F460438

General Info

Members Datasets Scaffolds Average Seq Length
533 187 533 219

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0103635|Ga0395900_0103635_788_1507
Length 239
Sequence LQGLPRQISGGGQALSSAPRRAQSVWDLPVRIVHWLLAALIAFSWWSVHXXXTDWHIWSGCAILTLLIFRLLWGFVGSSTARWTSFVGGPASVLAHLRGKWNGIGHTPLGAVSVVAIFLALTVQVGLGLISEDEDGIYTGPLSGLVSIDTSDKARDVHALWFDVILALILLHVAAIVYYRFRGRKLTKPMITGRAVLEPGTQPMRPGKWWVALICLAVGIGVTRWVIAGAPPFGHWTPS

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
154 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6
Rhizosphere 94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1010719 3300001976 Bacteria 1196
2 JGI24740J21852_10028415 3300001979 Bacteria 1848
3 JGI24740J21852_10028562 3300001979 Bacteria 1842
4 JGI24737J22298_10019577 3300001990 Bacteria 2164
5 JGI24735J21928_10031788 3300002067 Bacteria 1564
6 JGI24738J21930_10029111 3300002075 Bacteria 1130
7 JGI24744J21845_10000072 3300002077 Bacteria 12527
8 Ga0065715_10203744 3300005293 Bacteria 1294
9 Ga0070658_10012328 3300005327 Bacteria 6864
10 Ga0070658_10018678 3300005327 Bacteria 5553
11 Ga0070658_10025337 3300005327 Bacteria 4756
12 Ga0070658_10092103 3300005327 Bacteria 2499
13 Ga0070658_10158952 3300005327 Bacteria 1895
14 Ga0070676_10019947 3300005328 Bacteria 3735
15 Ga0070676_10354514 3300005328 Bacteria 1009
16 Ga0070683_100020037 3300005329 Bacteria 5947
17 Ga0070683_100029136 3300005329 Bacteria 4995
18 Ga0070683_100152703 3300005329 Bacteria 2189
19 Ga0070690_100008291 3300005330 Bacteria 5977
20 Ga0070670_100562064 3300005331 Bacteria 1018
21 Ga0070666_10001975 3300005335 Bacteria 12494
22 Ga0070666_10003290 3300005335 Bacteria 9807
23 Ga0070666_10204426 3300005335 Bacteria 1390
24 Ga0070680_100001960 3300005336 Bacteria 15158
25 Ga0070680_100007602 3300005336 Bacteria 8267
26 Ga0070680_100008811 3300005336 Bacteria 7739
27 Ga0070680_100011384 3300005336 Bacteria 6879
28 Ga0070680_100017846 3300005336 Bacteria 5599
29 Ga0070680_100059024 3300005336 Bacteria 3138
30 Ga0070682_100002765 3300005337 Bacteria 9713
31 Ga0070682_100086275 3300005337 Bacteria 2044
32 Ga0070682_100156071 3300005337 Bacteria 1571
33 Ga0068868_100001497 3300005338 Bacteria 16125
34 Ga0068868_100040484 3300005338 Bacteria 3627
35 Ga0068868_100055402 3300005338 Bacteria 3128
36 Ga0068868_100079400 3300005338 Bacteria 2628
37 Ga0070660_100012165 3300005339 Bacteria 6144
38 Ga0070660_100022407 3300005339 Bacteria 4671
39 Ga0070660_100037983 3300005339 Bacteria 3653
40 Ga0070660_100079712 3300005339 Bacteria 2569
41 Ga0070660_100087800 3300005339 Bacteria 2448
42 Ga0070660_100331902 3300005339 Bacteria 1250
43 Ga0070660_100438687 3300005339 Bacteria 1082
44 Ga0070689_100292869 3300005340 Bacteria 1353
45 Ga0070691_10012038 3300005341 Bacteria 3962
46 Ga0070687_100165315 3300005343 Unclassified 1312
47 Ga0070661_100009699 3300005344 Bacteria 6678
48 Ga0070661_100013255 3300005344 Bacteria 5786
49 Ga0070661_100024072 3300005344 Bacteria 4368
50 Ga0070661_100040242 3300005344 Bacteria 3409
51 Ga0070661_100485454 3300005344 Bacteria 987
52 Ga0070692_10029359 3300005345 Bacteria 2740
53 Ga0070675_100052515 3300005354 Bacteria 3351
54 Ga0070675_100065993 3300005354 Bacteria 2993
55 Ga0070675_100069765 3300005354 Bacteria 2912
56 Ga0070671_100023117 3300005355 Bacteria 5082
57 Ga0070671_100032123 3300005355 Bacteria 4341
58 Ga0070671_100083381 3300005355 Bacteria 2673
59 Ga0070671_100102644 3300005355 Bacteria 2399
60 Ga0070671_100105375 3300005355 Bacteria 2366
61 Ga0070674_100004983 3300005356 Bacteria 7614
62 Ga0070674_100043898 3300005356 Bacteria 3044
63 Ga0070674_100063650 3300005356 Bacteria 2582
64 Ga0070673_100001132 3300005364 Bacteria 15331
65 Ga0070673_100003531 3300005364 Bacteria 9752
66 Ga0070673_100361679 3300005364 Bacteria 1290
67 Ga0070673_100503552 3300005364 Bacteria 1096
68 Ga0070659_100019290 3300005366 Bacteria 5165
69 Ga0070659_100022605 3300005366 Bacteria 4801
70 Ga0070659_100028342 3300005366 Bacteria 4323
71 Ga0070659_100079490 3300005366 Bacteria 2617
72 Ga0070659_100174893 3300005366 Bacteria 1760
73 Ga0070659_100263080 3300005366 Bacteria 1431
74 Ga0070659_100490922 3300005366 Unclassified 1046
75 Ga0070667_100005255 3300005367 Bacteria 10826
76 Ga0070667_100020316 3300005367 Bacteria 5513
77 Ga0070667_100044768 3300005367 Bacteria 3718
78 Ga0070667_100548319 3300005367 Bacteria 1063
79 Ga0070714_100281075 3300005435 Bacteria 1546
80 Ga0070714_100760452 3300005435 Unclassified 937
81 Ga0070713_100014782 3300005436 Bacteria 5809
82 Ga0070663_100016007 3300005455 Bacteria 4856
83 Ga0070663_100052968 3300005455 Bacteria 2896
84 Ga0070663_100073497 3300005455 Bacteria 2494
85 Ga0070663_100176802 3300005455 Bacteria 1653
86 Ga0070663_100238366 3300005455 Bacteria 1435
87 Ga0070678_100005013 3300005456 Bacteria 7591
88 Ga0070678_100005250 3300005456 Bacteria 7459
89 Ga0070678_100081154 3300005456 Bacteria 2458
90 Ga0070662_100002632 3300005457 Bacteria 11074
91 Ga0070662_100005625 3300005457 Bacteria 8016
92 Ga0070662_100088946 3300005457 Bacteria 2316
93 Ga0070662_100153168 3300005457 Bacteria 1797
94 Ga0070681_10030807 3300005458 Bacteria 5384
95 Ga0070681_10067399 3300005458 Bacteria 3547
96 Ga0068867_100006361 3300005459 Bacteria 8348
97 Ga0070685_10032615 3300005466 Bacteria 2918
98 Ga0070679_100027755 3300005530 Bacteria 5575
99 Ga0070679_100030368 3300005530 Bacteria 5336
100 Ga0070679_100319850 3300005530 Bacteria 1501
101 Ga0070679_100482545 3300005530 Bacteria 1184
102 Ga0070679_100635212 3300005530 Unclassified 1011
103 Ga0070684_100016831 3300005535 Bacteria 5988
104 Ga0070684_100023225 3300005535 Bacteria 5183
105 Ga0070684_100076123 3300005535 Bacteria 2961
106 Ga0070684_100805962 3300005535 Unclassified 878
107 Ga0068853_100055802 3300005539 Bacteria 3405
108 Ga0068853_100064792 3300005539 Bacteria 3170
109 Ga0068853_100089050 3300005539 Bacteria 2710
110 Ga0068853_100189104 3300005539 Bacteria 1870
111 Ga0068853_100318290 3300005539 Bacteria 1442
112 Ga0068853_100530134 3300005539 Unclassified 1114
113 Ga0068853_100795068 3300005539 Bacteria 906
114 Ga0070672_100005635 3300005543 Bacteria 8330
115 Ga0070672_100006621 3300005543 Bacteria 7802
116 Ga0070672_100154751 3300005543 Bacteria 1898
117 Ga0070695_100253821 3300005545 Bacteria 1281
118 Ga0070696_100263916 3300005546 Bacteria 1307
119 Ga0070693_100001691 3300005547 Bacteria 10011
120 Ga0070665_100016126 3300005548 Bacteria 7498
121 Ga0070665_100034511 3300005548 Bacteria 5088
122 Ga0070665_100273007 3300005548 Bacteria 1692
123 Ga0068855_100019383 3300005563 Bacteria 8173
124 Ga0068855_100182411 3300005563 Bacteria 2372
125 Ga0068855_100274337 3300005563 Bacteria 1874
126 Ga0068855_100820224 3300005563 Bacteria 988
127 Ga0068855_100860789 3300005563 Bacteria 960
128 Ga0070664_100007622 3300005564 Bacteria 8740
129 Ga0070664_100010116 3300005564 Bacteria 7645
130 Ga0070664_100011689 3300005564 Bacteria 7125
131 Ga0070664_100022439 3300005564 Bacteria 5204
132 Ga0070664_100032733 3300005564 Bacteria 4349
133 Ga0070664_100065137 3300005564 Bacteria 3109
134 Ga0070664_100433187 3300005564 Bacteria 1205
135 Ga0068857_100002945 3300005577 Bacteria 14026
136 Ga0068857_100018000 3300005577 Bacteria 6197
137 Ga0068857_100044515 3300005577 Bacteria 3937
138 Ga0068857_100048254 3300005577 Bacteria 3781
139 Ga0068854_100041113 3300005578 Bacteria 3265
140 Ga0068854_100047870 3300005578 Bacteria 3048
141 Ga0068854_100052586 3300005578 Bacteria 2921
142 Ga0068854_100577930 3300005578 Bacteria 956
143 Ga0068856_100028185 3300005614 Bacteria 5482
144 Ga0068856_100039322 3300005614 Bacteria 4644
145 Ga0068856_100051429 3300005614 Bacteria 4062
146 Ga0068856_100088662 3300005614 Bacteria 3076
147 Ga0068856_100345389 3300005614 Bacteria 1507
148 Ga0068856_100483385 3300005614 Bacteria 1259
149 Ga0068856_100641792 3300005614 Bacteria 1082
150 Ga0068852_100004848 3300005616 Bacteria 9555
151 Ga0068852_100004886 3300005616 Bacteria 9519
152 Ga0068852_100021600 3300005616 Bacteria 5144
153 Ga0068852_100028783 3300005616 Bacteria 4552
154 Ga0068852_100083937 3300005616 Bacteria 2834
155 Ga0068852_100334674 3300005616 Bacteria 1474
156 Ga0068859_100017599 3300005617 Bacteria 7185
157 Ga0068859_100125068 3300005617 Bacteria 2640
158 Ga0068864_100001642 3300005618 Bacteria 18433
159 Ga0068864_100008878 3300005618 Bacteria 8288
160 Ga0068864_100028599 3300005618 Bacteria 4714
161 Ga0068866_10010216 3300005718 Bacteria 4016
162 Ga0068861_100494668 3300005719 Bacteria 1104
163 Ga0068851_10006186 3300005834 Bacteria 5464
164 Ga0068851_10216339 3300005834 Bacteria 1075
165 Ga0068863_100011068 3300005841 Bacteria 8749
166 Ga0068863_100033535 3300005841 Bacteria 4891
167 Ga0068863_100034907 3300005841 Bacteria 4791
168 Ga0068863_100124549 3300005841 Bacteria 2458
169 Ga0068858_100002545 3300005842 Bacteria 18388
170 Ga0068858_100014125 3300005842 Bacteria 7531
171 Ga0068858_100019058 3300005842 Bacteria 6419
172 Ga0068860_100034230 3300005843 Bacteria 4871
173 Ga0068860_100186149 3300005843 Bacteria 2008
174 Ga0070716_100060970 3300006173 Bacteria 2181
175 Ga0097621_100013293 3300006237 Bacteria 6132
176 Ga0097621_100015640 3300006237 Bacteria 5716
177 Ga0097621_100034267 3300006237 Bacteria 4049
178 Ga0068871_100007445 3300006358 Bacteria 7824
179 Ga0068871_100021153 3300006358 Bacteria 4995
180 Ga0068865_100006686 3300006881 Bacteria 7052
181 Ga0068865_100213440 3300006881 Bacteria 1505
182 Ga0097620_100017600 3300006931 Bacteria 7185
183 Ga0097620_100125064 3300006931 Bacteria 2640
184 Ga0105240_10050806 3300009093 Bacteria 5224
185 Ga0105240_10070774 3300009093 Bacteria 4314
186 Ga0105245_10010546 3300009098 Bacteria 8041
187 Ga0105245_10072184 3300009098 Bacteria 3135
188 Ga0105247_10115034 3300009101 Bacteria 1736
189 Ga0105243_10023919 3300009148 Bacteria 4655
190 Ga0105243_10220458 3300009148 Bacteria 1676
191 Ga0105241_10047638 3300009174 Bacteria 3260
192 Ga0105241_10160760 3300009174 Bacteria 1846
193 Ga0105242_10009591 3300009176 Bacteria 7420
194 Ga0105248_10005810 3300009177 Bacteria 13563
195 Ga0105248_10038332 3300009177 Bacteria 5363
196 Ga0105248_10180733 3300009177 Bacteria 2377
197 Ga0105237_10067334 3300009545 Bacteria 3575
198 Ga0105237_10121532 3300009545 Bacteria 2606
199 Ga0105238_10016671 3300009551 Bacteria 7443
200 Ga0105238_10163686 3300009551 Bacteria 2200
201 Ga0105238_10337677 3300009551 Bacteria 1494
202 Ga0105246_10144498 3300011119 Bacteria 1793
203 Ga0157373_10038000 3300013100 Bacteria 3450
204 Ga0157373_10044714 3300013100 Bacteria 3161
205 Ga0157373_10063921 3300013100 Bacteria 2605
206 Ga0157373_10213833 3300013100 Bacteria 1359
207 Ga0157373_10240053 3300013100 Unclassified 1281
208 Ga0157371_10021293 3300013102 Bacteria 4761
209 Ga0157371_10024685 3300013102 Bacteria 4386
210 Ga0157371_10138066 3300013102 Bacteria 1736
211 Ga0157371_10260802 3300013102 Bacteria 1249
212 Ga0157371_10384710 3300013102 Bacteria 1025
213 Ga0157371_10419056 3300013102 Bacteria 981
214 Ga0157370_10001875 3300013104 Bacteria 25926
215 Ga0157370_10023030 3300013104 Bacteria 6191
216 Ga0157370_10023359 3300013104 Bacteria 6140
217 Ga0157370_10042639 3300013104 Bacteria 4371
218 Ga0157370_10168638 3300013104 Bacteria 2035
219 Ga0157369_10034175 3300013105 Bacteria 5582
220 Ga0157369_10075809 3300013105 Bacteria 3605
221 Ga0157369_10246658 3300013105 Bacteria 1865
222 Ga0157374_10022956 3300013296 Bacteria 5572
223 Ga0157378_10012580 3300013297 Bacteria 7408
224 Ga0157378_10033888 3300013297 Bacteria 4517
225 Ga0157378_10157507 3300013297 Bacteria 2121
226 Ga0157378_10294945 3300013297 Bacteria 1567
227 Ga0163162_10020561 3300013306 Bacteria 6485
228 Ga0157372_10211590 3300013307 Bacteria 2247
229 Ga0157372_10284097 3300013307 Bacteria 1924
230 Ga0157372_10513842 3300013307 Unclassified 1396
231 Ga0157372_10727941 3300013307 Bacteria 1154
232 Ga0157375_10009954 3300013308 Bacteria 8358
233 Ga0163163_10055306 3300014325 Bacteria 3923
234 Ga0163163_10091322 3300014325 Bacteria 3059
235 Ga0157377_10349064 3300014745 Bacteria 992
236 Ga0157379_10002869 3300014968 Bacteria 14535
237 Ga0157379_10010521 3300014968 Bacteria 8064
238 Ga0157376_10030968 3300014969 Bacteria 4278
239 Ga0163161_10209610 3300017792 Bacteria 1505
240 Ga0197907_10814763 3300020069 Bacteria 2910
241 Ga0206356_11877315 3300020070 Unclassified 886
242 Ga0206354_10518832 3300020081 Unclassified 1056
243 Ga0206353_10080605 3300020082 Bacteria 2336
244 Ga0207656_10030437 3300025321 Bacteria 2230
245 Ga0207656_10144049 3300025321 Bacteria 1125
246 Ga0207656_10191381 3300025321 Bacteria 985
247 Ga0207642_10033971 3300025899 Bacteria 2164
248 Ga0207642_10045108 3300025899 Bacteria 1955
249 Ga0207710_10307425 3300025900 Unclassified 802
250 Ga0207688_10078702 3300025901 Bacteria 1879
251 Ga0207680_10001306 3300025903 Bacteria 11767
252 Ga0207680_10006317 3300025903 Bacteria 5720
253 Ga0207680_10010102 3300025903 Bacteria 4711
254 Ga0207647_10002598 3300025904 Bacteria 13647
255 Ga0207647_10015034 3300025904 Bacteria 5320
256 Ga0207647_10064097 3300025904 Bacteria 2233
257 Ga0207645_10026652 3300025907 Bacteria 3734
258 Ga0207645_10084796 3300025907 Bacteria 2033
259 Ga0207645_10388874 3300025907 Unclassified 937
260 Ga0207705_10001651 3300025909 Bacteria 17706
261 Ga0207705_10027003 3300025909 Bacteria 4092
262 Ga0207705_10028881 3300025909 Bacteria 3953
263 Ga0207705_10038012 3300025909 Bacteria 3445
264 Ga0207705_10056625 3300025909 Bacteria 2827
265 Ga0207705_10104353 3300025909 Bacteria 2088
266 Ga0207705_10182875 3300025909 Bacteria 1582
267 Ga0207705_10194416 3300025909 Bacteria 1535
268 Ga0207707_10117980 3300025912 Bacteria 2320
269 Ga0207695_10018678 3300025913 Bacteria 8007
270 Ga0207695_10748382 3300025913 Bacteria 858
271 Ga0207671_10096217 3300025914 Bacteria 2237
272 Ga0207660_10000716 3300025917 Bacteria 22075
273 Ga0207660_10001309 3300025917 Bacteria 16627
274 Ga0207660_10010110 3300025917 Bacteria 6111
275 Ga0207660_10066923 3300025917 Bacteria 2600
276 Ga0207660_10182978 3300025917 Bacteria 1628
277 Ga0207660_10203997 3300025917 Bacteria 1545
278 Ga0207657_10001862 3300025919 Bacteria 22804
279 Ga0207657_10005820 3300025919 Bacteria 12840
280 Ga0207657_10005882 3300025919 Bacteria 12778
281 Ga0207657_10011525 3300025919 Bacteria 8777
282 Ga0207657_10074217 3300025919 Bacteria 2873
283 Ga0207657_10107322 3300025919 Bacteria 2310
284 Ga0207657_10236927 3300025919 Bacteria 1458
285 Ga0207649_10002104 3300025920 Bacteria 11287
286 Ga0207649_10016221 3300025920 Bacteria 4196
287 Ga0207649_10027651 3300025920 Bacteria 3331
288 Ga0207649_10060930 3300025920 Bacteria 2373
289 Ga0207649_10110274 3300025920 Bacteria 1837
290 Ga0207652_10012439 3300025921 Bacteria 6878
291 Ga0207652_10317384 3300025921 Bacteria 1407
292 Ga0207652_10385286 3300025921 Unclassified 1265
293 Ga0207652_10439975 3300025921 Bacteria 1175
294 Ga0207694_10128992 3300025924 Bacteria 2026
295 Ga0207694_10196502 3300025924 Bacteria 1640
296 Ga0207650_10006964 3300025925 Bacteria 7708
297 Ga0207650_10094558 3300025925 Bacteria 2290
298 Ga0207659_10097392 3300025926 Bacteria 2210
299 Ga0207687_10070185 3300025927 Bacteria 2500
300 Ga0207700_10029593 3300025928 Bacteria 3866
301 Ga0207664_10095828 3300025929 Bacteria 2442
302 Ga0207664_10420214 3300025929 Unclassified 1191
303 Ga0207644_10001036 3300025931 Bacteria 17813
304 Ga0207644_10001055 3300025931 Bacteria 17632
305 Ga0207644_10020468 3300025931 Bacteria 4498
306 Ga0207690_10010318 3300025932 Bacteria 5545
307 Ga0207690_10033602 3300025932 Bacteria 3299
308 Ga0207690_10038177 3300025932 Bacteria 3124
309 Ga0207690_10038851 3300025932 Bacteria 3101
310 Ga0207690_10051428 3300025932 Bacteria 2755
311 Ga0207690_10062840 3300025932 Bacteria 2530
312 Ga0207690_10079576 3300025932 Bacteria 2284
313 Ga0207690_10174153 3300025932 Bacteria 1614
314 Ga0207690_10322539 3300025932 Bacteria 1214
315 Ga0207690_10519498 3300025932 Unclassified 965
316 Ga0207706_10002923 3300025933 Bacteria 16502
317 Ga0207706_10002977 3300025933 Bacteria 16347
318 Ga0207706_10054433 3300025933 Bacteria 3531
319 Ga0207706_10058767 3300025933 Bacteria 3387
320 Ga0207706_10225872 3300025933 Bacteria 1639
321 Ga0207706_10247901 3300025933 Bacteria 1556
322 Ga0207686_10004481 3300025934 Bacteria 7482
323 Ga0207670_10302586 3300025936 Bacteria 1252
324 Ga0207669_10005160 3300025937 Bacteria 5826
325 Ga0207704_10199193 3300025938 Bacteria 1464
326 Ga0207691_10001996 3300025940 Bacteria 19962
327 Ga0207691_10002787 3300025940 Bacteria 17036
328 Ga0207691_10153289 3300025940 Bacteria 2025
329 Ga0207711_10003024 3300025941 Bacteria 14701
330 Ga0207711_10009940 3300025941 Bacteria 7910
331 Ga0207711_10197864 3300025941 Bacteria 1833
332 Ga0207711_10539098 3300025941 Bacteria 1088
333 Ga0207711_10685372 3300025941 Bacteria 956
334 Ga0207661_10010079 3300025944 Bacteria 6792
335 Ga0207661_10021095 3300025944 Bacteria 4880
336 Ga0207661_10025169 3300025944 Bacteria 4522
337 Ga0207661_10238694 3300025944 Bacteria 1612
338 Ga0207679_10015997 3300025945 Bacteria 4972
339 Ga0207679_10021255 3300025945 Bacteria 4396
340 Ga0207679_10079600 3300025945 Bacteria 2499
341 Ga0207679_10127150 3300025945 Bacteria 2038
342 Ga0207679_10155444 3300025945 Bacteria 1867
343 Ga0207679_10360657 3300025945 Bacteria 1269
344 Ga0207667_10004287 3300025949 Bacteria 17471
345 Ga0207667_10089017 3300025949 Bacteria 3191
346 Ga0207667_10280616 3300025949 Bacteria 1702
347 Ga0207667_10737718 3300025949 Bacteria 985
348 Ga0207651_10001542 3300025960 Bacteria 10516
349 Ga0207651_10002725 3300025960 Bacteria 8474
350 Ga0207651_10283755 3300025960 Bacteria 1370
351 Ga0207640_10003404 3300025981 Bacteria 8569
352 Ga0207640_10031678 3300025981 Bacteria 3270
353 Ga0207640_10039030 3300025981 Bacteria 3002
354 Ga0207640_10047165 3300025981 Bacteria 2777
355 Ga0207658_10005276 3300025986 Bacteria 8889
356 Ga0207658_10012694 3300025986 Bacteria 5753
357 Ga0207658_10053374 3300025986 Bacteria 2986
358 Ga0207658_10498519 3300025986 Bacteria 1084
359 Ga0207677_10003171 3300026023 Bacteria 8683
360 Ga0207677_10003995 3300026023 Bacteria 7868
361 Ga0207677_10229420 3300026023 Bacteria 1494
362 Ga0207703_10019201 3300026035 Bacteria 5339
363 Ga0207703_10024121 3300026035 Bacteria 4785
364 Ga0207703_10036865 3300026035 Bacteria 3894
365 Ga0207639_10002075 3300026041 Bacteria 13498
366 Ga0207639_10153369 3300026041 Bacteria 1932
367 Ga0207639_10206811 3300026041 Bacteria 1687
368 Ga0207639_10511427 3300026041 Bacteria 1099
369 Ga0207678_10014800 3300026067 Bacteria 6864
370 Ga0207678_10083177 3300026067 Bacteria 2738
371 Ga0207678_10182624 3300026067 Bacteria 1791
372 Ga0207678_10235676 3300026067 Bacteria 1567
373 Ga0207678_10300474 3300026067 Bacteria 1379
374 Ga0207702_10005569 3300026078 Bacteria 11000
375 Ga0207702_10017951 3300026078 Bacteria 5854
376 Ga0207702_10038783 3300026078 Bacteria 3990
377 Ga0207702_10041446 3300026078 Bacteria 3861
378 Ga0207702_10069946 3300026078 Bacteria 3018
379 Ga0207702_10213409 3300026078 Bacteria 1795
380 Ga0207702_10526096 3300026078 Bacteria 1155
381 Ga0207702_10869715 3300026078 Bacteria 893
382 Ga0207641_10011882 3300026088 Bacteria 7142
383 Ga0207641_10042941 3300026088 Bacteria 3794
384 Ga0207641_11035411 3300026088 Bacteria 818
385 Ga0207648_10010598 3300026089 Bacteria 8718
386 Ga0207676_10006163 3300026095 Bacteria 8467
387 Ga0207676_10436464 3300026095 Unclassified 1231
388 Ga0207676_10495616 3300026095 Bacteria 1159
389 Ga0207674_10000271 3300026116 Bacteria 65366
390 Ga0207674_10000780 3300026116 Bacteria 41514
391 Ga0207674_10003100 3300026116 Bacteria 20520
392 Ga0207674_10004321 3300026116 Bacteria 17130
393 Ga0207674_10023046 3300026116 Bacteria 6677
394 Ga0207675_100408503 3300026118 Bacteria 1339
395 Ga0207683_10001537 3300026121 Bacteria 20804
396 Ga0207683_10006388 3300026121 Bacteria 10095
397 Ga0207683_10326801 3300026121 Bacteria 1405
398 Ga0207698_10001436 3300026142 Bacteria 13841
399 Ga0207698_10002802 3300026142 Bacteria 10414
400 Ga0207698_10006239 3300026142 Bacteria 7424
401 Ga0207698_10016104 3300026142 Bacteria 5030
402 Ga0207698_10057796 3300026142 Bacteria 3003
403 Ga0207698_10532649 3300026142 Bacteria 1148
404 Ga0268266_10000458 3300028379 Bacteria 59553
405 Ga0268266_10010398 3300028379 Bacteria 8134
406 Ga0268266_10044171 3300028379 Bacteria 3809
407 Ga0268264_10132428 3300028381 Bacteria 2212
408 Ga0307405_10140896 3300031731 Bacteria 1681
409 Ga0307416_100570360 3300032002 Bacteria 1208
410 Ga0373955_0062725 3300035172 Bacteria 2056
411 Ga0373935_0025493 3300035692 Bacteria 3644
412 Ga0373933_0212425 3300035724 Unclassified 1240
413 Ga0395899_0008499 3300037312 Bacteria 7909
414 Ga0395899_0014094 3300037312 Bacteria 6103
415 Ga0395899_0060488 3300037312 Bacteria 2791
416 Ga0395899_0219057 3300037312 Unclassified 1319
417 Ga0395900_0013711 3300037418 Bacteria 8274
418 Ga0395900_0013806 3300037418 Bacteria 8244
419 Ga0395900_0062328 3300037418 Bacteria 3833
420 Ga0395900_0081116 3300037418 Bacteria 3333
421 Ga0395900_0103635 3300037418 Bacteria 2922
422 Ga0395900_0126912 3300037418 Bacteria 2616
423 Ga0395900_0170507 3300037418 Bacteria 2216
424 Ga0395900_0171352 3300037418 Bacteria 2209
425 Ga0395900_0236107 3300037418 Bacteria 1836
426 Ga0395900_0245191 3300037418 Bacteria 1795
427 Ga0395900_0279343 3300037418 Bacteria 1662
428 Ga0395900_0315736 3300037418 Bacteria 1544
429 Ga0395900_0732598 3300037418 Unclassified 920
430 Ga0395900_0817642 3300037418 Bacteria 859
431 Ga0395898_0087043 3300037466 Bacteria 3010
432 Ga0395898_0089055 3300037466 Bacteria 2970
433 Ga0395898_0097940 3300037466 Bacteria 2816
434 Ga0395898_0098845 3300037466 Bacteria 2802
435 Ga0395898_0100821 3300037466 Bacteria 2773
436 Ga0395898_0104116 3300037466 Bacteria 2722
437 Ga0395898_0127566 3300037466 Bacteria 2437
438 Ga0395898_0215257 3300037466 Bacteria 1832
439 Ga0395905_0001997 3300037471 Bacteria 23312
440 Ga0395905_0006735 3300037471 Bacteria 11506
441 Ga0395905_0008262 3300037471 Bacteria 10278
442 Ga0395905_0010132 3300037471 Bacteria 9188
443 Ga0395905_0023006 3300037471 Bacteria 5890
444 Ga0395905_0040830 3300037471 Bacteria 4353
445 Ga0395905_0083847 3300037471 Bacteria 2986
446 Ga0395905_0091575 3300037471 Bacteria 2851
447 Ga0395905_0144388 3300037471 Bacteria 2239
448 Ga0395905_0175109 3300037471 Bacteria 2014
449 Ga0395905_0422312 3300037471 Bacteria 1229
450 Ga0395905_0461524 3300037471 Bacteria 1168
451 Ga0395905_0607572 3300037471 Bacteria 995
452 Ga0395901_0002513 3300038443 Bacteria 18561
453 Ga0395901_0006861 3300038443 Bacteria 11503
454 Ga0395901_0007314 3300038443 Bacteria 11145
455 Ga0395901_0008904 3300038443 Bacteria 10165
456 Ga0395901_0036368 3300038443 Bacteria 5089
457 Ga0395901_0100253 3300038443 Bacteria 3037
458 Ga0395901_0132884 3300038443 Bacteria 2615
459 Ga0395901_0153405 3300038443 Bacteria 2419
460 Ga0395901_0159760 3300038443 Bacteria 2367
461 Ga0395901_0245769 3300038443 Bacteria 1865
462 Ga0395901_0258554 3300038443 Bacteria 1812
463 Ga0395901_0289461 3300038443 Bacteria 1700
464 Ga0395901_0302019 3300038443 Bacteria 1659
465 Ga0395901_0306141 3300038443 Bacteria 1647
466 Ga0395901_0488155 3300038443 Bacteria 1255
467 Ga0439448_0004171 3300042005 Bacteria 4068
468 Ga0439455_0027992 3300042012 Bacteria 1384
469 Ga0439458_0022391 3300042157 Bacteria 1468
470 Ga0466972_0059516 3300044658 Bacteria 1833
471 Ga0466965_0246232 3300044683 Unclassified 958
472 Ga0466966_0042918 3300044684 Bacteria 2900
473 Ga0466963_0023695 3300044694 Bacteria 3901
474 Ga0466963_0032333 3300044694 Bacteria 3387
475 Ga0466963_0066689 3300044694 Bacteria 2415
476 Ga0466964_0090420 3300044706 Bacteria 1331
477 Ga0466968_0004672 3300044735 Bacteria 5128
478 Ga0466970_0007504 3300044765 Bacteria 5469
479 Ga0466970_0079639 3300044765 Unclassified 1769
480 Ga0466957_0140179 3300044842 Bacteria 1557
481 Ga0466959_0006389 3300045049 Bacteria 8159
482 Ga0466959_0056203 3300045049 Bacteria 2872
483 Ga0466959_0099974 3300045049 Bacteria 2077
484 Ga0466959_0311946 3300045049 Bacteria 1076
485 Ga0466959_0331623 3300045049 Unclassified 1039
486 Ga0466958_0011056 3300045836 Bacteria 5074
487 Ga0466958_0119283 3300045836 Bacteria 1651
488 Ga0466967_0003513 3300045976 Bacteria 10246
489 Ga0466967_0034884 3300045976 Bacteria 4275
490 Ga0466967_0092201 3300045976 Bacteria 2754
491 Ga0466967_0239483 3300045976 Bacteria 1730
492 Ga0466967_0292447 3300045976 Bacteria 1565
493 Ga0495643_0186689 3300046522 Unclassified 1004
494 Ga0495647_0013059 3300046681 Bacteria 2871
495 Ga0496100_0061673 3300048903 Bacteria 2471
496 Ga0496100_0093938 3300048903 Bacteria 2053
497 Ga0496101_0011745 3300048904 Bacteria 5822
498 Ga0496101_0024318 3300048904 Bacteria 4192
499 Ga0496101_0054058 3300048904 Bacteria 2899
500 Ga0496102_0022268 3300048905 Bacteria 5614
501 Ga0496102_0221350 3300048905 Bacteria 1784
502 Ga0496103_0474623 3300048906 Unclassified 801
503 Ga0496104_0211029 3300048907 Bacteria 1853
504 Ga0496105_0016317 3300048908 Bacteria 5928
505 Ga0496105_0018231 3300048908 Bacteria 5636
506 Ga0496106_0003210 3300048909 Bacteria 12244
507 Ga0496107_0001852 3300048910 Bacteria 13357
508 Ga0496107_0070176 3300048910 Bacteria 2543
509 Ga0496108_0000578 3300048911 Bacteria 28619
510 Ga0496108_0003009 3300048911 Bacteria 13547
511 Ga0496108_0018738 3300048911 Bacteria 5673
512 Ga0496109_0004627 3300048912 Bacteria 11488
513 Ga0496109_0013232 3300048912 Bacteria 7144
514 Ga0496109_0032517 3300048912 Bacteria 4689
515 Ga0496110_0004837 3300048913 Bacteria 10498
516 Ga0496110_0009281 3300048913 Bacteria 7955
517 Ga0496111_0000970 3300048914 Bacteria 15674
518 Ga0496111_0088831 3300048914 Bacteria 2263
519 Ga0496111_0362539 3300048914 Unclassified 1072
520 Ga0496112_0013295 3300048915 Bacteria 7599
521 Ga0496112_0020194 3300048915 Bacteria 6308
522 Ga0496112_0023255 3300048915 Bacteria 5917
523 Ga0496113_0000659 3300048916 Bacteria 17462
524 Ga0496113_0012992 3300048916 Bacteria 5618
525 Ga0496114_0040584 3300048917 Bacteria 3854
526 Ga0496115_0010245 3300048918 Bacteria 6995
527 Ga0501070_0097861 3300049586 Bacteria 2427
528 Ga0501080_0554370 3300049742 Unclassified 1023
529 Ga0495612_0179505 3300053078 Unclassified 929
530 Ga0466962_0028790 3300061719 Bacteria 2661
531 Ga0466962_0227549 3300061719 Unclassified 914
532 Ga0466962_0295513 3300061719 Bacteria 801
533 Ga0466962_0335164 3300061719 Unclassified 752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300020070 Ga0206356_11877315 Ga0206356_118773152 166
2 3300013102 Ga0157371_10419056 Ga0157371_104190562 191
3 3300013104 Ga0157370_10168638 Ga0157370_101686383 191
4 3300005616 Ga0068852_100004848 Ga0068852_1000048484 192
5 3300013104 Ga0157370_10001875 Ga0157370_1000187521 192
6 3300026142 Ga0207698_10002802 Ga0207698_1000280211 192
7 3300049586 Ga0501070_0097861 Ga0501070_0097861_1052_1672 193
8 3300049742 Ga0501080_0554370 Ga0501080_0554370_247_867 193
9 3300025944 Ga0207661_10238694 Ga0207661_102386942 198
10 3300037466 Ga0395898_0104116 Ga0395898_0104116_1715_2311 198
11 3300037471 Ga0395905_0175109 Ga0395905_0175109_826_1422 198
12 3300017792 Ga0163161_10209610 Ga0163161_102096101 199
13 3300048906 Ga0496103_0474623 Ga0496103_0474623_23_628 199
14 3300025960 Ga0207651_10283755 Ga0207651_102837552 201
15 3300005564 Ga0070664_100433187 Ga0070664_1004331872 203
16 3300005577 Ga0068857_100044515 Ga0068857_1000445155 203
17 3300005614 Ga0068856_100483385 Ga0068856_1004833852 203
18 3300005841 Ga0068863_100034907 Ga0068863_1000349075 203
19 3300005843 Ga0068860_100034230 Ga0068860_1000342306 203
20 3300006237 Ga0097621_100034267 Ga0097621_1000342676 203
21 3300009101 Ga0105247_10115034 Ga0105247_101150342 203
22 3300009177 Ga0105248_10180733 Ga0105248_101807333 203
23 3300009545 Ga0105237_10121532 Ga0105237_101215321 203
24 3300013102 Ga0157371_10138066 Ga0157371_101380662 203
25 3300014325 Ga0163163_10091322 Ga0163163_100913222 203
26 3300014968 Ga0157379_10002869 Ga0157379_1000286911 203
27 3300025932 Ga0207690_10079576 Ga0207690_100795764 203
28 3300025933 Ga0207706_10058767 Ga0207706_100587673 203
29 3300025941 Ga0207711_10539098 Ga0207711_105390982 203
30 3300025945 Ga0207679_10015997 Ga0207679_100159976 203
31 3300026067 Ga0207678_10182624 Ga0207678_101826242 203
32 3300026078 Ga0207702_10038783 Ga0207702_100387833 203
33 3300026088 Ga0207641_10011882 Ga0207641_100118824 203
34 3300026116 Ga0207674_10000780 Ga0207674_1000078031 203
35 3300028381 Ga0268264_10132428 Ga0268264_101324281 203
36 3300037471 Ga0395905_0010132 Ga0395905_0010132_7280_7891 203
37 3300044765 Ga0466970_0079639 Ga0466970_0079639_996_1622 203
38 3300045049 Ga0466959_0331623 Ga0466959_0331623_150_776 203
39 3300048908 Ga0496105_0016317 Ga0496105_0016317_5034_5645 203
40 3300048911 Ga0496108_0003009 Ga0496108_0003009_6446_7057 203
41 3300013297 Ga0157378_10157507 Ga0157378_101575072 204
42 3300037418 Ga0395900_0732598 Ga0395900_0732598_32_646 204
43 3300038443 Ga0395901_0100253 Ga0395901_0100253_644_1258 204
44 3300044658 Ga0466972_0059516 Ga0466972_0059516_78_692 204
45 3300045049 Ga0466959_0311946 Ga0466959_0311946_247_861 204
46 3300005293 Ga0065715_10203744 Ga0065715_102037442 205
47 3300005336 Ga0070680_100001960 Ga0070680_1000019609 205
48 3300005354 Ga0070675_100065993 Ga0070675_1000659933 205
49 3300005543 Ga0070672_100154751 Ga0070672_1001547512 205
50 3300013100 Ga0157373_10240053 Ga0157373_102400532 205
51 3300013307 Ga0157372_10513842 Ga0157372_105138422 205
52 3300025917 Ga0207660_10001309 Ga0207660_1000130913 205
53 3300025940 Ga0207691_10153289 Ga0207691_101532893 205
54 3300026078 Ga0207702_10869715 Ga0207702_108697152 205
55 3300037466 Ga0395898_0089055 Ga0395898_0089055_1969_2610 205
56 3300048912 Ga0496109_0032517 Ga0496109_0032517_1779_2396 205
57 3300005336 Ga0070680_100011384 Ga0070680_1000113843 206
58 3300005530 Ga0070679_100635212 Ga0070679_1006352122 206
59 3300005539 Ga0068853_100318290 Ga0068853_1003182902 206
60 3300005539 Ga0068853_100530134 Ga0068853_1005301342 206
61 3300005563 Ga0068855_100274337 Ga0068855_1002743372 206
62 3300005614 Ga0068856_100028185 Ga0068856_1000281858 206
63 3300009093 Ga0105240_10050806 Ga0105240_100508066 206
64 3300009551 Ga0105238_10163686 Ga0105238_101636863 206
65 3300013104 Ga0157370_10023030 Ga0157370_100230302 206
66 3300013105 Ga0157369_10075809 Ga0157369_100758094 206
67 3300013307 Ga0157372_10727941 Ga0157372_107279412 206
68 3300020069 Ga0197907_10814763 Ga0197907_108147633 206
69 3300020081 Ga0206354_10518832 Ga0206354_105188322 206
70 3300020082 Ga0206353_10080605 Ga0206353_100806052 206
71 3300025913 Ga0207695_10018678 Ga0207695_100186784 206
72 3300025917 Ga0207660_10010110 Ga0207660_100101106 206
73 3300025921 Ga0207652_10385286 Ga0207652_103852862 206
74 3300025924 Ga0207694_10128992 Ga0207694_101289922 206
75 3300025932 Ga0207690_10519498 Ga0207690_105194981 206
76 3300025949 Ga0207667_10004287 Ga0207667_1000428712 206
77 3300026078 Ga0207702_10526096 Ga0207702_105260962 206
78 3300035172 Ga0373955_0062725 Ga0373955_0062725_1389_2009 206
79 3300035724 Ga0373933_0212425 Ga0373933_0212425_581_1201 206
80 3300053078 Ga0495612_0179505 Ga0495612_0179505_69_689 206
81 3300035692 Ga0373935_0025493 Ga0373935_0025493_168_794 207
82 3300037418 Ga0395900_0013806 Ga0395900_0013806_3009_3635 207
83 3300037418 Ga0395900_0236107 Ga0395900_0236107_319_942 207
84 3300037471 Ga0395905_0023006 Ga0395905_0023006_2676_3299 207
85 3300038443 Ga0395901_0159760 Ga0395901_0159760_948_1574 207
86 3300005530 Ga0070679_100482545 Ga0070679_1004825452 208
87 3300044683 Ga0466965_0246232 Ga0466965_0246232_311_937 208
88 3300044706 Ga0466964_0090420 Ga0466964_0090420_259_885 208
89 3300044735 Ga0466968_0004672 Ga0466968_0004672_683_1309 208
90 3300044765 Ga0466970_0007504 Ga0466970_0007504_4075_4701 208
91 3300045049 Ga0466959_0056203 Ga0466959_0056203_365_991 208
92 3300045836 Ga0466958_0011056 Ga0466958_0011056_660_1286 208
93 3300045976 Ga0466967_0292447 Ga0466967_0292447_439_1065 208
94 3300061719 Ga0466962_0028790 Ga0466962_0028790_1103_1759 208
95 3300061719 Ga0466962_0295513 Ga0466962_0295513_67_693 208
96 3300002067 JGI24735J21928_10031788 JGI24735J21928_100317883 211
97 3300005327 Ga0070658_10158952 Ga0070658_101589523 211
98 3300005329 Ga0070683_100020037 Ga0070683_1000200376 211
99 3300005329 Ga0070683_100152703 Ga0070683_1001527031 211
100 3300005336 Ga0070680_100017846 Ga0070680_1000178466 211
101 3300005336 Ga0070680_100059024 Ga0070680_1000590244 211
102 3300005337 Ga0070682_100002765 Ga0070682_1000027654 211
103 3300005337 Ga0070682_100086275 Ga0070682_1000862752 211
104 3300005339 Ga0070660_100037983 Ga0070660_1000379833 211
105 3300005341 Ga0070691_10012038 Ga0070691_100120383 211
106 3300005344 Ga0070661_100024072 Ga0070661_1000240727 211
107 3300005366 Ga0070659_100079490 Ga0070659_1000794902 211
108 3300005366 Ga0070659_100263080 Ga0070659_1002630802 211
109 3300005435 Ga0070714_100760452 Ga0070714_1007604522 211
110 3300005455 Ga0070663_100016007 Ga0070663_1000160077 211
111 3300005455 Ga0070663_100176802 Ga0070663_1001768022 211
112 3300005457 Ga0070662_100153168 Ga0070662_1001531682 211
113 3300005530 Ga0070679_100319850 Ga0070679_1003198502 211
114 3300005535 Ga0070684_100023225 Ga0070684_1000232255 211
115 3300005539 Ga0068853_100055802 Ga0068853_1000558023 211
116 3300005563 Ga0068855_100182411 Ga0068855_1001824112 211
117 3300005564 Ga0070664_100010116 Ga0070664_10001011611 211
118 3300005564 Ga0070664_100022439 Ga0070664_1000224394 211
119 3300005577 Ga0068857_100048254 Ga0068857_1000482544 211
120 3300005578 Ga0068854_100041113 Ga0068854_1000411132 211
121 3300005578 Ga0068854_100052586 Ga0068854_1000525862 211
122 3300005614 Ga0068856_100088662 Ga0068856_1000886624 211
123 3300005614 Ga0068856_100641792 Ga0068856_1006417922 211
124 3300009174 Ga0105241_10047638 Ga0105241_100476382 211
125 3300009174 Ga0105241_10160760 Ga0105241_101607603 211
126 3300009545 Ga0105237_10067334 Ga0105237_100673343 211
127 3300009551 Ga0105238_10337677 Ga0105238_103376772 211
128 3300013100 Ga0157373_10044714 Ga0157373_100447143 211
129 3300013102 Ga0157371_10021293 Ga0157371_100212933 211
130 3300013102 Ga0157371_10384710 Ga0157371_103847102 211
131 3300013104 Ga0157370_10042639 Ga0157370_100426396 211
132 3300013307 Ga0157372_10211590 Ga0157372_102115903 211
133 3300013307 Ga0157372_10284097 Ga0157372_102840972 211
134 3300025904 Ga0207647_10015034 Ga0207647_100150344 211
135 3300025909 Ga0207705_10104353 Ga0207705_101043532 211
136 3300025909 Ga0207705_10194416 Ga0207705_101944162 211
137 3300025913 Ga0207695_10748382 Ga0207695_107483822 211
138 3300025914 Ga0207671_10096217 Ga0207671_100962172 211
139 3300025917 Ga0207660_10182978 Ga0207660_101829782 211
140 3300025917 Ga0207660_10203997 Ga0207660_102039972 211
141 3300025919 Ga0207657_10005820 Ga0207657_100058207 211
142 3300025919 Ga0207657_10005882 Ga0207657_1000588211 211
143 3300025920 Ga0207649_10002104 Ga0207649_100021044 211
144 3300025920 Ga0207649_10060930 Ga0207649_100609302 211
145 3300025921 Ga0207652_10317384 Ga0207652_103173842 211
146 3300025924 Ga0207694_10196502 Ga0207694_101965023 211
147 3300025932 Ga0207690_10033602 Ga0207690_100336024 211
148 3300025932 Ga0207690_10051428 Ga0207690_100514283 211
149 3300025933 Ga0207706_10225872 Ga0207706_102258722 211
150 3300025944 Ga0207661_10010079 Ga0207661_100100794 211
151 3300025944 Ga0207661_10025169 Ga0207661_100251694 211
152 3300025945 Ga0207679_10079600 Ga0207679_100796003 211
153 3300025945 Ga0207679_10360657 Ga0207679_103606572 211
154 3300025949 Ga0207667_10089017 Ga0207667_100890174 211
155 3300025949 Ga0207667_10280616 Ga0207667_102806162 211
156 3300025981 Ga0207640_10003404 Ga0207640_100034042 211
157 3300025981 Ga0207640_10047165 Ga0207640_100471654 211
158 3300026041 Ga0207639_10002075 Ga0207639_100020759 211
159 3300026041 Ga0207639_10206811 Ga0207639_102068113 211
160 3300026067 Ga0207678_10014800 Ga0207678_100148003 211
161 3300026067 Ga0207678_10083177 Ga0207678_100831774 211
162 3300026078 Ga0207702_10005569 Ga0207702_1000556913 211
163 3300026078 Ga0207702_10041446 Ga0207702_100414464 211
164 3300026116 Ga0207674_10003100 Ga0207674_100031006 211
165 3300026116 Ga0207674_10004321 Ga0207674_1000432110 211
166 3300026142 Ga0207698_10001436 Ga0207698_1000143613 211
167 3300026142 Ga0207698_10006239 Ga0207698_100062398 211
168 3300037418 Ga0395900_0081116 Ga0395900_0081116_2402_3040 211
169 3300037418 Ga0395900_0245191 Ga0395900_0245191_826_1464 211
170 3300037466 Ga0395898_0100821 Ga0395898_0100821_723_1361 211
171 3300037466 Ga0395898_0215257 Ga0395898_0215257_863_1501 211
172 3300037471 Ga0395905_0607572 Ga0395905_0607572_332_970 211
173 3300038443 Ga0395901_0289461 Ga0395901_0289461_479_1117 211
174 3300005336 Ga0070680_100008811 Ga0070680_1000088115 212
175 3300005563 Ga0068855_100820224 Ga0068855_1008202242 212
176 3300025917 Ga0207660_10000716 Ga0207660_100007164 212
177 3300005366 Ga0070659_100490922 Ga0070659_1004909222 213
178 3300013102 Ga0157371_10260802 Ga0157371_102608022 213
179 3300025932 Ga0207690_10174153 Ga0207690_101741532 213
180 3300025909 Ga0207705_10182875 Ga0207705_101828752 214
181 3300025932 Ga0207690_10062840 Ga0207690_100628404 214
182 3300025933 Ga0207706_10247901 Ga0207706_102479011 214
183 3300026116 Ga0207674_10023046 Ga0207674_100230467 214
184 3300005539 Ga0068853_100064792 Ga0068853_1000647924 215
185 3300011119 Ga0105246_10144498 Ga0105246_101444983 215
186 3300025941 Ga0207711_10685372 Ga0207711_106853721 215
187 3300026041 Ga0207639_10153369 Ga0207639_101533692 215
188 3300037312 Ga0395899_0008499 Ga0395899_0008499_6396_7043 215
189 3300037418 Ga0395900_0170507 Ga0395900_0170507_28_675 215
190 3300037418 Ga0395900_0315736 Ga0395900_0315736_348_995 215
191 3300037466 Ga0395898_0087043 Ga0395898_0087043_2267_2914 215
192 3300037466 Ga0395898_0127566 Ga0395898_0127566_1285_1932 215
193 3300037471 Ga0395905_0040830 Ga0395905_0040830_380_1027 215
194 3300037471 Ga0395905_0091575 Ga0395905_0091575_641_1288 215
195 3300037471 Ga0395905_0461524 Ga0395905_0461524_346_993 215
196 3300038443 Ga0395901_0245769 Ga0395901_0245769_570_1217 215
197 3300038443 Ga0395901_0258554 Ga0395901_0258554_246_893 215
198 3300038443 Ga0395901_0488155 Ga0395901_0488155_11_658 215
199 3300042005 Ga0439448_0004171 Ga0439448_0004171_3104_3751 215
200 3300042012 Ga0439455_0027992 Ga0439455_0027992_72_719 215
201 3300044694 Ga0466963_0066689 Ga0466963_0066689_1353_2000 215
202 3300045976 Ga0466967_0003513 Ga0466967_0003513_3583_4230 215
203 3300045976 Ga0466967_0092201 Ga0466967_0092201_1813_2460 215
204 3300046522 Ga0495643_0186689 Ga0495643_0186689_180_827 215
205 3300046681 Ga0495647_0013059 Ga0495647_0013059_1997_2647 215
206 3300048904 Ga0496101_0024318 Ga0496101_0024318_3312_3974 215
207 3300048918 Ga0496115_0010245 Ga0496115_0010245_1550_2212 215
208 3300005366 Ga0070659_100028342 Ga0070659_1000283426 216
209 3300005455 Ga0070663_100238366 Ga0070663_1002383662 216
210 3300005458 Ga0070681_10030807 Ga0070681_100308078 216
211 3300005530 Ga0070679_100027755 Ga0070679_1000277556 216
212 3300005539 Ga0068853_100089050 Ga0068853_1000890503 216
213 3300005548 Ga0070665_100273007 Ga0070665_1002730072 216
214 3300005564 Ga0070664_100065137 Ga0070664_1000651375 216
215 3300005616 Ga0068852_100083937 Ga0068852_1000839373 216
216 3300013100 Ga0157373_10038000 Ga0157373_100380004 216
217 3300013105 Ga0157369_10246658 Ga0157369_102466582 216
218 3300025909 Ga0207705_10027003 Ga0207705_100270036 216
219 3300025919 Ga0207657_10011525 Ga0207657_100115253 216
220 3300025932 Ga0207690_10010318 Ga0207690_100103186 216
221 3300025932 Ga0207690_10322539 Ga0207690_103225392 216
222 3300025945 Ga0207679_10155444 Ga0207679_101554442 216
223 3300026067 Ga0207678_10235676 Ga0207678_102356762 216
224 3300037418 Ga0395900_0126912 Ga0395900_0126912_967_1650 216
225 3300037471 Ga0395905_0144388 Ga0395905_0144388_971_1621 216
226 3300037471 Ga0395905_0422312 Ga0395905_0422312_361_1044 216
227 3300038443 Ga0395901_0302019 Ga0395901_0302019_10_693 216
228 3300005364 Ga0070673_100361679 Ga0070673_1003616791 217
229 3300061719 Ga0466962_0227549 Ga0466962_0227549_198_857 217
230 3300001990 JGI24737J22298_10019577 JGI24737J22298_100195772 218
231 3300002075 JGI24738J21930_10029111 JGI24738J21930_100291112 218
232 3300005327 Ga0070658_10012328 Ga0070658_100123283 218
233 3300005327 Ga0070658_10018678 Ga0070658_100186785 218
234 3300005328 Ga0070676_10019947 Ga0070676_100199472 218
235 3300005330 Ga0070690_100008291 Ga0070690_1000082916 218
236 3300005335 Ga0070666_10003290 Ga0070666_100032909 218
237 3300005338 Ga0068868_100001497 Ga0068868_10000149715 218
238 3300005338 Ga0068868_100040484 Ga0068868_1000404843 218
239 3300005339 Ga0070660_100022407 Ga0070660_1000224073 218
240 3300005339 Ga0070660_100079712 Ga0070660_1000797124 218
241 3300005340 Ga0070689_100292869 Ga0070689_1002928692 218
242 3300005344 Ga0070661_100009699 Ga0070661_1000096996 218
243 3300005354 Ga0070675_100069765 Ga0070675_1000697655 218
244 3300005355 Ga0070671_100023117 Ga0070671_1000231174 218
245 3300005356 Ga0070674_100004983 Ga0070674_1000049836 218
246 3300005364 Ga0070673_100003531 Ga0070673_1000035316 218
247 3300005366 Ga0070659_100174893 Ga0070659_1001748933 218
248 3300005367 Ga0070667_100020316 Ga0070667_1000203165 218
249 3300005455 Ga0070663_100052968 Ga0070663_1000529682 218
250 3300005456 Ga0070678_100005013 Ga0070678_1000050138 218
251 3300005457 Ga0070662_100002632 Ga0070662_1000026325 218
252 3300005459 Ga0068867_100006361 Ga0068867_1000063616 218
253 3300005539 Ga0068853_100795068 Ga0068853_1007950682 218
254 3300005543 Ga0070672_100006621 Ga0070672_1000066215 218
255 3300005548 Ga0070665_100016126 Ga0070665_1000161268 218
256 3300005564 Ga0070664_100007622 Ga0070664_1000076222 218
257 3300005578 Ga0068854_100047870 Ga0068854_1000478703 218
258 3300005614 Ga0068856_100039322 Ga0068856_1000393226 218
259 3300005616 Ga0068852_100004886 Ga0068852_1000048868 218
260 3300005617 Ga0068859_100017599 Ga0068859_1000175997 218
261 3300005618 Ga0068864_100028599 Ga0068864_1000285996 218
262 3300005718 Ga0068866_10010216 Ga0068866_100102165 218
263 3300005719 Ga0068861_100494668 Ga0068861_1004946682 218
264 3300005834 Ga0068851_10006186 Ga0068851_100061868 218
265 3300005834 Ga0068851_10216339 Ga0068851_102163392 218
266 3300005841 Ga0068863_100033535 Ga0068863_1000335354 218
267 3300005842 Ga0068858_100019058 Ga0068858_1000190586 218
268 3300006237 Ga0097621_100015640 Ga0097621_1000156404 218
269 3300006358 Ga0068871_100021153 Ga0068871_1000211535 218
270 3300006881 Ga0068865_100006686 Ga0068865_1000066866 218
271 3300006931 Ga0097620_100017600 Ga0097620_1000176007 218
272 3300009093 Ga0105240_10070774 Ga0105240_100707746 218
273 3300009098 Ga0105245_10010546 Ga0105245_100105469 218
274 3300009148 Ga0105243_10023919 Ga0105243_100239196 218
275 3300009176 Ga0105242_10009591 Ga0105242_100095919 218
276 3300009177 Ga0105248_10038332 Ga0105248_100383326 218
277 3300009551 Ga0105238_10016671 Ga0105238_100166715 218
278 3300013100 Ga0157373_10213833 Ga0157373_102138332 218
279 3300013102 Ga0157371_10024685 Ga0157371_100246855 218
280 3300013296 Ga0157374_10022956 Ga0157374_100229563 218
281 3300013297 Ga0157378_10012580 Ga0157378_100125808 218
282 3300013297 Ga0157378_10294945 Ga0157378_102949451 218
283 3300013306 Ga0163162_10020561 Ga0163162_100205619 218
284 3300013308 Ga0157375_10009954 Ga0157375_100099546 218
285 3300014325 Ga0163163_10055306 Ga0163163_100553065 218
286 3300014745 Ga0157377_10349064 Ga0157377_103490642 218
287 3300014968 Ga0157379_10010521 Ga0157379_100105218 218
288 3300014969 Ga0157376_10030968 Ga0157376_100309686 218
289 3300025321 Ga0207656_10030437 Ga0207656_100304373 218
290 3300025321 Ga0207656_10144049 Ga0207656_101440491 218
291 3300025899 Ga0207642_10033971 Ga0207642_100339713 218
292 3300025901 Ga0207688_10078702 Ga0207688_100787022 218
293 3300025903 Ga0207680_10001306 Ga0207680_100013069 218
294 3300025907 Ga0207645_10026652 Ga0207645_100266523 218
295 3300025907 Ga0207645_10084796 Ga0207645_100847963 218
296 3300025909 Ga0207705_10028881 Ga0207705_100288815 218
297 3300025909 Ga0207705_10056625 Ga0207705_100566254 218
298 3300025919 Ga0207657_10074217 Ga0207657_100742174 218
299 3300025919 Ga0207657_10236927 Ga0207657_102369272 218
300 3300025920 Ga0207649_10027651 Ga0207649_100276516 218
301 3300025925 Ga0207650_10094558 Ga0207650_100945582 218
302 3300025927 Ga0207687_10070185 Ga0207687_100701854 218
303 3300025931 Ga0207644_10001055 Ga0207644_1000105510 218
304 3300025933 Ga0207706_10002977 Ga0207706_1000297714 218
305 3300025934 Ga0207686_10004481 Ga0207686_100044816 218
306 3300025936 Ga0207670_10302586 Ga0207670_103025861 218
307 3300025937 Ga0207669_10005160 Ga0207669_100051606 218
308 3300025940 Ga0207691_10002787 Ga0207691_1000278720 218
309 3300025941 Ga0207711_10009940 Ga0207711_100099406 218
310 3300025945 Ga0207679_10127150 Ga0207679_101271503 218
311 3300025960 Ga0207651_10001542 Ga0207651_100015426 218
312 3300025981 Ga0207640_10039030 Ga0207640_100390303 218
313 3300025986 Ga0207658_10012694 Ga0207658_100126944 218
314 3300026023 Ga0207677_10003171 Ga0207677_100031717 218
315 3300026023 Ga0207677_10003995 Ga0207677_100039954 218
316 3300026035 Ga0207703_10024121 Ga0207703_100241212 218
317 3300026041 Ga0207639_10511427 Ga0207639_105114272 218
318 3300026078 Ga0207702_10069946 Ga0207702_100699464 218
319 3300026088 Ga0207641_10042941 Ga0207641_100429414 218
320 3300026089 Ga0207648_10010598 Ga0207648_100105988 218
321 3300026118 Ga0207675_100408503 Ga0207675_1004085032 218
322 3300026121 Ga0207683_10006388 Ga0207683_100063886 218
323 3300026142 Ga0207698_10016104 Ga0207698_100161044 218
324 3300028379 Ga0268266_10044171 Ga0268266_100441715 218
325 3300048903 Ga0496100_0061673 Ga0496100_0061673_148_810 218
326 3300048904 Ga0496101_0011745 Ga0496101_0011745_3099_3761 218
327 3300048905 Ga0496102_0221350 Ga0496102_0221350_738_1400 218
328 3300048908 Ga0496105_0018231 Ga0496105_0018231_1515_2177 218
329 3300048909 Ga0496106_0003210 Ga0496106_0003210_8850_9512 218
330 3300048910 Ga0496107_0001852 Ga0496107_0001852_3675_4337 218
331 3300048911 Ga0496108_0000578 Ga0496108_0000578_24082_24744 218
332 3300048912 Ga0496109_0013232 Ga0496109_0013232_2703_3365 218
333 3300048913 Ga0496110_0004837 Ga0496110_0004837_4426_5088 218
334 3300048914 Ga0496111_0000970 Ga0496111_0000970_9902_10564 218
335 3300048915 Ga0496112_0023255 Ga0496112_0023255_581_1243 218
336 3300048916 Ga0496113_0000659 Ga0496113_0000659_11019_11681 218
337 3300048917 Ga0496114_0040584 Ga0496114_0040584_2236_2898 218
338 3300005563 Ga0068855_100860789 Ga0068855_1008607892 219
339 3300025949 Ga0207667_10737718 Ga0207667_107377182 219
340 3300044684 Ga0466966_0042918 Ga0466966_0042918_1155_1814 219
341 3300044694 Ga0466963_0032333 Ga0466963_0032333_2647_3306 219
342 3300044842 Ga0466957_0140179 Ga0466957_0140179_463_1134 219
343 3300045049 Ga0466959_0006389 Ga0466959_0006389_4016_4675 219
344 3300045836 Ga0466958_0119283 Ga0466958_0119283_652_1311 219
345 3300061719 Ga0466962_0335164 Ga0466962_0335164_29_700 219
346 3300001979 JGI24740J21852_10028415 JGI24740J21852_100284151 220
347 3300001979 JGI24740J21852_10028562 JGI24740J21852_100285623 220
348 3300005327 Ga0070658_10025337 Ga0070658_100253377 220
349 3300005327 Ga0070658_10092103 Ga0070658_100921033 220
350 3300005329 Ga0070683_100029136 Ga0070683_1000291365 220
351 3300005336 Ga0070680_100007602 Ga0070680_1000076024 220
352 3300005339 Ga0070660_100012165 Ga0070660_1000121652 220
353 3300005345 Ga0070692_10029359 Ga0070692_100293593 220
354 3300005458 Ga0070681_10067399 Ga0070681_100673995 220
355 3300005530 Ga0070679_100030368 Ga0070679_1000303688 220
356 3300005535 Ga0070684_100016831 Ga0070684_1000168318 220
357 3300005563 Ga0068855_100019383 Ga0068855_1000193837 220
358 3300005614 Ga0068856_100051429 Ga0068856_1000514296 220
359 3300005616 Ga0068852_100334674 Ga0068852_1003346742 220
360 3300013104 Ga0157370_10023359 Ga0157370_100233594 220
361 3300025909 Ga0207705_10001651 Ga0207705_1000165111 220
362 3300025912 Ga0207707_10117980 Ga0207707_101179803 220
363 3300025917 Ga0207660_10066923 Ga0207660_100669232 220
364 3300025919 Ga0207657_10001862 Ga0207657_1000186226 220
365 3300025921 Ga0207652_10012439 Ga0207652_100124399 220
366 3300025944 Ga0207661_10021095 Ga0207661_100210957 220
367 3300025981 Ga0207640_10031678 Ga0207640_100316784 220
368 3300026078 Ga0207702_10017951 Ga0207702_100179516 220
369 3300037312 Ga0395899_0014094 Ga0395899_0014094_4498_5193 220
370 3300037471 Ga0395905_0006735 Ga0395905_0006735_9046_9741 220
371 3300038443 Ga0395901_0007314 Ga0395901_0007314_10424_11119 220
372 3300002077 JGI24744J21845_10000072 JGI24744J21845_100000723 222
373 3300005328 Ga0070676_10354514 Ga0070676_103545142 222
374 3300005337 Ga0070682_100156071 Ga0070682_1001560712 222
375 3300005339 Ga0070660_100087800 Ga0070660_1000878003 222
376 3300005339 Ga0070660_100438687 Ga0070660_1004386872 222
377 3300005344 Ga0070661_100040242 Ga0070661_1000402424 222
378 3300005366 Ga0070659_100019290 Ga0070659_1000192903 222
379 3300005457 Ga0070662_100088946 Ga0070662_1000889463 222
380 3300005539 Ga0068853_100189104 Ga0068853_1001891043 222
381 3300005547 Ga0070693_100001691 Ga0070693_1000016919 222
382 3300005564 Ga0070664_100032733 Ga0070664_1000327337 222
383 3300005578 Ga0068854_100577930 Ga0068854_1005779302 222
384 3300005616 Ga0068852_100021600 Ga0068852_1000216005 222
385 3300009098 Ga0105245_10072184 Ga0105245_100721844 222
386 3300009148 Ga0105243_10220458 Ga0105243_102204581 222
387 3300013100 Ga0157373_10063921 Ga0157373_100639214 222
388 3300013297 Ga0157378_10033888 Ga0157378_100338882 222
389 3300025899 Ga0207642_10045108 Ga0207642_100451082 222
390 3300025919 Ga0207657_10107322 Ga0207657_101073223 222
391 3300025932 Ga0207690_10038177 Ga0207690_100381772 222
392 3300025933 Ga0207706_10054433 Ga0207706_100544334 222
393 3300026067 Ga0207678_10300474 Ga0207678_103004742 222
394 3300037466 Ga0395898_0098845 Ga0395898_0098845_1245_1916 222
395 3300037471 Ga0395905_0001997 Ga0395905_0001997_14890_15561 222
396 3300038443 Ga0395901_0036368 Ga0395901_0036368_1245_1916 222
397 3300005356 Ga0070674_100043898 Ga0070674_1000438982 226
398 3300005456 Ga0070678_100081154 Ga0070678_1000811543 227
399 3300026121 Ga0207683_10326801 Ga0207683_103268012 227
400 3300037312 Ga0395899_0219057 Ga0395899_0219057_83_787 227
401 3300037418 Ga0395900_0279343 Ga0395900_0279343_807_1511 227
402 3300038443 Ga0395901_0008904 Ga0395901_0008904_9436_10140 227
403 3300038443 Ga0395901_0132884 Ga0395901_0132884_303_1007 227
404 3300038443 Ga0395901_0153405 Ga0395901_0153405_391_1086 227
405 3300005335 Ga0070666_10001975 Ga0070666_100019759 228
406 3300005335 Ga0070666_10204426 Ga0070666_102044262 228
407 3300005338 Ga0068868_100055402 Ga0068868_1000554025 228
408 3300005339 Ga0070660_100331902 Ga0070660_1003319022 228
409 3300005344 Ga0070661_100013255 Ga0070661_1000132555 228
410 3300005354 Ga0070675_100052515 Ga0070675_1000525154 228
411 3300005355 Ga0070671_100032123 Ga0070671_1000321234 228
412 3300005355 Ga0070671_100105375 Ga0070671_1001053752 228
413 3300005356 Ga0070674_100063650 Ga0070674_1000636503 228
414 3300005364 Ga0070673_100001132 Ga0070673_1000011329 228
415 3300005367 Ga0070667_100005255 Ga0070667_1000052558 228
416 3300005435 Ga0070714_100281075 Ga0070714_1002810752 228
417 3300005436 Ga0070713_100014782 Ga0070713_1000147823 228
418 3300005456 Ga0070678_100005250 Ga0070678_1000052508 228
419 3300005457 Ga0070662_100005625 Ga0070662_1000056254 228
420 3300005466 Ga0070685_10032615 Ga0070685_100326152 228
421 3300005535 Ga0070684_100805962 Ga0070684_1008059622 228
422 3300005543 Ga0070672_100005635 Ga0070672_10000563513 228
423 3300005548 Ga0070665_100034511 Ga0070665_1000345115 228
424 3300005564 Ga0070664_100011689 Ga0070664_1000116898 228
425 3300005616 Ga0068852_100028783 Ga0068852_1000287832 228
426 3300005617 Ga0068859_100125068 Ga0068859_1001250683 228
427 3300005618 Ga0068864_100001642 Ga0068864_10000164217 228
428 3300005841 Ga0068863_100011068 Ga0068863_1000110689 228
429 3300005842 Ga0068858_100002545 Ga0068858_10000254514 228
430 3300005843 Ga0068860_100186149 Ga0068860_1001861492 228
431 3300006173 Ga0070716_100060970 Ga0070716_1000609702 228
432 3300006237 Ga0097621_100013293 Ga0097621_1000132939 228
433 3300006358 Ga0068871_100007445 Ga0068871_1000074454 228
434 3300006881 Ga0068865_100213440 Ga0068865_1002134401 228
435 3300006931 Ga0097620_100125064 Ga0097620_1001250643 228
436 3300009177 Ga0105248_10005810 Ga0105248_100058103 228
437 3300025903 Ga0207680_10006317 Ga0207680_100063174 228
438 3300025907 Ga0207645_10388874 Ga0207645_103888742 228
439 3300025909 Ga0207705_10038012 Ga0207705_100380123 228
440 3300025920 Ga0207649_10016221 Ga0207649_100162212 228
441 3300025921 Ga0207652_10439975 Ga0207652_104399752 228
442 3300025925 Ga0207650_10006964 Ga0207650_100069645 228
443 3300025926 Ga0207659_10097392 Ga0207659_100973922 228
444 3300025928 Ga0207700_10029593 Ga0207700_100295932 228
445 3300025929 Ga0207664_10095828 Ga0207664_100958283 228
446 3300025929 Ga0207664_10420214 Ga0207664_104202142 228
447 3300025931 Ga0207644_10001036 Ga0207644_1000103612 228
448 3300025933 Ga0207706_10002923 Ga0207706_1000292313 228
449 3300025938 Ga0207704_10199193 Ga0207704_101991931 228
450 3300025940 Ga0207691_10001996 Ga0207691_100019962 228
451 3300025941 Ga0207711_10003024 Ga0207711_100030242 228
452 3300025941 Ga0207711_10197864 Ga0207711_101978643 228
453 3300025945 Ga0207679_10021255 Ga0207679_100212555 228
454 3300025960 Ga0207651_10002725 Ga0207651_1000272510 228
455 3300025986 Ga0207658_10005276 Ga0207658_100052768 228
456 3300026035 Ga0207703_10036865 Ga0207703_100368655 228
457 3300026095 Ga0207676_10006163 Ga0207676_1000616310 228
458 3300026121 Ga0207683_10001537 Ga0207683_1000153710 228
459 3300026142 Ga0207698_10057796 Ga0207698_100577962 228
460 3300026142 Ga0207698_10532649 Ga0207698_105326492 228
461 3300028379 Ga0268266_10000458 Ga0268266_1000045824 228
462 3300028379 Ga0268266_10010398 Ga0268266_100103989 228
463 3300031731 Ga0307405_10140896 Ga0307405_101408962 228
464 3300032002 Ga0307416_100570360 Ga0307416_1005703602 228
465 3300037312 Ga0395899_0060488 Ga0395899_0060488_729_1427 228
466 3300037418 Ga0395900_0013711 Ga0395900_0013711_4721_5419 228
467 3300037418 Ga0395900_0062328 Ga0395900_0062328_2840_3538 228
468 3300037466 Ga0395898_0097940 Ga0395898_0097940_662_1360 228
469 3300037471 Ga0395905_0008262 Ga0395905_0008262_6294_6992 228
470 3300038443 Ga0395901_0002513 Ga0395901_0002513_16045_16743 228
471 3300038443 Ga0395901_0006861 Ga0395901_0006861_4240_4938 228
472 3300042157 Ga0439458_0022391 Ga0439458_0022391_398_1096 228
473 3300044694 Ga0466963_0023695 Ga0466963_0023695_2213_2905 228
474 3300045976 Ga0466967_0034884 Ga0466967_0034884_3043_3735 228
475 3300045976 Ga0466967_0239483 Ga0466967_0239483_91_792 228
476 3300048903 Ga0496100_0093938 Ga0496100_0093938_1296_1994 228
477 3300048904 Ga0496101_0054058 Ga0496101_0054058_1532_2230 228
478 3300048911 Ga0496108_0018738 Ga0496108_0018738_136_834 228
479 3300048912 Ga0496109_0004627 Ga0496109_0004627_5985_6683 228
480 3300048913 Ga0496110_0009281 Ga0496110_0009281_4250_4948 228
481 3300048914 Ga0496111_0088831 Ga0496111_0088831_436_1134 228
482 3300048915 Ga0496112_0020194 Ga0496112_0020194_2119_2817 228
483 3300005331 Ga0070670_100562064 Ga0070670_1005620642 229
484 3300005338 Ga0068868_100079400 Ga0068868_1000794002 229
485 3300005355 Ga0070671_100102644 Ga0070671_1001026444 229
486 3300005364 Ga0070673_100503552 Ga0070673_1005035521 229
487 3300005367 Ga0070667_100548319 Ga0070667_1005483192 229
488 3300005577 Ga0068857_100002945 Ga0068857_1000029452 229
489 3300005614 Ga0068856_100345389 Ga0068856_1003453892 229
490 3300005841 Ga0068863_100124549 Ga0068863_1001245492 229
491 3300013105 Ga0157369_10034175 Ga0157369_100341753 229
492 3300025903 Ga0207680_10010102 Ga0207680_100101026 229
493 3300025904 Ga0207647_10064097 Ga0207647_100640972 229
494 3300025932 Ga0207690_10038851 Ga0207690_100388514 229
495 3300025986 Ga0207658_10498519 Ga0207658_104985192 229
496 3300026023 Ga0207677_10229420 Ga0207677_102294202 229
497 3300026078 Ga0207702_10213409 Ga0207702_102134092 229
498 3300026088 Ga0207641_11035411 Ga0207641_110354111 229
499 3300026095 Ga0207676_10495616 Ga0207676_104956162 229
500 3300026116 Ga0207674_10000271 Ga0207674_1000027141 229
501 3300037418 Ga0395900_0171352 Ga0395900_0171352_226_930 229
502 3300037418 Ga0395900_0817642 Ga0395900_0817642_63_764 229
503 3300037471 Ga0395905_0083847 Ga0395905_0083847_1445_2149 229
504 3300038443 Ga0395901_0306141 Ga0395901_0306141_685_1389 229
505 3300001976 JGI24752J21851_1010719 JGI24752J21851_10107192 231
506 3300005343 Ga0070687_100165315 Ga0070687_1001653152 231
507 3300005344 Ga0070661_100485454 Ga0070661_1004854542 231
508 3300005355 Ga0070671_100083381 Ga0070671_1000833814 231
509 3300005366 Ga0070659_100022605 Ga0070659_1000226055 231
510 3300005367 Ga0070667_100044768 Ga0070667_1000447682 231
511 3300005455 Ga0070663_100073497 Ga0070663_1000734973 231
512 3300005535 Ga0070684_100076123 Ga0070684_1000761233 231
513 3300005545 Ga0070695_100253821 Ga0070695_1002538212 231
514 3300005546 Ga0070696_100263916 Ga0070696_1002639161 231
515 3300005577 Ga0068857_100018000 Ga0068857_1000180005 231
516 3300005618 Ga0068864_100008878 Ga0068864_1000088786 231
517 3300005842 Ga0068858_100014125 Ga0068858_1000141257 231
518 3300025321 Ga0207656_10191381 Ga0207656_101913812 231
519 3300025900 Ga0207710_10307425 Ga0207710_103074252 231
520 3300025904 Ga0207647_10002598 Ga0207647_100025986 231
521 3300025920 Ga0207649_10110274 Ga0207649_101102743 231
522 3300025931 Ga0207644_10020468 Ga0207644_100204683 231
523 3300025986 Ga0207658_10053374 Ga0207658_100533743 231
524 3300026035 Ga0207703_10019201 Ga0207703_100192016 231
525 3300026095 Ga0207676_10436464 Ga0207676_104364642 231
526 3300037418 Ga0395900_0103635 Ga0395900_0103635_788_1507 231
527 3300045049 Ga0466959_0099974 Ga0466959_0099974_1071_1781 231
528 3300048905 Ga0496102_0022268 Ga0496102_0022268_3369_4064 231
529 3300048907 Ga0496104_0211029 Ga0496104_0211029_898_1593 231
530 3300048910 Ga0496107_0070176 Ga0496107_0070176_1637_2332 231
531 3300048914 Ga0496111_0362539 Ga0496111_0362539_12_707 231
532 3300048915 Ga0496112_0013295 Ga0496112_0013295_2909_3604 231
533 3300048916 Ga0496113_0012992 Ga0496113_0012992_3934_4629 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01292

Ni_hydr_CYTB

Prokaryotic cytochrome b561

25

193

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ch4-assembly1.cif.gz_G peptide-bound state of thermus thermophilus secyeg 0.664 102 164
5ch4-assembly1.cif.gz_G peptide-bound state of thermus thermophilus secyeg 0.5703 102 164
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.5621 18 177
8akn-assembly1.cif.gz_W cryo-em structure of the proline-rich antimicrobial peptide drosocin bound to the terminating ribosome 0.5196 81 161
8u4v-assembly1.cif.gz_A cryo-em structure of human claudin-4 complex with clostridium perfringens enterotoxin c-terminal domain, sfab cop-1, and nanobody 0.5187 101 221
ID Description Score Start End Superfamily
1kqgC00 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6122 13 188 1.20.950.20
af_P0AAM1_1_207_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.5971 1 173 1.20.950.20
4gd3B00 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.5623 18 177 1.20.950.20
af_D3YXS5_690_1028_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.5551 82 175 2.60.40.150
af_V6CKM5_1256_1408_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.5435 18 185 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A6J4TLL8-F1-model_v4 Cytochrome b561 bacterial/Ni-hydrogenase domain-containing protein 0.8821 14 228 GO:0005886
GO:0009055
GO:0020037
GO:0022904
AF-A0A1U9JLL2-F1-model_v4 Hydrogenase 0.8777 14 222 GO:0005886
GO:0009055
GO:0020037
GO:0022904
AF-A0A537MGM9-F1-model_v4 Ni/Fe-hydrogenase 1 b-type cytochrome subunit 0.8714 14 219 GO:0005886
GO:0009055
GO:0020037
GO:0022904
AF-A9LZ79-F1-model_v4 deleted 0.8713 47 221
AF-A0A850KKC3-F1-model_v4 Cytochrome b/b6 domain-containing protein 0.8693 14 218 GO:0005886
GO:0009055
GO:0020037
GO:0022904

Feature Viewer

pLDDT pTM Quality
80.64 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map