F460457

General Info

Members Datasets Scaffolds Average Seq Length
533 235 526 103

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0007245|Ga0495643_0007245_6697_7041
Length 114
Sequence MQGQGQQGGNLQLLTGALLDDAALTLEELARACAVEPDWVVRHVHAGVLGGGFDVSVQVTRWRFRSGDLARARRLLSIERDFDANEDLAALVVDMADEIRRLRARLHALGIDLA

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221556 Massilia sp. Root1485 Isolate Unclassified
3 2643221638 Duganella sp. Root336D2 Isolate Unclassified
4 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
5 2643221684 Massilia sp. Root133 Isolate Unclassified
6 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
106 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
107 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
108 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
109 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
110 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
111 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
112 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
113 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
114 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
130 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
156 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
191 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
219 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
220 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
225 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
226 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
227 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
228 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
229 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 0.94
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.44
Nodule 0
Rhizoplane 4.32
Rhizosphere 80.86
Stem 0
Stem Tuber 0
Unclassified 3.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1002522 3300002739 Bacteria 2962
2 JGI25158J39367_1025476 3300002739 Bacteria 696
3 JGI25152J39213_1000200 3300002773 Bacteria 40043
4 JGI25152J39213_1000212 3300002773 Bacteria 39360
5 JGI25152J39213_1011176 3300002773 Bacteria 2000
6 JGI25150J39212_1000124 3300002774 Bacteria 43391
7 JGI25150J39212_1006104 3300002774 Bacteria 2516
8 JGI25159J45721_1000149 3300002987 Bacteria 32497
9 JGI25159J45721_1003350 3300002987 Bacteria 5715
10 JGI25153J46596_10001715 3300003215 Bacteria 12987
11 rootL2_10019282 3300003322 Bacteria 18425
12 rootL2_10060538 3300003322 Bacteria 4044
13 JGI25160J50197_1002663 3300003354 Bacteria 8229
14 JGI25161J50226_1000249 3300003374 Bacteria 32210
15 JGI25161J50226_1002440 3300003374 Bacteria 4770
16 Ga0007409J51694_1098955 3300003575 Bacteria 1142
17 Ga0055525_1000074 3300003759 Bacteria 178058
18 Ga0055542_1023166 3300003762 Bacteria 874
19 Ga0055526_1001603 3300003771 Bacteria 15881
20 Ga0055526_1004898 3300003771 Bacteria 7881
21 Ga0055524_1001700 3300003775 Bacteria 12263
22 Ga0055524_1001710 3300003775 Bacteria 12200
23 Ga0055524_1001782 3300003775 Bacteria 11821
24 Ga0055534_1040853 3300003784 Bacteria 683
25 Ga0055528_1012631 3300003790 Bacteria 3262
26 Ga0055530_10000569 3300003791 Bacteria 31991
27 Ga0055530_10085031 3300003791 Unclassified 658
28 Ga0055531_10004579 3300003794 Bacteria 8345
29 Ga0055531_10012420 3300003794 Bacteria 4008
30 Ga0055531_10112065 3300003794 Bacteria 543
31 Ga0055543_1000154 3300004625 Bacteria 57352
32 Ga0065165_1000571 3300005262 Bacteria 54679
33 Ga0070658_10092863 3300005327 Bacteria 2488
34 Ga0070676_10387486 3300005328 Bacteria 969
35 Ga0068869_100501763 3300005334 Bacteria 1013
36 Ga0070660_100033746 3300005339 Bacteria 3860
37 Ga0070660_100224456 3300005339 Bacteria 1527
38 Ga0070660_100483038 3300005339 Bacteria 1029
39 Ga0070661_100202420 3300005344 Bacteria 1517
40 Ga0070674_100590833 3300005356 Bacteria 937
41 Ga0070659_100033434 3300005366 Bacteria 3994
42 Ga0070663_101754588 3300005455 Bacteria 556
43 Ga0070662_100219118 3300005457 Bacteria 1518
44 Ga0070662_100886968 3300005457 Bacteria 761
45 Ga0070662_101346802 3300005457 Bacteria 615
46 Ga0068867_100218056 3300005459 Bacteria 1536
47 Ga0070679_101581391 3300005530 Bacteria 603
48 Ga0068853_101225756 3300005539 Bacteria 725
49 Ga0068855_100449311 3300005563 Bacteria 1407
50 Ga0068855_100973616 3300005563 Bacteria 893
51 Ga0068865_100137715 3300006881 Bacteria 1837
52 Ga0105244_10099500 3300009036 Bacteria 1423
53 Ga0105240_11044279 3300009093 Bacteria 872
54 Ga0105245_10278261 3300009098 Bacteria 1635
55 Ga0105243_10033568 3300009148 Bacteria 3969
56 Ga0105241_10018687 3300009174 Bacteria 5103
57 Ga0105242_10023888 3300009176 Bacteria 4824
58 Ga0105237_10539999 3300009545 Bacteria 1173
59 Ga0105238_11417503 3300009551 Bacteria 722
60 Ga0105239_10653362 3300010375 Bacteria 1201
61 Ga0105246_12315376 3300011119 Bacteria 525
62 Ga0157373_10405866 3300013100 Bacteria 977
63 Ga0157371_10648272 3300013102 Bacteria 788
64 Ga0157370_10829191 3300013104 Bacteria 841
65 Ga0157369_12278918 3300013105 Bacteria 549
66 Ga0157374_10637473 3300013296 Bacteria 1077
67 Ga0157378_10333530 3300013297 Bacteria 1477
68 Ga0157372_10481364 3300013307 Bacteria 1447
69 Ga0157372_10778080 3300013307 Bacteria 1112
70 Ga0157372_10898581 3300013307 Bacteria 1028
71 Ga0157376_10623227 3300014969 Bacteria 1076
72 Ga0182007_10167136 3300015262 Bacteria 755
73 Ga0213872_10001281 3300021361 Bacteria 16820
74 Ga0213872_10092168 3300021361 Bacteria 1355
75 Ga0209436_100090 3300025208 Bacteria 45531
76 Ga0209436_100848 3300025208 Bacteria 12300
77 Ga0209563_100003 3300025230 Bacteria 1932942
78 Ga0207425_1000017 3300025245 Bacteria 423851
79 Ga0207425_1000341 3300025245 Bacteria 32384
80 Ga0209677_102572 3300025253 Bacteria 6678
81 Ga0209148_1001147 3300025254 Bacteria 15420
82 Ga0209129_1000039 3300025258 Bacteria 322444
83 Ga0209129_1000088 3300025258 Bacteria 179071
84 Ga0209129_1003144 3300025258 Bacteria 7399
85 Ga0209129_1010216 3300025258 Bacteria 2370
86 Ga0209565_1000941 3300025263 Bacteria 15300
87 Ga0209565_1001333 3300025263 Bacteria 11241
88 Ga0209565_1002908 3300025263 Bacteria 5852
89 Ga0209565_1007403 3300025263 Bacteria 2963
90 Ga0209673_1010685 3300025273 Bacteria 3848
91 Ga0209130_1000350 3300025284 Bacteria 52970
92 Ga0209130_1002389 3300025284 Bacteria 9496
93 Ga0209675_1001225 3300025291 Bacteria 15503
94 Ga0209675_1001968 3300025291 Bacteria 11030
95 Ga0209564_1000626 3300025295 Bacteria 53912
96 Ga0209564_1003337 3300025295 Bacteria 11147
97 Ga0209564_1013433 3300025295 Bacteria 3481
98 Ga0209758_1000137 3300025297 Bacteria 176734
99 Ga0209050_1000598 3300025298 Bacteria 57505
100 Ga0209050_1003499 3300025298 Bacteria 11507
101 Ga0209256_1000189 3300025299 Bacteria 117922
102 Ga0209256_1001876 3300025299 Bacteria 19385
103 Ga0209256_1004802 3300025299 Bacteria 8205
104 Ga0207426_1002427 3300025302 Bacteria 11927
105 Ga0209051_1026404 3300025303 Bacteria 2342
106 Ga0209257_1000355 3300025304 Bacteria 93718
107 Ga0207705_10219966 3300025909 Bacteria 1442
108 Ga0207705_11204905 3300025909 Bacteria 581
109 Ga0207654_10016799 3300025911 Bacteria 3816
110 Ga0207695_11120719 3300025913 Bacteria 667
111 Ga0207657_10003340 3300025919 Bacteria 17159
112 Ga0207657_10296693 3300025919 Bacteria 1281
113 Ga0207687_10213232 3300025927 Bacteria 1516
114 Ga0207690_10014816 3300025932 Bacteria 4717
115 Ga0207690_10272973 3300025932 Bacteria 1314
116 Ga0207690_10613779 3300025932 Bacteria 889
117 Ga0207706_10045057 3300025933 Bacteria 3908
118 Ga0207706_10616712 3300025933 Bacteria 931
119 Ga0207706_10872586 3300025933 Bacteria 761
120 Ga0207686_10090685 3300025934 Bacteria 2017
121 Ga0207709_10098532 3300025935 Bacteria 1928
122 Ga0207704_10114797 3300025938 Bacteria 1829
123 Ga0207689_10565026 3300025942 Bacteria 956
124 Ga0207667_10058209 3300025949 Bacteria 4054
125 Ga0207667_11330027 3300025949 Bacteria 694
126 Ga0207639_11883619 3300026041 Bacteria 559
127 Ga0207678_10744540 3300026067 Bacteria 864
128 Ga0207702_10191796 3300026078 Bacteria 1889
129 Ga0207648_10343174 3300026089 Bacteria 1345
130 Ga0207698_10167027 3300026142 Bacteria 1933
131 Ga0307515_10074419 3300028794 Bacteria 4544
132 Ga0307408_100000604 3300031548 Bacteria 30833
133 Ga0307408_100001681 3300031548 Bacteria 16252
134 Ga0307408_100002462 3300031548 Bacteria 12989
135 Ga0307408_100016587 3300031548 Bacteria 4919
136 Ga0307408_101107160 3300031548 Bacteria 735
137 Ga0307408_101355783 3300031548 Bacteria 668
138 Ga0265314_10055456 3300031711 Bacteria 2735
139 Ga0307416_100096436 3300032002 Bacteria 2557
140 Ga0307411_11281730 3300032005 Bacteria 667
141 Ga0395899_0002600 3300037312 Bacteria 14552
142 Ga0395899_0007727 3300037312 Bacteria 8292
143 Ga0395899_0050353 3300037312 Bacteria 3092
144 Ga0395899_0253595 3300037312 Bacteria 1206
145 Ga0395899_0683274 3300037312 Bacteria 645
146 Ga0395899_0996990 3300037312 Bacteria 505
147 Ga0395900_0000338 3300037418 Bacteria 69123
148 Ga0395900_0009793 3300037418 Bacteria 9820
149 Ga0395900_0013761 3300037418 Bacteria 8257
150 Ga0395900_0022377 3300037418 Bacteria 6464
151 Ga0395900_0061625 3300037418 Bacteria 3856
152 Ga0395900_0151448 3300037418 Bacteria 2369
153 Ga0395900_0257360 3300037418 Bacteria 1744
154 Ga0395900_1869576 3300037418 Bacteria 511
155 Ga0395898_0036327 3300037466 Bacteria 4892
156 Ga0395898_0225705 3300037466 Bacteria 1786
157 Ga0395898_0299718 3300037466 Bacteria 1533
158 Ga0395898_0533330 3300037466 Bacteria 1115
159 Ga0395898_0655160 3300037466 Bacteria 992
160 Ga0395898_0707013 3300037466 Bacteria 949
161 Ga0395905_0105847 3300037471 Bacteria 2641
162 Ga0395905_0177616 3300037471 Bacteria 1998
163 Ga0395905_0201373 3300037471 Bacteria 1866
164 Ga0395905_0249136 3300037471 Bacteria 1659
165 Ga0395905_0266716 3300037471 Bacteria 1598
166 Ga0395905_0548569 3300037471 Bacteria 1057
167 Ga0395905_1214611 3300037471 Bacteria 657
168 Ga0395905_1503124 3300037471 Bacteria 578
169 Ga0395901_0001241 3300038443 Bacteria 27240
170 Ga0395901_0012316 3300038443 Bacteria 8679
171 Ga0395901_0067924 3300038443 Bacteria 3713
172 Ga0395901_0370927 3300038443 Bacteria 1474
173 Ga0395901_0384498 3300038443 Bacteria 1444
174 Ga0395901_0405804 3300038443 Bacteria 1399
175 Ga0395901_0446399 3300038443 Bacteria 1323
176 Ga0395901_0573779 3300038443 Bacteria 1140
177 Ga0395901_1428835 3300038443 Bacteria 649
178 Ga0436361_0356959 3300039447 Bacteria 7409
179 Ga0436361_1176958 3300039447 Bacteria 2210
180 Ga0439465_0116376 3300041413 Bacteria 934
181 Ga0439433_0054021 3300041999 Bacteria 950
182 Ga0439448_0002056 3300042005 Bacteria 5395
183 Ga0439432_142741 3300042006 Bacteria 704
184 Ga0439449_0012190 3300042007 Bacteria 3232
185 Ga0439450_025658 3300042008 Bacteria 1293
186 Ga0439455_0009383 3300042012 Bacteria 2121
187 Ga0439455_0050474 3300042012 Bacteria 1086
188 Ga0450911_012230 3300042115 Bacteria 1161
189 Ga0450904_000249 3300042139 Bacteria 11733
190 Ga0439458_0032129 3300042157 Bacteria 1253
191 Ga0466969_0071096 3300044656 Bacteria 1673
192 Ga0466969_0086093 3300044656 Bacteria 1493
193 Ga0466969_0413686 3300044656 Bacteria 612
194 Ga0466972_0011790 3300044658 Bacteria 4390
195 Ga0466972_0051078 3300044658 Bacteria 1995
196 Ga0466972_0143862 3300044658 Bacteria 1122
197 Ga0466972_0222009 3300044658 Bacteria 884
198 Ga0466965_0012874 3300044683 Bacteria 3938
199 Ga0466965_0034155 3300044683 Bacteria 2487
200 Ga0466965_0081171 3300044683 Bacteria 1639
201 Ga0466965_0278633 3300044683 Bacteria 902
202 Ga0466966_0004652 3300044684 Bacteria 9040
203 Ga0466966_0026466 3300044684 Bacteria 3785
204 Ga0466966_0032802 3300044684 Bacteria 3362
205 Ga0466966_0320427 3300044684 Bacteria 931
206 Ga0466961_0316237 3300044693 Bacteria 952
207 Ga0466961_0957025 3300044693 Bacteria 509
208 Ga0466963_0118780 3300044694 Bacteria 1818
209 Ga0466964_0000146 3300044706 Bacteria 18973
210 Ga0466964_0001295 3300044706 Bacteria 8530
211 Ga0466964_0066681 3300044706 Bacteria 1511
212 Ga0466971_0044929 3300044719 Bacteria 1984
213 Ga0466971_0059439 3300044719 Bacteria 1726
214 Ga0466971_0295345 3300044719 Bacteria 777
215 Ga0466968_0001147 3300044735 Bacteria 9388
216 Ga0466968_0216776 3300044735 Bacteria 900
217 Ga0466970_0318309 3300044765 Bacteria 879
218 Ga0466970_0672482 3300044765 Bacteria 603
219 Ga0466970_0925341 3300044765 Bacteria 513
220 Ga0466957_0000022 3300044842 Bacteria 60843
221 Ga0466957_0004698 3300044842 Bacteria 7641
222 Ga0466957_0039216 3300044842 Bacteria 2857
223 Ga0466957_0479081 3300044842 Bacteria 860
224 Ga0466959_0076232 3300045049 Bacteria 2422
225 Ga0466959_0093590 3300045049 Bacteria 2156
226 Ga0466959_0123764 3300045049 Bacteria 1836
227 Ga0466959_0132055 3300045049 Bacteria 1769
228 Ga0466958_0028816 3300045836 Bacteria 3294
229 Ga0466958_0179701 3300045836 Bacteria 1342
230 Ga0466958_0572329 3300045836 Bacteria 734
231 Ga0466958_0736902 3300045836 Bacteria 642
232 Ga0466958_0757176 3300045836 Bacteria 633
233 Ga0466967_0000530 3300045976 Bacteria 18543
234 Ga0466967_0047208 3300045976 Bacteria 3753
235 Ga0466967_0127094 3300045976 Bacteria 2362
236 Ga0466967_1761060 3300045976 Bacteria 617
237 Ga0495617_001238 3300046452 Bacteria 11482
238 Ga0495617_055388 3300046452 Bacteria 1316
239 Ga0495627_005200 3300046453 Bacteria 5290
240 Ga0495603_0320364 3300046455 Bacteria 890
241 Ga0495590_0000180 3300046457 Bacteria 37213
242 Ga0495590_0272990 3300046457 Unclassified 632
243 Ga0495638_0004695 3300046460 Bacteria 10325
244 Ga0495638_0358721 3300046460 Unclassified 767
245 Ga0495653_0048307 3300046463 Bacteria 3285
246 Ga0495650_0000109 3300046471 Bacteria 199925
247 Ga0495650_0000152 3300046471 Bacteria 156983
248 Ga0495650_0007621 3300046471 Bacteria 6465
249 Ga0495580_0102173 3300046472 Bacteria 1993
250 Ga0495582_0000647 3300046473 Bacteria 19151
251 Ga0495605_0004465 3300046474 Bacteria 8209
252 Ga0495605_0007843 3300046474 Bacteria 6048
253 Ga0495605_0020960 3300046474 Bacteria 3468
254 Ga0495605_0024663 3300046474 Bacteria 3143
255 Ga0495605_0028557 3300046474 Bacteria 2878
256 Ga0495605_0034135 3300046474 Bacteria 2578
257 Ga0495605_0080367 3300046474 Bacteria 1526
258 Ga0495605_0081459 3300046474 Bacteria 1513
259 Ga0495605_0137151 3300046474 Bacteria 1099
260 Ga0495605_0237437 3300046474 Unclassified 783
261 Ga0495605_0272991 3300046474 Bacteria 720
262 Ga0495639_0365111 3300046475 Bacteria 726
263 Ga0495584_0001552 3300046491 Bacteria 13647
264 Ga0495584_0004823 3300046491 Bacteria 7207
265 Ga0495584_0010689 3300046491 Bacteria 4714
266 Ga0495584_0016990 3300046491 Bacteria 3707
267 Ga0495584_0028000 3300046491 Bacteria 2854
268 Ga0495584_0041421 3300046491 Bacteria 2325
269 Ga0495584_0087241 3300046491 Bacteria 1572
270 Ga0495584_0152642 3300046491 Bacteria 1173
271 Ga0495584_0543975 3300046491 Bacteria 592
272 Ga0495585_0001768 3300046492 Bacteria 16401
273 Ga0495585_0007460 3300046492 Bacteria 6690
274 Ga0495585_0008151 3300046492 Bacteria 6365
275 Ga0495585_0009868 3300046492 Bacteria 5709
276 Ga0495585_0116437 3300046492 Bacteria 1417
277 Ga0495585_0228679 3300046492 Bacteria 935
278 Ga0495594_0137228 3300046499 Bacteria 1387
279 Ga0495596_0001264 3300046500 Bacteria 14651
280 Ga0495596_0003778 3300046500 Bacteria 7557
281 Ga0495596_0038446 3300046500 Bacteria 1891
282 Ga0495596_0058203 3300046500 Bacteria 1507
283 Ga0495596_0098226 3300046500 Bacteria 1137
284 Ga0495596_0119435 3300046500 Bacteria 1023
285 Ga0495607_0001075 3300046501 Bacteria 24954
286 Ga0495607_0007409 3300046501 Bacteria 7596
287 Ga0495607_0024766 3300046501 Bacteria 3737
288 Ga0495607_0033031 3300046501 Bacteria 3151
289 Ga0495607_0086734 3300046501 Bacteria 1705
290 Ga0495607_0173966 3300046501 Bacteria 1085
291 Ga0495607_0367274 3300046501 Bacteria 661
292 Ga0495583_0000191 3300046506 Bacteria 102390
293 Ga0495583_0007453 3300046506 Bacteria 6867
294 Ga0495583_0008534 3300046506 Bacteria 6252
295 Ga0495583_0108477 3300046506 Bacteria 1178
296 Ga0495583_0163723 3300046506 Bacteria 916
297 Ga0495606_0000190 3300046507 Bacteria 107709
298 Ga0495606_0001538 3300046507 Bacteria 30447
299 Ga0495606_0033737 3300046507 Bacteria 3525
300 Ga0495606_0049960 3300046507 Bacteria 2739
301 Ga0495606_0196568 3300046507 Bacteria 1152
302 Ga0495606_0222604 3300046507 Bacteria 1062
303 Ga0495616_0000525 3300046513 Bacteria 28982
304 Ga0495616_0005915 3300046513 Bacteria 7460
305 Ga0495616_0008061 3300046513 Bacteria 6272
306 Ga0495616_0010267 3300046513 Bacteria 5427
307 Ga0495616_0057285 3300046513 Bacteria 1921
308 Ga0495616_0130777 3300046513 Bacteria 1150
309 Ga0495616_0198381 3300046513 Bacteria 883
310 Ga0495630_0185840 3300046517 Bacteria 1585
311 Ga0495631_0006913 3300046518 Bacteria 5816
312 Ga0495631_0017000 3300046518 Bacteria 3450
313 Ga0495631_0025793 3300046518 Bacteria 2703
314 Ga0495631_0069855 3300046518 Bacteria 1518
315 Ga0495632_0005534 3300046519 Bacteria 8328
316 Ga0495632_0014585 3300046519 Bacteria 4439
317 Ga0495637_0139691 3300046520 Bacteria 920
318 Ga0495637_0249668 3300046520 Bacteria 639
319 Ga0495643_0007245 3300046522 Bacteria 7186
320 Ga0495643_0015173 3300046522 Bacteria 4561
321 Ga0495643_0070023 3300046522 Bacteria 1842
322 Ga0495643_0430204 3300046522 Bacteria 577
323 Ga0495644_0011210 3300046523 Bacteria 3455
324 Ga0495648_0001254 3300046524 Bacteria 25334
325 Ga0495648_0005153 3300046524 Bacteria 10931
326 Ga0495648_0421636 3300046524 Bacteria 591
327 Ga0495663_0007083 3300046525 Bacteria 3096
328 Ga0495666_0004086 3300046526 Bacteria 7373
329 Ga0495642_0000193 3300046528 Bacteria 36094
330 Ga0495642_0010466 3300046528 Bacteria 3554
331 Ga0495642_0014174 3300046528 Bacteria 3089
332 Ga0495642_0014436 3300046528 Bacteria 3060
333 Ga0495642_0061468 3300046528 Bacteria 1559
334 Ga0495642_0082732 3300046528 Bacteria 1353
335 Ga0495642_0097828 3300046528 Bacteria 1246
336 Ga0495642_0166026 3300046528 Bacteria 958
337 Ga0495642_0341967 3300046528 Bacteria 657
338 Ga0495652_0013176 3300046529 Bacteria 7444
339 Ga0495654_0009148 3300046530 Bacteria 5432
340 Ga0495665_0003122 3300046531 Bacteria 8958
341 Ga0495586_0044186 3300046535 Bacteria 2399
342 Ga0495609_0000026 3300046538 Bacteria 251973
343 Ga0495609_0001077 3300046538 Bacteria 19040
344 Ga0495609_0001130 3300046538 Bacteria 18463
345 Ga0495609_0022505 3300046538 Bacteria 2902
346 Ga0495609_0038307 3300046538 Bacteria 2162
347 Ga0495609_0052480 3300046538 Bacteria 1814
348 Ga0495609_0071333 3300046538 Bacteria 1526
349 Ga0495609_0217757 3300046538 Bacteria 793
350 Ga0495609_0281907 3300046538 Unclassified 679
351 Ga0495597_0014682 3300046542 Bacteria 3725
352 Ga0495597_0024042 3300046542 Bacteria 2814
353 Ga0495597_0104363 3300046542 Bacteria 1192
354 Ga0495597_0110929 3300046542 Bacteria 1150
355 Ga0495597_0305192 3300046542 Unclassified 617
356 Ga0495645_0107096 3300046543 Bacteria 1982
357 Ga0495645_0474253 3300046543 Bacteria 786
358 Ga0495622_0338334 3300046557 Bacteria 652
359 Ga0495622_0458557 3300046557 Bacteria 546
360 Ga0495633_0004291 3300046558 Bacteria 9106
361 Ga0495633_0008961 3300046558 Bacteria 5574
362 Ga0495633_0009007 3300046558 Bacteria 5553
363 Ga0495633_0020283 3300046558 Bacteria 3345
364 Ga0495633_0129192 3300046558 Bacteria 1169
365 Ga0495656_0019235 3300046615 Bacteria 2634
366 Ga0495656_0469017 3300046615 Bacteria 665
367 Ga0495668_0003307 3300046616 Bacteria 12194
368 Ga0495668_0016644 3300046616 Bacteria 4274
369 Ga0495668_0030329 3300046616 Bacteria 3053
370 Ga0495668_0059320 3300046616 Bacteria 2111
371 Ga0495668_0315980 3300046616 Bacteria 856
372 Ga0495668_0497929 3300046616 Bacteria 671
373 Ga0495634_0002131 3300046642 Bacteria 16684
374 Ga0495611_0032471 3300046648 Bacteria 2300
375 Ga0495611_0105659 3300046648 Bacteria 1309
376 Ga0495611_0195379 3300046648 Bacteria 944
377 Ga0495611_0213046 3300046648 Bacteria 899
378 Ga0495611_0371183 3300046648 Bacteria 655
379 Ga0495625_0033305 3300046660 Bacteria 3812
380 Ga0495625_0084696 3300046660 Bacteria 2201
381 Ga0495625_0464490 3300046660 Unclassified 779
382 Ga0495625_0905975 3300046660 Bacteria 505
383 Ga0495659_0198296 3300046664 Bacteria 822
384 Ga0495661_0000913 3300046665 Bacteria 27093
385 Ga0495661_0011394 3300046665 Bacteria 6035
386 Ga0495661_0035230 3300046665 Bacteria 3142
387 Ga0495661_0041278 3300046665 Bacteria 2855
388 Ga0495661_0065353 3300046665 Bacteria 2143
389 Ga0495661_0067407 3300046665 Bacteria 2102
390 Ga0495661_0078704 3300046665 Bacteria 1906
391 Ga0495661_0091823 3300046665 Bacteria 1726
392 Ga0495661_0108746 3300046665 Bacteria 1548
393 Ga0495661_0170023 3300046665 Bacteria 1163
394 Ga0495661_0381408 3300046665 Bacteria 688
395 Ga0495661_0450563 3300046665 Bacteria 619
396 Ga0495588_0000140 3300046674 Bacteria 107766
397 Ga0495588_0058146 3300046674 Bacteria 1998
398 Ga0495588_0186940 3300046674 Bacteria 1094
399 Ga0495623_0049908 3300046679 Bacteria 2651
400 Ga0495623_0127701 3300046679 Bacteria 1525
401 Ga0495669_0000922 3300046684 Bacteria 12296
402 Ga0495669_0059292 3300046684 Bacteria 1728
403 Ga0495669_0217227 3300046684 Bacteria 916
404 Ga0495670_0004812 3300046691 Bacteria 6633
405 Ga0495670_0013188 3300046691 Bacteria 4064
406 Ga0495670_0052552 3300046691 Bacteria 2040
407 Ga0495649_0001214 3300046694 Bacteria 19895
408 Ga0495649_0032484 3300046694 Bacteria 2874
409 Ga0495649_0063954 3300046694 Bacteria 1976
410 Ga0495649_0119412 3300046694 Bacteria 1394
411 Ga0495649_0247743 3300046694 Bacteria 916
412 Ga0495649_0263670 3300046694 Bacteria 883
413 Ga0495649_0330867 3300046694 Bacteria 772
414 Ga0495589_0000337 3300046794 Bacteria 36745
415 Ga0495589_0020568 3300046794 Bacteria 3375
416 Ga0495589_0026838 3300046794 Bacteria 2916
417 Ga0495589_0032369 3300046794 Bacteria 2629
418 Ga0495589_0057196 3300046794 Bacteria 1918
419 Ga0495589_0385111 3300046794 Bacteria 644
420 Ga0495600_0133342 3300046809 Bacteria 1614
421 Ga0495660_0006344 3300046810 Bacteria 7007
422 Ga0495660_0079897 3300046810 Bacteria 1717
423 Ga0495660_0106469 3300046810 Bacteria 1436
424 Ga0495660_0370315 3300046810 Bacteria 633
425 Ga0495604_0012639 3300047317 Bacteria 6716
426 Ga0495636_0094902 3300047318 Bacteria 1298
427 Ga0495672_0020932 3300047320 Bacteria 4275
428 Ga0495672_0025490 3300047320 Bacteria 3784
429 Ga0495672_0074406 3300047320 Bacteria 1913
430 Ga0495672_0197380 3300047320 Bacteria 1008
431 Ga0495672_0283697 3300047320 Bacteria 790
432 Ga0495672_0370670 3300047320 Bacteria 660
433 Ga0495676_0082849 3300047321 Bacteria 2426
434 Ga0495676_0089394 3300047321 Bacteria 2308
435 Ga0495683_0005975 3300047323 Bacteria 6686
436 Ga0495683_0049352 3300047323 Bacteria 2108
437 Ga0495683_0070194 3300047323 Bacteria 1720
438 Ga0495683_0082094 3300047323 Bacteria 1571
439 Ga0495687_000037 3300047443 Bacteria 252363
440 Ga0495687_000155 3300047443 Bacteria 104610
441 Ga0495687_029218 3300047443 Bacteria 2554
442 Ga0495675_0013093 3300047444 Bacteria 5232
443 Ga0495677_0000130 3300047445 Bacteria 36684
444 Ga0495677_0001090 3300047445 Bacteria 10882
445 Ga0495677_0005200 3300047445 Bacteria 4950
446 Ga0495677_0013331 3300047445 Bacteria 2991
447 Ga0495677_0027129 3300047445 Bacteria 2077
448 Ga0495677_0043560 3300047445 Bacteria 1645
449 Ga0495677_0086792 3300047445 Bacteria 1176
450 Ga0495679_003055 3300047446 Bacteria 8223
451 Ga0495685_012312 3300047447 Bacteria 2896
452 Ga0495673_0139653 3300047469 Bacteria 945
453 Ga0495681_0000380 3300047470 Bacteria 34736
454 Ga0495681_0008050 3300047470 Bacteria 6645
455 Ga0495681_0018326 3300047470 Bacteria 3860
456 Ga0495681_0032729 3300047470 Bacteria 2614
457 Ga0495681_0089617 3300047470 Bacteria 1360
458 Ga0495686_0000047 3300047472 Bacteria 280086
459 Ga0495602_0010861 3300048088 Bacteria 9439
460 Ga0495615_0185680 3300048090 Unclassified 635
461 Ga0495626_0000009 3300048091 Bacteria 270596
462 Ga0495626_0000327 3300048091 Bacteria 50207
463 Ga0495626_0001723 3300048091 Bacteria 16731
464 Ga0495626_0008227 3300048091 Bacteria 5743
465 Ga0495626_0011856 3300048091 Bacteria 4590
466 Ga0495626_0013206 3300048091 Bacteria 4298
467 Ga0495626_0029803 3300048091 Bacteria 2636
468 Ga0495626_0031819 3300048091 Bacteria 2536
469 Ga0495626_0093868 3300048091 Bacteria 1316
470 Ga0495626_0132843 3300048091 Bacteria 1061
471 Ga0495626_0431675 3300048091 Unclassified 507
472 Ga0496100_0779781 3300048903 Bacteria 748
473 Ga0496100_0932837 3300048903 Bacteria 682
474 Ga0496100_1209615 3300048903 Bacteria 596
475 Ga0496101_0069505 3300048904 Bacteria 2577
476 Ga0496101_0287719 3300048904 Bacteria 1285
477 Ga0496101_1051321 3300048904 Bacteria 640
478 Ga0496102_0146256 3300048905 Bacteria 2218
479 Ga0496102_0233379 3300048905 Bacteria 1734
480 Ga0496103_0706720 3300048906 Bacteria 639
481 Ga0496103_0961040 3300048906 Bacteria 533
482 Ga0496104_0100373 3300048907 Bacteria 2771
483 Ga0496104_0116271 3300048907 Bacteria 2567
484 Ga0496105_0404242 3300048908 Bacteria 1084
485 Ga0496106_0017107 3300048909 Bacteria 5367
486 Ga0496107_0027276 3300048910 Bacteria 4055
487 Ga0496107_0193567 3300048910 Bacteria 1511
488 Ga0496108_0201426 3300048911 Bacteria 1728
489 Ga0496109_0614689 3300048912 Bacteria 1023
490 Ga0496110_0566541 3300048913 Bacteria 1032
491 Ga0496112_0523151 3300048915 Bacteria 1121
492 Ga0496113_0242560 3300048916 Bacteria 1438
493 Ga0496113_0508412 3300048916 Bacteria 967
494 Ga0496115_0044126 3300048918 Bacteria 3555
495 Ga0496121_0170826 3300048924 Bacteria 1580
496 Ga0496122_0002477 3300048925 Bacteria 26088
497 Ga0496122_0044266 3300048925 Bacteria 3476
498 Ga0496123_0004015 3300048926 Bacteria 15906
499 Ga0496123_0043899 3300048926 Bacteria 3063
500 Ga0496124_0016398 3300048927 Bacteria 7046
501 Ga0496124_0028356 3300048927 Bacteria 5009
502 Ga0496124_0102762 3300048927 Bacteria 2312
503 Ga0496124_0119282 3300048927 Bacteria 2110
504 Ga0496126_0549440 3300048929 Bacteria 917
505 Ga0501308_076493 3300049128 Bacteria 527
506 Ga0495678_002349 3300049459 Bacteria 13005
507 Ga0495678_017958 3300049459 Bacteria 3191
508 Ga0495678_031768 3300049459 Bacteria 2197
509 Ga0495682_0298017 3300049460 Unclassified 569
510 Ga0501315_065541 3300049531 Bacteria 594
511 Ga0501034_0037485 3300049571 Bacteria 4910
512 Ga0501036_0177267 3300049572 Bacteria 1795
513 Ga0501047_0130473 3300049581 Bacteria 2394
514 Ga0501222_082320 3300049662 Bacteria 514
515 Ga0501227_002017 3300049665 Bacteria 4505
516 Ga0501234_082654 3300049707 Bacteria 568
517 Ga0501245_126373 3300049708 Unclassified 544
518 Ga0501263_019980 3300049760 Bacteria 896
519 Ga0501279_000538 3300049775 Bacteria 4961
520 Ga0501279_001190 3300049775 Bacteria 3422
521 Ga0501035_0002946 3300049822 Bacteria 16379
522 Ga0501044_0111858 3300049823 Bacteria 2738
523 Ga0587083_0141865 3300059505 Bacteria 641
524 Ga0587088_003302 3300059508 Bacteria 1941
525 Ga0466962_0195860 3300061719 Bacteria 986
526 Ga0466962_0252091 3300061719 Bacteria 867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221646 2644259547 90
2 3300003794 Ga0055531_10112065 Ga0055531_101120651 94
3 3300028794 Ga0307515_10074419 Ga0307515_100744193 94
4 3300046615 Ga0495656_0469017 Ga0495656_0469017_12_308 94
5 3300039447 Ga0436361_0356959 Ga0436361_0356959_1792_2085 96
6 3300039447 Ga0436361_1176958 Ga0436361_1176958_1058_1351 96
7 3300046457 Ga0495590_0272990 Ga0495590_0272990_14_316 98
8 3300046460 Ga0495638_0358721 Ga0495638_0358721_455_757 98
9 3300046474 Ga0495605_0004465 Ga0495605_0004465_6871_7185 98
10 3300046474 Ga0495605_0024663 Ga0495605_0024663_2163_2477 98
11 3300046474 Ga0495605_0028557 Ga0495605_0028557_2374_2688 98
12 3300046474 Ga0495605_0237437 Ga0495605_0237437_455_757 98
13 3300046491 Ga0495584_0010689 Ga0495584_0010689_3456_3770 98
14 3300046491 Ga0495584_0016990 Ga0495584_0016990_3122_3424 98
15 3300046492 Ga0495585_0228679 Ga0495585_0228679_196_510 98
16 3300046500 Ga0495596_0098226 Ga0495596_0098226_627_941 98
17 3300046501 Ga0495607_0007409 Ga0495607_0007409_2695_3009 98
18 3300046501 Ga0495607_0033031 Ga0495607_0033031_1034_1336 98
19 3300046506 Ga0495583_0000191 Ga0495583_0000191_52499_52813 98
20 3300046506 Ga0495583_0008534 Ga0495583_0008534_5731_6033 98
21 3300046513 Ga0495616_0005915 Ga0495616_0005915_3755_4057 98
22 3300046513 Ga0495616_0130777 Ga0495616_0130777_537_851 98
23 3300046518 Ga0495631_0017000 Ga0495631_0017000_2378_2692 98
24 3300046519 Ga0495632_0014585 Ga0495632_0014585_445_759 98
25 3300046528 Ga0495642_0010466 Ga0495642_0010466_2853_3167 98
26 3300046538 Ga0495609_0001077 Ga0495609_0001077_1582_1884 98
27 3300046538 Ga0495609_0052480 Ga0495609_0052480_1163_1477 98
28 3300046542 Ga0495597_0110929 Ga0495597_0110929_504_818 98
29 3300046558 Ga0495633_0008961 Ga0495633_0008961_2113_2427 98
30 3300046616 Ga0495668_0059320 Ga0495668_0059320_1338_1652 98
31 3300046616 Ga0495668_0315980 Ga0495668_0315980_207_509 98
32 3300046648 Ga0495611_0032471 Ga0495611_0032471_330_644 98
33 3300046660 Ga0495625_0084696 Ga0495625_0084696_1034_1336 98
34 3300046660 Ga0495625_0464490 Ga0495625_0464490_76_378 98
35 3300046664 Ga0495659_0198296 Ga0495659_0198296_175_477 98
36 3300046665 Ga0495661_0065353 Ga0495661_0065353_1113_1427 98
37 3300046684 Ga0495669_0000922 Ga0495669_0000922_2289_2591 98
38 3300046684 Ga0495669_0059292 Ga0495669_0059292_688_1002 98
39 3300046691 Ga0495670_0052552 Ga0495670_0052552_1706_2014 98
40 3300046694 Ga0495649_0032484 Ga0495649_0032484_905_1207 98
41 3300046794 Ga0495589_0026838 Ga0495589_0026838_587_901 98
42 3300046810 Ga0495660_0006344 Ga0495660_0006344_6195_6509 98
43 3300046810 Ga0495660_0079897 Ga0495660_0079897_227_529 98
44 3300047318 Ga0495636_0094902 Ga0495636_0094902_220_522 98
45 3300047320 Ga0495672_0074406 Ga0495672_0074406_363_677 98
46 3300047320 Ga0495672_0197380 Ga0495672_0197380_577_891 98
47 3300047323 Ga0495683_0005975 Ga0495683_0005975_1831_2145 98
48 3300047443 Ga0495687_029218 Ga0495687_029218_652_954 98
49 3300047445 Ga0495677_0043560 Ga0495677_0043560_165_479 98
50 3300047446 Ga0495679_003055 Ga0495679_003055_1045_1359 98
51 3300047447 Ga0495685_012312 Ga0495685_012312_906_1208 98
52 3300047470 Ga0495681_0008050 Ga0495681_0008050_4762_5064 98
53 3300047470 Ga0495681_0089617 Ga0495681_0089617_454_768 98
54 3300048091 Ga0495626_0011856 Ga0495626_0011856_590_904 98
55 3300048091 Ga0495626_0093868 Ga0495626_0093868_255_569 98
56 3300049459 Ga0495678_017958 Ga0495678_017958_583_897 98
57 iso_pu_bacteria 2643221556 2643801362 98
58 iso_pu_bacteria 2643221684 2644472676 98
59 iso_pu_bacteria 2808606418 2809142263 98
60 iso_pu_bacteria 8047673197 8047675143 98
61 3300046507 Ga0495606_0000190 Ga0495606_0000190_95565_95882 99
62 3300049459 Ga0495678_031768 Ga0495678_031768_1522_1830 99
63 iso_pu_bacteria 2643221554 2643788168 99
64 iso_pu_bacteria 2643221638 2644216229 99
65 3300025295 Ga0209564_1013433 Ga0209564_10134333 100
66 3300046471 Ga0495650_0007621 Ga0495650_0007621_5134_5469 100
67 3300048091 Ga0495626_0431675 Ga0495626_0431675_164_475 100
68 3300049459 Ga0495678_002349 Ga0495678_002349_3658_3987 100
69 3300021361 Ga0213872_10001281 Ga0213872_100012818 101
70 3300021361 Ga0213872_10092168 Ga0213872_100921682 101
71 3300032002 Ga0307416_100096436 Ga0307416_1000964361 101
72 3300032005 Ga0307411_11281730 Ga0307411_112817301 101
73 3300044706 Ga0466964_0066681 Ga0466964_0066681_960_1277 101
74 3300046471 Ga0495650_0000152 Ga0495650_0000152_129830_130156 101
75 3300046475 Ga0495639_0365111 Ga0495639_0365111_46_354 101
76 3300046499 Ga0495594_0137228 Ga0495594_0137228_523_831 101
77 3300046501 Ga0495607_0001075 Ga0495607_0001075_17089_17406 101
78 3300046513 Ga0495616_0010267 Ga0495616_0010267_2978_3295 101
79 3300046519 Ga0495632_0005534 Ga0495632_0005534_2731_3048 101
80 3300046522 Ga0495643_0015173 Ga0495643_0015173_1118_1435 101
81 3300046665 Ga0495661_0035230 Ga0495661_0035230_244_561 101
82 3300046674 Ga0495588_0186940 Ga0495588_0186940_137_445 101
83 3300047320 Ga0495672_0370670 Ga0495672_0370670_281_598 101
84 3300047445 Ga0495677_0005200 Ga0495677_0005200_2865_3182 101
85 3300048091 Ga0495626_0029803 Ga0495626_0029803_332_649 101
86 3300003322 rootL2_10019282 rootL2_100192822 102
87 3300003322 rootL2_10060538 rootL2_100605382 102
88 3300003575 Ga0007409J51694_1098955 Ga0007409J51694_10989552 102
89 3300003759 Ga0055525_1000074 Ga0055525_100007484 102
90 3300003762 Ga0055542_1023166 Ga0055542_10231662 102
91 3300005327 Ga0070658_10092863 Ga0070658_100928632 102
92 3300005328 Ga0070676_10387486 Ga0070676_103874862 102
93 3300005334 Ga0068869_100501763 Ga0068869_1005017631 102
94 3300005339 Ga0070660_100033746 Ga0070660_1000337464 102
95 3300005339 Ga0070660_100224456 Ga0070660_1002244561 102
96 3300005339 Ga0070660_100483038 Ga0070660_1004830381 102
97 3300005344 Ga0070661_100202420 Ga0070661_1002024202 102
98 3300005356 Ga0070674_100590833 Ga0070674_1005908332 102
99 3300005366 Ga0070659_100033434 Ga0070659_1000334342 102
100 3300005455 Ga0070663_101754588 Ga0070663_1017545881 102
101 3300005457 Ga0070662_100219118 Ga0070662_1002191182 102
102 3300005457 Ga0070662_100886968 Ga0070662_1008869682 102
103 3300005457 Ga0070662_101346802 Ga0070662_1013468022 102
104 3300005459 Ga0068867_100218056 Ga0068867_1002180562 102
105 3300005530 Ga0070679_101581391 Ga0070679_1015813911 102
106 3300005539 Ga0068853_101225756 Ga0068853_1012257562 102
107 3300005563 Ga0068855_100449311 Ga0068855_1004493112 102
108 3300005563 Ga0068855_100973616 Ga0068855_1009736162 102
109 3300006881 Ga0068865_100137715 Ga0068865_1001377152 102
110 3300009036 Ga0105244_10099500 Ga0105244_100995002 102
111 3300009093 Ga0105240_11044279 Ga0105240_110442792 102
112 3300009098 Ga0105245_10278261 Ga0105245_102782612 102
113 3300009148 Ga0105243_10033568 Ga0105243_100335683 102
114 3300009174 Ga0105241_10018687 Ga0105241_100186873 102
115 3300009176 Ga0105242_10023888 Ga0105242_100238882 102
116 3300009545 Ga0105237_10539999 Ga0105237_105399992 102
117 3300009551 Ga0105238_11417503 Ga0105238_114175031 102
118 3300010375 Ga0105239_10653362 Ga0105239_106533621 102
119 3300011119 Ga0105246_12315376 Ga0105246_123153762 102
120 3300013100 Ga0157373_10405866 Ga0157373_104058662 102
121 3300013102 Ga0157371_10648272 Ga0157371_106482722 102
122 3300013104 Ga0157370_10829191 Ga0157370_108291911 102
123 3300013105 Ga0157369_12278918 Ga0157369_122789181 102
124 3300013296 Ga0157374_10637473 Ga0157374_106374732 102
125 3300013297 Ga0157378_10333530 Ga0157378_103335302 102
126 3300013307 Ga0157372_10481364 Ga0157372_104813642 102
127 3300013307 Ga0157372_10778080 Ga0157372_107780802 102
128 3300014969 Ga0157376_10623227 Ga0157376_106232272 102
129 3300015262 Ga0182007_10167136 Ga0182007_101671362 102
130 3300025230 Ga0209563_100003 Ga0209563_10000382 102
131 3300025253 Ga0209677_102572 Ga0209677_1025722 102
132 3300025254 Ga0209148_1001147 Ga0209148_10011479 102
133 3300025909 Ga0207705_10219966 Ga0207705_102199662 102
134 3300025909 Ga0207705_11204905 Ga0207705_112049051 102
135 3300025911 Ga0207654_10016799 Ga0207654_100167992 102
136 3300025913 Ga0207695_11120719 Ga0207695_111207192 102
137 3300025919 Ga0207657_10003340 Ga0207657_100033408 102
138 3300025919 Ga0207657_10296693 Ga0207657_102966932 102
139 3300025927 Ga0207687_10213232 Ga0207687_102132322 102
140 3300025932 Ga0207690_10014816 Ga0207690_100148163 102
141 3300025932 Ga0207690_10272973 Ga0207690_102729732 102
142 3300025932 Ga0207690_10613779 Ga0207690_106137792 102
143 3300025933 Ga0207706_10045057 Ga0207706_100450573 102
144 3300025933 Ga0207706_10616712 Ga0207706_106167122 102
145 3300025933 Ga0207706_10872586 Ga0207706_108725862 102
146 3300025934 Ga0207686_10090685 Ga0207686_100906852 102
147 3300025935 Ga0207709_10098532 Ga0207709_100985322 102
148 3300025938 Ga0207704_10114797 Ga0207704_101147972 102
149 3300025942 Ga0207689_10565026 Ga0207689_105650262 102
150 3300025949 Ga0207667_10058209 Ga0207667_100582092 102
151 3300025949 Ga0207667_11330027 Ga0207667_113300272 102
152 3300026041 Ga0207639_11883619 Ga0207639_118836192 102
153 3300026067 Ga0207678_10744540 Ga0207678_107445402 102
154 3300026078 Ga0207702_10191796 Ga0207702_101917962 102
155 3300026089 Ga0207648_10343174 Ga0207648_103431742 102
156 3300026142 Ga0207698_10167027 Ga0207698_101670272 102
157 3300031548 Ga0307408_101107160 Ga0307408_1011071602 102
158 3300031711 Ga0265314_10055456 Ga0265314_100554562 102
159 3300037312 Ga0395899_0002600 Ga0395899_0002600_13555_13875 102
160 3300037312 Ga0395899_0007727 Ga0395899_0007727_4489_4800 102
161 3300037312 Ga0395899_0050353 Ga0395899_0050353_2523_2843 102
162 3300037312 Ga0395899_0253595 Ga0395899_0253595_416_736 102
163 3300037312 Ga0395899_0683274 Ga0395899_0683274_144_464 102
164 3300037312 Ga0395899_0996990 Ga0395899_0996990_59_379 102
165 3300037418 Ga0395900_0000338 Ga0395900_0000338_2236_2544 102
166 3300037418 Ga0395900_0009793 Ga0395900_0009793_67_378 102
167 3300037418 Ga0395900_0013761 Ga0395900_0013761_4502_4813 102
168 3300037418 Ga0395900_0022377 Ga0395900_0022377_5643_5963 102
169 3300037418 Ga0395900_0061625 Ga0395900_0061625_717_1037 102
170 3300037418 Ga0395900_0151448 Ga0395900_0151448_120_440 102
171 3300037418 Ga0395900_0257360 Ga0395900_0257360_1032_1352 102
172 3300037418 Ga0395900_1869576 Ga0395900_1869576_92_403 102
173 3300037466 Ga0395898_0036327 Ga0395898_0036327_4201_4512 102
174 3300037466 Ga0395898_0225705 Ga0395898_0225705_280_600 102
175 3300037466 Ga0395898_0299718 Ga0395898_0299718_712_1032 102
176 3300037466 Ga0395898_0533330 Ga0395898_0533330_695_1015 102
177 3300037466 Ga0395898_0655160 Ga0395898_0655160_232_552 102
178 3300037466 Ga0395898_0707013 Ga0395898_0707013_509_820 102
179 3300037471 Ga0395905_0105847 Ga0395905_0105847_840_1160 102
180 3300037471 Ga0395905_0177616 Ga0395905_0177616_1571_1891 102
181 3300037471 Ga0395905_0201373 Ga0395905_0201373_657_968 102
182 3300037471 Ga0395905_0249136 Ga0395905_0249136_744_1055 102
183 3300037471 Ga0395905_0266716 Ga0395905_0266716_1223_1534 102
184 3300037471 Ga0395905_0548569 Ga0395905_0548569_440_760 102
185 3300037471 Ga0395905_1214611 Ga0395905_1214611_88_408 102
186 3300037471 Ga0395905_1503124 Ga0395905_1503124_130_438 102
187 3300038443 Ga0395901_0001241 Ga0395901_0001241_25413_25721 102
188 3300038443 Ga0395901_0012316 Ga0395901_0012316_3509_3820 102
189 3300038443 Ga0395901_0067924 Ga0395901_0067924_1106_1426 102
190 3300038443 Ga0395901_0370927 Ga0395901_0370927_877_1197 102
191 3300038443 Ga0395901_0384498 Ga0395901_0384498_916_1227 102
192 3300038443 Ga0395901_0405804 Ga0395901_0405804_261_572 102
193 3300038443 Ga0395901_0446399 Ga0395901_0446399_136_456 102
194 3300038443 Ga0395901_0573779 Ga0395901_0573779_638_949 102
195 3300038443 Ga0395901_1428835 Ga0395901_1428835_190_510 102
196 3300041413 Ga0439465_0116376 Ga0439465_0116376_96_404 102
197 3300041999 Ga0439433_0054021 Ga0439433_0054021_52_360 102
198 3300042005 Ga0439448_0002056 Ga0439448_0002056_1543_1851 102
199 3300042006 Ga0439432_142741 Ga0439432_142741_30_338 102
200 3300042007 Ga0439449_0012190 Ga0439449_0012190_2482_2790 102
201 3300042008 Ga0439450_025658 Ga0439450_025658_862_1170 102
202 3300042012 Ga0439455_0009383 Ga0439455_0009383_770_1078 102
203 3300042012 Ga0439455_0050474 Ga0439455_0050474_658_978 102
204 3300042115 Ga0450911_012230 Ga0450911_012230_313_621 102
205 3300042157 Ga0439458_0032129 Ga0439458_0032129_802_1113 102
206 3300044656 Ga0466969_0071096 Ga0466969_0071096_165_485 102
207 3300044656 Ga0466969_0086093 Ga0466969_0086093_937_1245 102
208 3300044656 Ga0466969_0413686 Ga0466969_0413686_285_593 102
209 3300044658 Ga0466972_0011790 Ga0466972_0011790_1579_1887 102
210 3300044658 Ga0466972_0051078 Ga0466972_0051078_1568_1879 102
211 3300044658 Ga0466972_0143862 Ga0466972_0143862_703_1023 102
212 3300044658 Ga0466972_0222009 Ga0466972_0222009_560_868 102
213 3300044683 Ga0466965_0012874 Ga0466965_0012874_3405_3713 102
214 3300044683 Ga0466965_0034155 Ga0466965_0034155_1191_1502 102
215 3300044683 Ga0466965_0081171 Ga0466965_0081171_443_751 102
216 3300044683 Ga0466965_0278633 Ga0466965_0278633_266_586 102
217 3300044684 Ga0466966_0004652 Ga0466966_0004652_3721_4029 102
218 3300044684 Ga0466966_0026466 Ga0466966_0026466_1862_2173 102
219 3300044684 Ga0466966_0032802 Ga0466966_0032802_262_570 102
220 3300044684 Ga0466966_0320427 Ga0466966_0320427_176_484 102
221 3300044693 Ga0466961_0316237 Ga0466961_0316237_16_324 102
222 3300044693 Ga0466961_0957025 Ga0466961_0957025_172_480 102
223 3300044694 Ga0466963_0118780 Ga0466963_0118780_255_566 102
224 3300044706 Ga0466964_0000146 Ga0466964_0000146_398_706 102
225 3300044706 Ga0466964_0001295 Ga0466964_0001295_4133_4441 102
226 3300044719 Ga0466971_0044929 Ga0466971_0044929_254_562 102
227 3300044719 Ga0466971_0059439 Ga0466971_0059439_733_1053 102
228 3300044719 Ga0466971_0295345 Ga0466971_0295345_175_483 102
229 3300044735 Ga0466968_0001147 Ga0466968_0001147_3781_4089 102
230 3300044735 Ga0466968_0216776 Ga0466968_0216776_358_678 102
231 3300044765 Ga0466970_0318309 Ga0466970_0318309_116_424 102
232 3300044765 Ga0466970_0672482 Ga0466970_0672482_279_587 102
233 3300044765 Ga0466970_0925341 Ga0466970_0925341_66_386 102
234 3300044842 Ga0466957_0000022 Ga0466957_0000022_40727_41038 102
235 3300044842 Ga0466957_0039216 Ga0466957_0039216_173_481 102
236 3300044842 Ga0466957_0479081 Ga0466957_0479081_188_496 102
237 3300045049 Ga0466959_0076232 Ga0466959_0076232_758_1066 102
238 3300045049 Ga0466959_0093590 Ga0466959_0093590_598_918 102
239 3300045049 Ga0466959_0123764 Ga0466959_0123764_1494_1802 102
240 3300045049 Ga0466959_0132055 Ga0466959_0132055_829_1140 102
241 3300045836 Ga0466958_0028816 Ga0466958_0028816_2129_2449 102
242 3300045836 Ga0466958_0179701 Ga0466958_0179701_274_585 102
243 3300045836 Ga0466958_0572329 Ga0466958_0572329_44_364 102
244 3300045836 Ga0466958_0736902 Ga0466958_0736902_167_475 102
245 3300045836 Ga0466958_0757176 Ga0466958_0757176_168_476 102
246 3300045976 Ga0466967_0000530 Ga0466967_0000530_12810_13118 102
247 3300045976 Ga0466967_0047208 Ga0466967_0047208_1726_2037 102
248 3300045976 Ga0466967_0127094 Ga0466967_0127094_1845_2165 102
249 3300045976 Ga0466967_1761060 Ga0466967_1761060_120_428 102
250 3300046457 Ga0495590_0000180 Ga0495590_0000180_11640_11951 102
251 3300046471 Ga0495650_0000109 Ga0495650_0000109_17084_17398 102
252 3300046474 Ga0495605_0007843 Ga0495605_0007843_2777_3085 102
253 3300046491 Ga0495584_0001552 Ga0495584_0001552_2973_3281 102
254 3300046491 Ga0495584_0004823 Ga0495584_0004823_6788_7096 102
255 3300046491 Ga0495584_0543975 Ga0495584_0543975_145_456 102
256 3300046501 Ga0495607_0024766 Ga0495607_0024766_375_683 102
257 3300046501 Ga0495607_0086734 Ga0495607_0086734_1320_1628 102
258 3300046507 Ga0495606_0001538 Ga0495606_0001538_16000_16314 102
259 3300046507 Ga0495606_0033737 Ga0495606_0033737_3080_3388 102
260 3300046507 Ga0495606_0049960 Ga0495606_0049960_973_1284 102
261 3300046507 Ga0495606_0222604 Ga0495606_0222604_258_566 102
262 3300046513 Ga0495616_0008061 Ga0495616_0008061_5210_5518 102
263 3300046520 Ga0495637_0249668 Ga0495637_0249668_41_349 102
264 3300046522 Ga0495643_0430204 Ga0495643_0430204_256_564 102
265 3300046524 Ga0495648_0005153 Ga0495648_0005153_7348_7656 102
266 3300046528 Ga0495642_0000193 Ga0495642_0000193_8181_8489 102
267 3300046528 Ga0495642_0341967 Ga0495642_0341967_157_465 102
268 3300046538 Ga0495609_0000026 Ga0495609_0000026_221637_221945 102
269 3300046665 Ga0495661_0000913 Ga0495661_0000913_6325_6633 102
270 3300046665 Ga0495661_0011394 Ga0495661_0011394_2322_2630 102
271 3300046665 Ga0495661_0041278 Ga0495661_0041278_2516_2824 102
272 3300046665 Ga0495661_0170023 Ga0495661_0170023_641_949 102
273 3300046665 Ga0495661_0450563 Ga0495661_0450563_255_563 102
274 3300046674 Ga0495588_0000140 Ga0495588_0000140_85047_85355 102
275 3300046694 Ga0495649_0247743 Ga0495649_0247743_566_874 102
276 3300046694 Ga0495649_0263670 Ga0495649_0263670_277_588 102
277 3300046794 Ga0495589_0000337 Ga0495589_0000337_6350_6658 102
278 3300046810 Ga0495660_0106469 Ga0495660_0106469_317_625 102
279 3300047443 Ga0495687_000037 Ga0495687_000037_221637_221945 102
280 3300047443 Ga0495687_000155 Ga0495687_000155_49609_49917 102
281 3300047445 Ga0495677_0000130 Ga0495677_0000130_6348_6656 102
282 3300048091 Ga0495626_0000327 Ga0495626_0000327_33989_34297 102
283 3300048903 Ga0496100_0779781 Ga0496100_0779781_134_454 102
284 3300048903 Ga0496100_0932837 Ga0496100_0932837_353_664 102
285 3300048903 Ga0496100_1209615 Ga0496100_1209615_12_332 102
286 3300048904 Ga0496101_0069505 Ga0496101_0069505_801_1121 102
287 3300048904 Ga0496101_0287719 Ga0496101_0287719_849_1157 102
288 3300048904 Ga0496101_1051321 Ga0496101_1051321_302_622 102
289 3300048905 Ga0496102_0146256 Ga0496102_0146256_1850_2170 102
290 3300048905 Ga0496102_0233379 Ga0496102_0233379_813_1133 102
291 3300048906 Ga0496103_0706720 Ga0496103_0706720_17_337 102
292 3300048906 Ga0496103_0961040 Ga0496103_0961040_129_440 102
293 3300048907 Ga0496104_0100373 Ga0496104_0100373_408_719 102
294 3300048907 Ga0496104_0116271 Ga0496104_0116271_657_977 102
295 3300048908 Ga0496105_0404242 Ga0496105_0404242_107_427 102
296 3300048909 Ga0496106_0017107 Ga0496106_0017107_3256_3576 102
297 3300048910 Ga0496107_0027276 Ga0496107_0027276_602_922 102
298 3300048910 Ga0496107_0193567 Ga0496107_0193567_872_1192 102
299 3300048911 Ga0496108_0201426 Ga0496108_0201426_360_680 102
300 3300048912 Ga0496109_0614689 Ga0496109_0614689_494_817 102
301 3300048913 Ga0496110_0566541 Ga0496110_0566541_399_710 102
302 3300048916 Ga0496113_0242560 Ga0496113_0242560_305_616 102
303 3300048916 Ga0496113_0508412 Ga0496113_0508412_589_900 102
304 3300048924 Ga0496121_0170826 Ga0496121_0170826_608_916 102
305 3300048925 Ga0496122_0002477 Ga0496122_0002477_10406_10729 102
306 3300048925 Ga0496122_0044266 Ga0496122_0044266_218_526 102
307 3300048926 Ga0496123_0004015 Ga0496123_0004015_8832_9140 102
308 3300048926 Ga0496123_0043899 Ga0496123_0043899_1125_1448 102
309 3300048927 Ga0496124_0016398 Ga0496124_0016398_1678_1998 102
310 3300048927 Ga0496124_0102762 Ga0496124_0102762_920_1228 102
311 3300048927 Ga0496124_0119282 Ga0496124_0119282_1576_1884 102
312 3300048929 Ga0496126_0549440 Ga0496126_0549440_547_855 102
313 3300049128 Ga0501308_076493 Ga0501308_076493_27_335 102
314 3300049571 Ga0501034_0037485 Ga0501034_0037485_3660_3968 102
315 3300049572 Ga0501036_0177267 Ga0501036_0177267_1232_1540 102
316 3300049581 Ga0501047_0130473 Ga0501047_0130473_1177_1485 102
317 3300049822 Ga0501035_0002946 Ga0501035_0002946_10010_10318 102
318 3300049823 Ga0501044_0111858 Ga0501044_0111858_677_985 102
319 3300059505 Ga0587083_0141865 Ga0587083_0141865_98_409 102
320 3300059508 Ga0587088_003302 Ga0587088_003302_585_893 102
321 3300061719 Ga0466962_0195860 Ga0466962_0195860_96_404 102
322 3300061719 Ga0466962_0252091 Ga0466962_0252091_431_751 102
323 3300002739 JGI25158J39367_1002522 JGI25158J39367_10025222 103
324 3300002739 JGI25158J39367_1025476 JGI25158J39367_10254762 103
325 3300002773 JGI25152J39213_1000200 JGI25152J39213_100020034 103
326 3300002773 JGI25152J39213_1000212 JGI25152J39213_100021231 103
327 3300002773 JGI25152J39213_1011176 JGI25152J39213_10111762 103
328 3300002774 JGI25150J39212_1000124 JGI25150J39212_100012431 103
329 3300002774 JGI25150J39212_1006104 JGI25150J39212_10061042 103
330 3300002987 JGI25159J45721_1000149 JGI25159J45721_10001496 103
331 3300002987 JGI25159J45721_1003350 JGI25159J45721_10033502 103
332 3300003215 JGI25153J46596_10001715 JGI25153J46596_1000171510 103
333 3300003354 JGI25160J50197_1002663 JGI25160J50197_10026632 103
334 3300003374 JGI25161J50226_1000249 JGI25161J50226_100024935 103
335 3300003374 JGI25161J50226_1002440 JGI25161J50226_10024402 103
336 3300003771 Ga0055526_1001603 Ga0055526_10016036 103
337 3300003771 Ga0055526_1004898 Ga0055526_10048983 103
338 3300003775 Ga0055524_1001700 Ga0055524_100170012 103
339 3300003775 Ga0055524_1001710 Ga0055524_10017103 103
340 3300003775 Ga0055524_1001782 Ga0055524_10017823 103
341 3300003784 Ga0055534_1040853 Ga0055534_10408532 103
342 3300003790 Ga0055528_1012631 Ga0055528_10126312 103
343 3300003791 Ga0055530_10000569 Ga0055530_1000056914 103
344 3300003791 Ga0055530_10085031 Ga0055530_100850311 103
345 3300003794 Ga0055531_10004579 Ga0055531_100045794 103
346 3300003794 Ga0055531_10012420 Ga0055531_100124201 103
347 3300004625 Ga0055543_1000154 Ga0055543_100015428 103
348 3300005262 Ga0065165_1000571 Ga0065165_100057127 103
349 3300013307 Ga0157372_10898581 Ga0157372_108985812 103
350 3300025208 Ga0209436_100090 Ga0209436_10009014 103
351 3300025208 Ga0209436_100848 Ga0209436_1008482 103
352 3300025245 Ga0207425_1000017 Ga0207425_1000017203 103
353 3300025245 Ga0207425_1000341 Ga0207425_100034111 103
354 3300025258 Ga0209129_1000039 Ga0209129_1000039196 103
355 3300025258 Ga0209129_1000088 Ga0209129_100008888 103
356 3300025258 Ga0209129_1003144 Ga0209129_100314410 103
357 3300025258 Ga0209129_1010216 Ga0209129_10102163 103
358 3300025263 Ga0209565_1000941 Ga0209565_100094114 103
359 3300025263 Ga0209565_1001333 Ga0209565_10013337 103
360 3300025263 Ga0209565_1002908 Ga0209565_10029083 103
361 3300025263 Ga0209565_1007403 Ga0209565_10074031 103
362 3300025273 Ga0209673_1010685 Ga0209673_10106853 103
363 3300025284 Ga0209130_1000350 Ga0209130_100035032 103
364 3300025284 Ga0209130_1002389 Ga0209130_100238911 103
365 3300025291 Ga0209675_1001225 Ga0209675_100122513 103
366 3300025291 Ga0209675_1001968 Ga0209675_10019684 103
367 3300025295 Ga0209564_1000626 Ga0209564_100062629 103
368 3300025295 Ga0209564_1003337 Ga0209564_100333713 103
369 3300025297 Ga0209758_1000137 Ga0209758_1000137100 103
370 3300025298 Ga0209050_1000598 Ga0209050_100059832 103
371 3300025298 Ga0209050_1003499 Ga0209050_10034992 103
372 3300025299 Ga0209256_1000189 Ga0209256_100018990 103
373 3300025299 Ga0209256_1001876 Ga0209256_100187619 103
374 3300025299 Ga0209256_1004802 Ga0209256_100480210 103
375 3300025302 Ga0207426_1002427 Ga0207426_100242711 103
376 3300025303 Ga0209051_1026404 Ga0209051_10264042 103
377 3300025304 Ga0209257_1000355 Ga0209257_100035571 103
378 3300031548 Ga0307408_100000604 Ga0307408_10000060435 103
379 3300031548 Ga0307408_100001681 Ga0307408_10000168117 103
380 3300031548 Ga0307408_100002462 Ga0307408_1000024626 103
381 3300031548 Ga0307408_100016587 Ga0307408_1000165875 103
382 3300031548 Ga0307408_101355783 Ga0307408_1013557832 103
383 3300042139 Ga0450904_000249 Ga0450904_000249_4738_5049 103
384 3300044842 Ga0466957_0004698 Ga0466957_0004698_1052_1375 103
385 3300046452 Ga0495617_001238 Ga0495617_001238_3897_4208 103
386 3300046452 Ga0495617_055388 Ga0495617_055388_484_795 103
387 3300046453 Ga0495627_005200 Ga0495627_005200_4887_5198 103
388 3300046455 Ga0495603_0320364 Ga0495603_0320364_281_595 103
389 3300046460 Ga0495638_0004695 Ga0495638_0004695_6060_6371 103
390 3300046463 Ga0495653_0048307 Ga0495653_0048307_1882_2196 103
391 3300046472 Ga0495580_0102173 Ga0495580_0102173_688_1002 103
392 3300046473 Ga0495582_0000647 Ga0495582_0000647_8110_8424 103
393 3300046474 Ga0495605_0020960 Ga0495605_0020960_1735_2046 103
394 3300046474 Ga0495605_0034135 Ga0495605_0034135_29_340 103
395 3300046474 Ga0495605_0080367 Ga0495605_0080367_924_1262 103
396 3300046474 Ga0495605_0081459 Ga0495605_0081459_670_981 103
397 3300046474 Ga0495605_0137151 Ga0495605_0137151_464_775 103
398 3300046474 Ga0495605_0272991 Ga0495605_0272991_220_531 103
399 3300046491 Ga0495584_0028000 Ga0495584_0028000_28_339 103
400 3300046491 Ga0495584_0041421 Ga0495584_0041421_426_737 103
401 3300046491 Ga0495584_0087241 Ga0495584_0087241_239_550 103
402 3300046491 Ga0495584_0152642 Ga0495584_0152642_37_348 103
403 3300046492 Ga0495585_0001768 Ga0495585_0001768_3897_4208 103
404 3300046492 Ga0495585_0007460 Ga0495585_0007460_6037_6348 103
405 3300046492 Ga0495585_0008151 Ga0495585_0008151_3114_3425 103
406 3300046492 Ga0495585_0009868 Ga0495585_0009868_4537_4848 103
407 3300046492 Ga0495585_0116437 Ga0495585_0116437_892_1206 103
408 3300046500 Ga0495596_0001264 Ga0495596_0001264_1464_1775 103
409 3300046500 Ga0495596_0003778 Ga0495596_0003778_47_358 103
410 3300046500 Ga0495596_0038446 Ga0495596_0038446_299_610 103
411 3300046500 Ga0495596_0058203 Ga0495596_0058203_774_1085 103
412 3300046500 Ga0495596_0119435 Ga0495596_0119435_611_922 103
413 3300046501 Ga0495607_0173966 Ga0495607_0173966_79_390 103
414 3300046501 Ga0495607_0367274 Ga0495607_0367274_37_348 103
415 3300046506 Ga0495583_0007453 Ga0495583_0007453_734_1045 103
416 3300046506 Ga0495583_0108477 Ga0495583_0108477_204_515 103
417 3300046506 Ga0495583_0163723 Ga0495583_0163723_309_623 103
418 3300046507 Ga0495606_0196568 Ga0495606_0196568_598_912 103
419 3300046513 Ga0495616_0000525 Ga0495616_0000525_19990_20301 103
420 3300046513 Ga0495616_0057285 Ga0495616_0057285_50_361 103
421 3300046513 Ga0495616_0198381 Ga0495616_0198381_438_749 103
422 3300046517 Ga0495630_0185840 Ga0495630_0185840_559_873 103
423 3300046518 Ga0495631_0006913 Ga0495631_0006913_2006_2317 103
424 3300046518 Ga0495631_0025793 Ga0495631_0025793_1670_1981 103
425 3300046518 Ga0495631_0069855 Ga0495631_0069855_1190_1501 103
426 3300046520 Ga0495637_0139691 Ga0495637_0139691_307_651 103
427 3300046522 Ga0495643_0007245 Ga0495643_0007245_6697_7041 103
428 3300046522 Ga0495643_0070023 Ga0495643_0070023_11_322 103
429 3300046523 Ga0495644_0011210 Ga0495644_0011210_2238_2549 103
430 3300046524 Ga0495648_0001254 Ga0495648_0001254_3821_4132 103
431 3300046524 Ga0495648_0421636 Ga0495648_0421636_61_372 103
432 3300046525 Ga0495663_0007083 Ga0495663_0007083_544_855 103
433 3300046526 Ga0495666_0004086 Ga0495666_0004086_4187_4501 103
434 3300046528 Ga0495642_0014174 Ga0495642_0014174_2015_2326 103
435 3300046528 Ga0495642_0014436 Ga0495642_0014436_1714_2025 103
436 3300046528 Ga0495642_0061468 Ga0495642_0061468_278_589 103
437 3300046528 Ga0495642_0082732 Ga0495642_0082732_994_1305 103
438 3300046528 Ga0495642_0097828 Ga0495642_0097828_445_756 103
439 3300046528 Ga0495642_0166026 Ga0495642_0166026_112_423 103
440 3300046529 Ga0495652_0013176 Ga0495652_0013176_4057_4371 103
441 3300046530 Ga0495654_0009148 Ga0495654_0009148_4755_5066 103
442 3300046531 Ga0495665_0003122 Ga0495665_0003122_1193_1507 103
443 3300046535 Ga0495586_0044186 Ga0495586_0044186_992_1306 103
444 3300046538 Ga0495609_0001130 Ga0495609_0001130_3903_4214 103
445 3300046538 Ga0495609_0022505 Ga0495609_0022505_275_586 103
446 3300046538 Ga0495609_0038307 Ga0495609_0038307_41_352 103
447 3300046538 Ga0495609_0071333 Ga0495609_0071333_1174_1485 103
448 3300046538 Ga0495609_0217757 Ga0495609_0217757_50_361 103
449 3300046538 Ga0495609_0281907 Ga0495609_0281907_339_650 103
450 3300046542 Ga0495597_0014682 Ga0495597_0014682_2601_2912 103
451 3300046542 Ga0495597_0024042 Ga0495597_0024042_1808_2119 103
452 3300046542 Ga0495597_0104363 Ga0495597_0104363_346_657 103
453 3300046542 Ga0495597_0305192 Ga0495597_0305192_213_524 103
454 3300046543 Ga0495645_0107096 Ga0495645_0107096_1363_1686 103
455 3300046543 Ga0495645_0474253 Ga0495645_0474253_44_358 103
456 3300046557 Ga0495622_0338334 Ga0495622_0338334_91_405 103
457 3300046557 Ga0495622_0458557 Ga0495622_0458557_97_408 103
458 3300046558 Ga0495633_0004291 Ga0495633_0004291_616_927 103
459 3300046558 Ga0495633_0009007 Ga0495633_0009007_3657_3968 103
460 3300046558 Ga0495633_0020283 Ga0495633_0020283_696_1007 103
461 3300046558 Ga0495633_0129192 Ga0495633_0129192_111_425 103
462 3300046615 Ga0495656_0019235 Ga0495656_0019235_1407_1718 103
463 3300046616 Ga0495668_0003307 Ga0495668_0003307_3594_3905 103
464 3300046616 Ga0495668_0016644 Ga0495668_0016644_481_792 103
465 3300046616 Ga0495668_0030329 Ga0495668_0030329_2061_2372 103
466 3300046616 Ga0495668_0497929 Ga0495668_0497929_36_347 103
467 3300046642 Ga0495634_0002131 Ga0495634_0002131_10499_10813 103
468 3300046648 Ga0495611_0105659 Ga0495611_0105659_722_1033 103
469 3300046648 Ga0495611_0195379 Ga0495611_0195379_281_592 103
470 3300046648 Ga0495611_0213046 Ga0495611_0213046_388_699 103
471 3300046648 Ga0495611_0371183 Ga0495611_0371183_309_620 103
472 3300046660 Ga0495625_0033305 Ga0495625_0033305_1104_1415 103
473 3300046660 Ga0495625_0905975 Ga0495625_0905975_167_478 103
474 3300046665 Ga0495661_0067407 Ga0495661_0067407_1219_1530 103
475 3300046665 Ga0495661_0078704 Ga0495661_0078704_930_1241 103
476 3300046665 Ga0495661_0091823 Ga0495661_0091823_411_722 103
477 3300046665 Ga0495661_0108746 Ga0495661_0108746_365_676 103
478 3300046665 Ga0495661_0381408 Ga0495661_0381408_209_520 103
479 3300046674 Ga0495588_0058146 Ga0495588_0058146_556_870 103
480 3300046679 Ga0495623_0049908 Ga0495623_0049908_1739_2053 103
481 3300046679 Ga0495623_0127701 Ga0495623_0127701_335_658 103
482 3300046684 Ga0495669_0217227 Ga0495669_0217227_551_862 103
483 3300046691 Ga0495670_0004812 Ga0495670_0004812_2141_2452 103
484 3300046691 Ga0495670_0013188 Ga0495670_0013188_2036_2347 103
485 3300046694 Ga0495649_0001214 Ga0495649_0001214_3376_3720 103
486 3300046694 Ga0495649_0063954 Ga0495649_0063954_370_681 103
487 3300046694 Ga0495649_0119412 Ga0495649_0119412_1006_1317 103
488 3300046694 Ga0495649_0330867 Ga0495649_0330867_424_735 103
489 3300046794 Ga0495589_0020568 Ga0495589_0020568_440_751 103
490 3300046794 Ga0495589_0032369 Ga0495589_0032369_2064_2375 103
491 3300046794 Ga0495589_0057196 Ga0495589_0057196_49_360 103
492 3300046794 Ga0495589_0385111 Ga0495589_0385111_259_570 103
493 3300046809 Ga0495600_0133342 Ga0495600_0133342_847_1161 103
494 3300046810 Ga0495660_0370315 Ga0495660_0370315_141_452 103
495 3300047317 Ga0495604_0012639 Ga0495604_0012639_5501_5815 103
496 3300047320 Ga0495672_0020932 Ga0495672_0020932_2936_3247 103
497 3300047320 Ga0495672_0025490 Ga0495672_0025490_2978_3289 103
498 3300047320 Ga0495672_0283697 Ga0495672_0283697_445_756 103
499 3300047321 Ga0495676_0082849 Ga0495676_0082849_284_595 103
500 3300047321 Ga0495676_0089394 Ga0495676_0089394_219_530 103
501 3300047323 Ga0495683_0049352 Ga0495683_0049352_1582_1893 103
502 3300047323 Ga0495683_0070194 Ga0495683_0070194_220_531 103
503 3300047323 Ga0495683_0082094 Ga0495683_0082094_503_838 103
504 3300047444 Ga0495675_0013093 Ga0495675_0013093_1221_1535 103
505 3300047445 Ga0495677_0001090 Ga0495677_0001090_4846_5190 103
506 3300047445 Ga0495677_0013331 Ga0495677_0013331_1650_1961 103
507 3300047445 Ga0495677_0027129 Ga0495677_0027129_307_618 103
508 3300047445 Ga0495677_0086792 Ga0495677_0086792_289_600 103
509 3300047469 Ga0495673_0139653 Ga0495673_0139653_485_796 103
510 3300047470 Ga0495681_0000380 Ga0495681_0000380_28913_29224 103
511 3300047470 Ga0495681_0018326 Ga0495681_0018326_486_797 103
512 3300047470 Ga0495681_0032729 Ga0495681_0032729_565_876 103
513 3300047472 Ga0495686_0000047 Ga0495686_0000047_218681_219004 103
514 3300048088 Ga0495602_0010861 Ga0495602_0010861_7262_7585 103
515 3300048090 Ga0495615_0185680 Ga0495615_0185680_100_411 103
516 3300048091 Ga0495626_0000009 Ga0495626_0000009_246704_247018 103
517 3300048091 Ga0495626_0001723 Ga0495626_0001723_1576_1887 103
518 3300048091 Ga0495626_0008227 Ga0495626_0008227_1604_1915 103
519 3300048091 Ga0495626_0013206 Ga0495626_0013206_3409_3753 103
520 3300048091 Ga0495626_0031819 Ga0495626_0031819_1499_1837 103
521 3300048091 Ga0495626_0132843 Ga0495626_0132843_321_632 103
522 3300048915 Ga0496112_0523151 Ga0496112_0523151_535_846 103
523 3300048918 Ga0496115_0044126 Ga0496115_0044126_260_571 103
524 3300048927 Ga0496124_0028356 Ga0496124_0028356_810_1133 103
525 3300049460 Ga0495682_0298017 Ga0495682_0298017_92_403 103
526 3300049531 Ga0501315_065541 Ga0501315_065541_262_573 103
527 3300049662 Ga0501222_082320 Ga0501222_082320_61_372 103
528 3300049665 Ga0501227_002017 Ga0501227_002017_752_1063 103
529 3300049707 Ga0501234_082654 Ga0501234_082654_233_544 103
530 3300049708 Ga0501245_126373 Ga0501245_126373_16_327 103
531 3300049760 Ga0501263_019980 Ga0501263_019980_55_366 103
532 3300049775 Ga0501279_000538 Ga0501279_000538_3338_3649 103
533 3300049775 Ga0501279_001190 Ga0501279_001190_123_434 103

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.8693 16 84
3vk0-assembly1.cif.gz_A crystal structure of hypothetical transcription factor nhtf from neisseria 0.8627 17 39
5c8d-assembly2.cif.gz_F crystal structure of full-length thermus thermophilus carh bound to adenosylcobalamin (dark state) 0.8592 16 84
4r4e-assembly1.cif.gz_B structure of glnr-dna complex 0.8527 17 88
5i44-assembly4.cif.gz_F-2 structure of raca-dna complex; p21 form 0.843 17 75
ID Description Score Start End Superfamily
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8691 13 83 1.10.1660.10
3vk0A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8627 17 39 1.10.260.40
af_P9WME7_10_96_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8502 16 82 1.10.1660.10
5i44K00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8452 15 78 1.10.1660.10
4r4eA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8392 16 89 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A3N4U3R8-F1-model_v4 Chaperone modulatory protein CbpM 0.9291 12 103
AF-A0A7U6B488-F1-model_v4 MerR family transcriptional regulator 0.9195 1 97
AF-A0A2R4C8D5-F1-model_v4 MerR family transcriptional regulator 0.919 1 99
AF-A0A0K1ND39-F1-model_v4 deleted 0.903 16 95
AF-A0A2R4C8D5-F1-model_v4 MerR family transcriptional regulator 0.9017 1 99

Feature Viewer

pLDDT pTM Quality
93.63 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map