ga0207660_10419300
811 Ga0207662_10135703
812 Ga0207657_10000694
813 Ga0207657_10530878
814 Ga0207649_10479012
815 Ga0207652_10030604
816 Ga0207652_10050872
817 Ga0207681_10098528
818 Ga0207681_10147120
819 Ga0207681_10161204
820 Ga0207681_10294648
821 Ga0207681_10529879
822 Ga0207681_10630042
823 Ga0207694_10078255
824 Ga0207650_10002734
825 Ga0207650_10013429
826 Ga0207650_10033936
827 Ga0207650_10774805
828 Ga0207659_10000095
829 Ga0207659_10001767
830 Ga0207659_10046964
831 Ga0207659_10157529
832 Ga0207659_10228965
833 Ga0207659_10334666
834 Ga0207659_10366578
835 Ga0207659_10411184
836 Ga0207687_10027017
837 Ga0207644_10190092
838 Ga0207706_10030743
839 Ga0207706_10064362
840 Ga0207706_10470673
841 Ga0207706_10683928
842 Ga0207686_10008980
843 Ga0207686_10041586
844 Ga0207709_10039711
845 Ga0207670_10240429
846 Ga0207670_10488026
847 Ga0207670_10954705
848 Ga0207669_10003890
849 Ga0207669_10275830
850 Ga0207669_10468431
851 Ga0207669_11022971
852 Ga0207704_10019074
853 Ga0207704_10432436
854 Ga0207704_11213042
855 Ga0207691_10045953
856 Ga0207691_10085681
857 Ga0207691_10115200
858 Ga0207691_10499785
859 Ga0207711_10006364
860 Ga0207711_10183151
861 Ga0207711_10301631
862 Ga0207711_10351975
863 Ga0207711_10368492
864 Ga0207711_10651190
865 Ga0207689_10002436
866 Ga0207689_10744154
867 Ga0207689_10792685
868 Ga0207661_10080863
869 Ga0207679_10049448
870 Ga0207679_10093351
871 Ga0207679_10636165
872 Ga0207667_10037302
873 Ga0207651_10016904
874 Ga0207651_10289177
875 Ga0207651_10361029
876 Ga0207651_10625853
877 Ga0207651_10955296
878 Ga0207712_10327757
879 Ga0207668_10580567
880 Ga0207640_10088014
881 Ga0207640_10105188
882 Ga0207640_10432829
883 Ga0207658_10589257
884 Ga0207658_10903664
885 Ga0207677_10070464
886 Ga0207677_10124900
887 Ga0207677_10600837
888 Ga0207677_11583290
889 Ga0207703_10015112
890 Ga0207703_10038191
891 Ga0207703_10140651
892 Ga0207703_10428937
893 Ga0207703_10473809
894 Ga0207703_10623025
895 Ga0207678_10017189
896 Ga0207678_10046595
897 Ga0207678_10230167
898 Ga0207708_10007380
899 Ga0207702_10337430
900 Ga0207641_10097419
901 Ga0207641_10268675
902 Ga0207641_10517041
903 Ga0207641_10628854
904 Ga0207641_11358890
905 Ga0207648_10001001
906 Ga0207648_10423010
907 Ga0207648_11632873
908 Ga0207676_10005150
909 Ga0207676_10006246
910 Ga0207676_10016345
911 Ga0207676_10327598
912 Ga0207676_11165138
913 Ga0207675_100123384
914 Ga0207675_100252833
915 Ga0207675_100479606
916 Ga0207675_100688823
917 Ga0207683_10024880
918 Ga0207683_10049043
919 Ga0207683_10218675
920 Ga0207683_10399100
921 Ga0207683_11540948
922 Ga0207698_10238800
923 Ga0207698_10259803
924 Ga0207428_10006216
925 Ga0268266_10013630
926 Ga0268266_10040670
927 Ga0268266_10222013
928 Ga0268265_10363747
929 Ga0268265_10601307
930 Ga0268264_10069209
931 Ga0268264_10591666
932 Ga0268264_11344536
933 Ga0268264_12304448
934 Ga0307405_10199874
935 Ga0307416_100897507
936 Ga0307411_10012978
937 Ga0373948_0001574
938 Ga0373950_0005808
939 Ga0373958_0000846
940 Ga0373959_0007999
941 Ga0373938_0002403
942 Ga0373928_0000340
943 Ga0373929_0005424
944 Ga0373934_0007074
945 Ga0373940_0003752
946 Ga0373949_0001722
947 Ga0373951_0001995
948 Ga0373952_0003843
949 Ga0373932_0001928
950 Ga0373939_0004081
951 Ga0373941_0005383
952 Ga0373953_0014978
953 Ga0373956_0021402
954 Ga0373960_0002996
955 Ga0373943_0655001
956 Ga0373955_0019667
957 Ga0373942_0000829
958 Ga0373961_0016126
959 Ga0373962_0001558
960 Ga0373931_0000740
961 Ga0373937_0002572
962 Ga0436364_0919480
963 Ga0436360_0588627
964 Ga0439453_0021945
965 Ga0451853_3533894
966 Ga0439433_0001472
967 Ga0439443_026664
968 Ga0439449_0127135
969 Ga0439449_0146889
970 Ga0439450_022940
971 Ga0439462_0035000
972 Ga0450894_000437
973 Ga0450895_000673
974 Ga0450896_000820
975 Ga0439435_0002588
976 Ga0439464_0061935
977 Ga0439464_0167037
978 Ga0439460_0120765
979 Ga0439440_0022714
980 Ga0466963_0144552
981 Ga0451576_0015430
982 Ga0495592_0193702
983 Ga0495651_0046655
984 Ga0495640_0843032
985 Ga0495586_0263252
986 Ga0495645_0102628
987 Ga0495599_0074330
988 Ga0495623_0194227
989 Ga0495658_0239478
990 Ga0495658_0434823
991 Ga0495613_0053522
992 Ga0495670_0171171
993 Ga0495670_0578139
994 Ga0496100_0091439
995 Ga0496101_0251483
996 Ga0496104_0044451
997 Ga0496105_0179063
998 Ga0496106_0053477
999 Ga0496106_0108636
1000 Ga0496106_0888280
1001 Ga0496107_0091293
1002 Ga0496107_0405010
1003 Ga0496108_0058962
1004 Ga0496108_0147564
1005 Ga0496108_0371031
1006 Ga0496109_0023019
1007 Ga0496109_0067709
1008 Ga0496110_0030194
1009 Ga0496110_0061287
1010 Ga0496111_0113090
1011 Ga0496111_0214135
1012 Ga0496112_0004999
1013 Ga0496112_0078827
1014 Ga0496113_0015902
1015 Ga0496113_0079948
1016 Ga0496114_0694822
1017 Ga0496114_0934018
1018 Ga0496115_0017593
1019 Ga0501033_0016796
1020 Ga0501038_0407317
1021 Ga0501039_0039958
1022 Ga0501040_0000719
1023 Ga0501040_0669066
1024 Ga0501041_0012341
1025 Ga0501042_0003741
1026 Ga0501046_0002475
1027 Ga0501048_0015280
1028 Ga0501067_0032159
1029 Ga0501068_0083374
1030 Ga0501068_0154908
1031 Ga0501069_0376117
1032 Ga0501071_0418896
1033 Ga0501072_0052584
1034 Ga0501074_0026067
1035 Ga0501075_0000043
1036 Ga0501075_0314185
1037 Ga0501075_0342866
1038 Ga0501076_0009500
1039 Ga0501077_0016563
1040 Ga0501077_0408390
1041 Ga0501079_0001578
1042 Ga0501079_1294022
1043 Ga0501080_0116387
1044 Ga0501081_0002138
1045 Ga0501083_0264763
1046 Ga0501083_0351071
1047 Ga0501045_0105186
1048 nmdc:mga09592_1272329_c1
1049 nmdc:mga06r32_1633342_c1
1050 nmdc:mga06r32_430210_c1
1051 nmdc:mga08y16_3800_c1
1052 nmdc:mga08y16_576739_c1
1053 nmdc:mga0n895_198996_c1
1054 nmdc:mga0n895_212718_c1
1055 nmdc:mga0rr50_939_c1
1056 nmdc:mga08x19_510714_c1
1057 Ga0501084_0023846
1058 Ga0501084_0480776
1059 Ga0501084_0809507
1060 Ga0501084_1174652
1061 Ga0590075_017198
1062 Ga0590075_063572
1063 Ga0501082_0084383
1064 Ga0501082_0951455
1065 Ga0530510_0006661
1066 Ga0530510_0672240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04461

DUF520

Protein of unknown function (DUF520)

24

185

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.9327 5 167
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.9317 6 167
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.9218 5 167
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.9208 6 167
1c0t-assembly1.cif.gz_A crystal structure of hiv-1 reverse transcriptase in complex with bm+21.1326 0.7135 111 161
ID Description Score Start End Superfamily
1in0B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9733 104 167 3.30.70.860
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9521 12 103 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9467 12 103 3.30.70.990
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9437 12 98 3.30.70.990
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9422 12 103 3.30.70.990
ID Description Score Start End GO Terms
AF-A0A377KAU0-F1-model_v4 Nucleotide-binding protein 1 11 77 GO:0000166
GO:0005829
AF-A0A379VV48-F1-model_v4 Putative nucleotide-binding protein 0.995 11 72 GO:0000166
GO:0005829
AF-A0A7W0J5U9-F1-model_v4 Nucleotide-binding protein 0.9937 13 102 GO:0000166
GO:0005829
AF-A0A3B1CFJ7-F1-model_v4 UPF0234 protein Yitk 0.9923 11 77 GO:0000166
GO:0005829
AF-A0A3S4GE15-F1-model_v4 deleted 0.9908 11 76

Map