F460477

General Info

Members Datasets Scaffolds Average Seq Length
533 291 1066 79

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_945481_c1|nmdc:mga08y16_945481_c1_504_779
Length 91
Sequence MAIRLHLDRVLLERRMTLTELAERVGITIANLSILKTNKAKAIRFSTLDALCRVLDCQPKDLLERVEGEDAPIDDEDEDASGKALVASRGG

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
142 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
143 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
174 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
175 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
176 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
177 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
178 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
179 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
182 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
217 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
222 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
244 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
245 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
246 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
256 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
257 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
258 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
259 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
260 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
261 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
262 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
263 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
264 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
265 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
266 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
267 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
268 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
269 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
270 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
271 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
272 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
273 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
274 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
275 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
277 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
278 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
279 2643221583 Caulobacter sp. Root655 Isolate Unclassified
280 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
281 2643221640 Caulobacter sp. Root342 Isolate Unclassified
282 2643221642 Caulobacter sp. Root343 Isolate Unclassified
283 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
284 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
285 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
286 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
287 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
288 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
289 2851153111 Caulobacter radicis 736 Isolate Unclassified
290 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
291 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.62
Metatranscriptomes 0.19
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.64
Nodule 0
Rhizoplane 3
Rhizosphere 68.48
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_945481_c1 3300050511 Bacteria 845
2 JGI25157J39369_1024890 3300002741 Bacteria 700
3 JGI25153J46596_10064298 3300003215 Bacteria 980
4 JGI25153J46596_10096101 3300003215 Bacteria 705
5 rootH1_10013055 3300003316 Bacteria 4588
6 Ga0055526_1033927 3300003771 Bacteria 1405
7 Ga0055526_1071185 3300003771 Bacteria 704
8 Ga0055537_1001045 3300003773 Bacteria 12416
9 Ga0055524_1008150 3300003775 Bacteria 4378
10 Ga0055536_1000251 3300003781 Bacteria 42530
11 Ga0055536_1000815 3300003781 Bacteria 20611
12 Ga0055536_1000953 3300003781 Bacteria 18523
13 Ga0055528_1036338 3300003790 Bacteria 1178
14 Ga0055530_10001790 3300003791 Bacteria 14930
15 Ga0055540_1084968 3300003792 Bacteria 603
16 Ga0055531_10000541 3300003794 Bacteria 33459
17 Ga0055531_10001885 3300003794 Bacteria 14679
18 Ga0055531_10006083 3300003794 Bacteria 6910
19 Ga0055531_10035697 3300003794 Bacteria 1550
20 Ga0055531_10100001 3300003794 Bacteria 597
21 Ga0065165_1001044 3300005262 Bacteria 33434
22 Ga0065165_1001092 3300005262 Bacteria 32262
23 Ga0065165_1007051 3300005262 Bacteria 5654
24 Ga0070658_10053138 3300005327 Bacteria 3287
25 Ga0070658_10378644 3300005327 Bacteria 1214
26 Ga0070658_10733975 3300005327 Bacteria 858
27 Ga0070658_10793886 3300005327 Bacteria 822
28 Ga0070658_10799549 3300005327 Bacteria 819
29 Ga0070658_11692136 3300005327 Bacteria 548
30 Ga0070683_101623281 3300005329 Bacteria 622
31 Ga0070670_102154267 3300005331 Bacteria 514
32 Ga0068869_100056322 3300005334 Bacteria 2867
33 Ga0068869_101177912 3300005334 Bacteria 673
34 Ga0070680_100038033 3300005336 Bacteria 3890
35 Ga0068868_101306108 3300005338 Bacteria 674
36 Ga0070660_100072343 3300005339 Bacteria 2694
37 Ga0070660_100233029 3300005339 Bacteria 1498
38 Ga0070660_100283553 3300005339 Bacteria 1356
39 Ga0070689_100432816 3300005340 Bacteria 1117
40 Ga0070691_10006066 3300005341 Bacteria 5516
41 Ga0070661_100864505 3300005344 Bacteria 745
42 Ga0070661_101357772 3300005344 Bacteria 597
43 Ga0070669_101619193 3300005353 Bacteria 564
44 Ga0070671_100054034 3300005355 Bacteria 3338
45 Ga0070659_100000194 3300005366 Bacteria 46646
46 Ga0070659_100032719 3300005366 Bacteria 4035
47 Ga0070713_101275693 3300005436 Bacteria 712
48 Ga0070663_101215042 3300005455 Bacteria 663
49 Ga0070663_101741556 3300005455 Bacteria 558
50 Ga0070678_101424909 3300005456 Bacteria 647
51 Ga0070681_10059209 3300005458 Bacteria 3809
52 Ga0070681_10059441 3300005458 Bacteria 3802
53 Ga0068867_100520199 3300005459 Bacteria 1026
54 Ga0070685_10941751 3300005466 Bacteria 645
55 Ga0070706_101432950 3300005467 Bacteria 632
56 Ga0070679_100096921 3300005530 Bacteria 2937
57 Ga0070679_100211985 3300005530 Bacteria 1900
58 Ga0070684_101225650 3300005535 Bacteria 706
59 Ga0070684_101339394 3300005535 Bacteria 674
60 Ga0068853_100032141 3300005539 Bacteria 4444
61 Ga0068853_100048356 3300005539 Bacteria 3653
62 Ga0068853_100056100 3300005539 Bacteria 3396
63 Ga0068853_100062463 3300005539 Bacteria 3224
64 Ga0068853_100506930 3300005539 Bacteria 1140
65 Ga0068853_101171813 3300005539 Bacteria 742
66 Ga0068853_101269176 3300005539 Bacteria 712
67 Ga0070665_100002063 3300005548 Bacteria 22556
68 Ga0070665_100907510 3300005548 Bacteria 894
69 Ga0068855_100042938 3300005563 Bacteria 5357
70 Ga0068855_100060640 3300005563 Bacteria 4423
71 Ga0068855_100145212 3300005563 Bacteria 2701
72 Ga0068855_100146004 3300005563 Bacteria 2693
73 Ga0068855_100687767 3300005563 Bacteria 1096
74 Ga0070664_100219279 3300005564 Bacteria 1702
75 Ga0070664_100761822 3300005564 Bacteria 904
76 Ga0068857_100550636 3300005577 Bacteria 1087
77 Ga0068857_101666256 3300005577 Bacteria 623
78 Ga0068854_100829462 3300005578 Bacteria 808
79 Ga0068856_100269610 3300005614 Bacteria 1718
80 Ga0068856_102303605 3300005614 Bacteria 547
81 Ga0068852_100642958 3300005616 Bacteria 1068
82 Ga0068864_102473513 3300005618 Bacteria 525
83 Ga0068861_101180464 3300005719 Bacteria 739
84 Ga0068858_100834011 3300005842 Bacteria 900
85 Ga0068860_100590148 3300005843 Bacteria 1116
86 Ga0068862_100116994 3300005844 Bacteria 2346
87 Ga0075365_11013137 3300006038 Bacteria 585
88 Ga0075363_100305763 3300006048 Bacteria 923
89 Ga0075363_100347410 3300006048 Bacteria 866
90 Ga0075364_10004307 3300006051 Bacteria 8167
91 Ga0075362_10094624 3300006177 Bacteria 1390
92 Ga0075367_10009900 3300006178 Bacteria 4993
93 Ga0075367_10916221 3300006178 Bacteria 559
94 Ga0075369_10001212 3300006186 Bacteria 8746
95 Ga0075366_10020867 3300006195 Bacteria 3805
96 Ga0075366_10033211 3300006195 Bacteria 3039
97 Ga0075366_10045389 3300006195 Bacteria 2604
98 Ga0097621_102352995 3300006237 Bacteria 510
99 Ga0075370_10080534 3300006353 Bacteria 1871
100 Ga0075370_10333441 3300006353 Bacteria 905
101 Ga0075370_10979776 3300006353 Bacteria 518
102 Ga0075428_100573098 3300006844 Unclassified 1206
103 Ga0075433_11391549 3300006852 Bacteria 607
104 Ga0097620_100199603 3300006931 Bacteria 2085
105 Ga0105240_10000428 3300009093 Bacteria 77995
106 Ga0105240_10145877 3300009093 Bacteria 2824
107 Ga0105240_10368547 3300009093 Bacteria 1625
108 Ga0105240_10572717 3300009093 Bacteria 1247
109 Ga0105240_11279787 3300009093 Bacteria 774
110 Ga0105240_12688895 3300009093 Bacteria 513
111 Ga0105240_12748459 3300009093 Bacteria 507
112 Ga0105245_11019500 3300009098 Bacteria 872
113 Ga0114129_13346022 3300009147 Bacteria 517
114 Ga0105243_11250635 3300009148 Bacteria 758
115 Ga0105243_12421989 3300009148 Bacteria 563
116 Ga0105241_10846526 3300009174 Bacteria 846
117 Ga0105241_11187202 3300009174 Bacteria 722
118 Ga0105242_10829404 3300009176 Bacteria 918
119 Ga0105248_10069725 3300009177 Bacteria 3948
120 Ga0105238_10026580 3300009551 Bacteria 5901
121 Ga0105238_10340545 3300009551 Bacteria 1488
122 Ga0105238_10558448 3300009551 Bacteria 1150
123 Ga0105238_10722664 3300009551 Bacteria 1009
124 Ga0105238_10970347 3300009551 Bacteria 870
125 Ga0105238_11753142 3300009551 Bacteria 652
126 Ga0105238_11809870 3300009551 Bacteria 643
127 Ga0105238_12335893 3300009551 Bacteria 570
128 Ga0105249_10283738 3300009553 Bacteria 1655
129 Ga0105249_10373222 3300009553 Bacteria 1451
130 Ga0105249_10414507 3300009553 Bacteria 1380
131 Ga0105249_10680527 3300009553 Bacteria 1088
132 Ga0105239_10254380 3300010375 Bacteria 1973
133 Ga0105239_12952528 3300010375 Bacteria 554
134 Ga0105239_12970933 3300010375 Bacteria 553
135 Ga0105246_11775007 3300011119 Bacteria 589
136 Ga0157327_1067875 3300012512 Bacteria 547
137 Ga0157373_10000756 3300013100 Bacteria 25102
138 Ga0157373_10000769 3300013100 Bacteria 24730
139 Ga0157370_10022429 3300013104 Bacteria 6281
140 Ga0157370_10288805 3300013104 Bacteria 1515
141 Ga0157370_10302797 3300013104 Bacteria 1475
142 Ga0157369_10030310 3300013105 Bacteria 5966
143 Ga0157369_11270304 3300013105 Bacteria 751
144 Ga0157378_12447330 3300013297 Bacteria 574
145 Ga0163162_10380349 3300013306 Bacteria 1545
146 Ga0163162_10532111 3300013306 Bacteria 1304
147 Ga0163162_11535507 3300013306 Bacteria 759
148 Ga0157372_10764189 3300013307 Bacteria 1123
149 Ga0157372_11813750 3300013307 Bacteria 701
150 Ga0157375_12088204 3300013308 Bacteria 674
151 Ga0157375_13509827 3300013308 Bacteria 522
152 Ga0163163_10039963 3300014325 Bacteria 4580
153 Ga0163163_10310256 3300014325 Bacteria 1630
154 Ga0163163_11706918 3300014325 Bacteria 690
155 Ga0163163_13308693 3300014325 Bacteria 502
156 Ga0182008_10037576 3300014497 Bacteria 2423
157 Ga0182008_10382859 3300014497 Bacteria 752
158 Ga0157376_11354677 3300014969 Bacteria 742
159 Ga0157376_11686266 3300014969 Bacteria 669
160 Ga0163161_11371235 3300017792 Bacteria 617
161 Ga0163161_11819394 3300017792 Bacteria 542
162 Ga0213872_10005118 3300021361 Bacteria 6804
163 Ga0213872_10008379 3300021361 Bacteria 5007
164 Ga0213872_10130761 3300021361 Bacteria 1106
165 Ga0213876_10214927 3300021384 Bacteria 1022
166 Ga0209026_1001360 3300025250 Bacteria 10913
167 Ga0209026_1030874 3300025250 Bacteria 795
168 Ga0209148_1031715 3300025254 Bacteria 783
169 Ga0209565_1000798 3300025263 Bacteria 18129
170 Ga0209455_1028122 3300025272 Bacteria 987
171 Ga0209673_1005598 3300025273 Bacteria 6277
172 Ga0209673_1052705 3300025273 Bacteria 1066
173 Ga0209675_1015100 3300025291 Bacteria 2312
174 Ga0209675_1076884 3300025291 Bacteria 625
175 Ga0209676_1000038 3300025292 Bacteria 449305
176 Ga0209676_1000169 3300025292 Bacteria 155600
177 Ga0209676_1000319 3300025292 Bacteria 93542
178 Ga0209676_1095142 3300025292 Bacteria 646
179 Ga0209564_1007084 3300025295 Bacteria 5866
180 Ga0209564_1018803 3300025295 Bacteria 2613
181 Ga0209564_1033664 3300025295 Bacteria 1518
182 Ga0209758_1000852 3300025297 Bacteria 42442
183 Ga0209758_1005712 3300025297 Bacteria 9388
184 Ga0209758_1011442 3300025297 Bacteria 5139
185 Ga0209050_1000053 3300025298 Bacteria 349521
186 Ga0209050_1000281 3300025298 Bacteria 108751
187 Ga0209050_1000722 3300025298 Bacteria 48344
188 Ga0209050_1031075 3300025298 Bacteria 1672
189 Ga0209256_1003409 3300025299 Bacteria 11199
190 Ga0209256_1006386 3300025299 Bacteria 6273
191 Ga0209256_1014428 3300025299 Bacteria 2843
192 Ga0209051_1001156 3300025303 Bacteria 23987
193 Ga0209257_1000036 3300025304 Bacteria 616006
194 Ga0209257_1000289 3300025304 Bacteria 110882
195 Ga0209257_1000433 3300025304 Bacteria 80612
196 Ga0209257_1000845 3300025304 Bacteria 43868
197 Ga0209257_1003375 3300025304 Bacteria 13790
198 Ga0207705_10003058 3300025909 Bacteria 12757
199 Ga0207705_10116372 3300025909 Bacteria 1979
200 Ga0207705_10319527 3300025909 Bacteria 1193
201 Ga0207705_10697700 3300025909 Unclassified 789
202 Ga0207705_10882586 3300025909 Bacteria 693
203 Ga0207684_10276041 3300025910 Bacteria 1450
204 Ga0207707_10103685 3300025912 Bacteria 2486
205 Ga0207707_10158906 3300025912 Bacteria 1976
206 Ga0207695_10001559 3300025913 Bacteria 37604
207 Ga0207695_10006445 3300025913 Bacteria 15243
208 Ga0207695_10116653 3300025913 Bacteria 2643
209 Ga0207695_10216015 3300025913 Bacteria 1826
210 Ga0207695_10398000 3300025913 Bacteria 1262
211 Ga0207695_10597703 3300025913 Bacteria 984
212 Ga0207695_10719232 3300025913 Bacteria 879
213 Ga0207660_10006424 3300025917 Bacteria 7620
214 Ga0207660_10579556 3300025917 Bacteria 913
215 Ga0207657_10023711 3300025919 Bacteria 5707
216 Ga0207657_10034910 3300025919 Bacteria 4514
217 Ga0207657_10164152 3300025919 Bacteria 1802
218 Ga0207649_10314858 3300025920 Bacteria 1148
219 Ga0207649_10703776 3300025920 Bacteria 784
220 Ga0207652_10007533 3300025921 Bacteria 8765
221 Ga0207652_10029023 3300025921 Bacteria 4620
222 Ga0207694_10071756 3300025924 Bacteria 2706
223 Ga0207694_10129299 3300025924 Bacteria 2023
224 Ga0207694_10132397 3300025924 Bacteria 1999
225 Ga0207694_10741958 3300025924 Bacteria 829
226 Ga0207694_10949787 3300025924 Bacteria 727
227 Ga0207694_11001330 3300025924 Bacteria 707
228 Ga0207694_11162989 3300025924 Bacteria 653
229 Ga0207687_11165078 3300025927 Bacteria 662
230 Ga0207700_10142818 3300025928 Bacteria 1969
231 Ga0207700_10760866 3300025928 Bacteria 866
232 Ga0207644_10119824 3300025931 Bacteria 2002
233 Ga0207690_10000142 3300025932 Bacteria 57187
234 Ga0207690_10042276 3300025932 Bacteria 2992
235 Ga0207686_10106673 3300025934 Bacteria 1881
236 Ga0207709_10229421 3300025935 Bacteria 1344
237 Ga0207669_10888909 3300025937 Bacteria 744
238 Ga0207711_10106003 3300025941 Bacteria 2493
239 Ga0207689_10070978 3300025942 Bacteria 2861
240 Ga0207679_10126789 3300025945 Bacteria 2041
241 Ga0207679_10876398 3300025945 Bacteria 820
242 Ga0207667_10024848 3300025949 Bacteria 6569
243 Ga0207667_10041397 3300025949 Bacteria 4899
244 Ga0207667_10484978 3300025949 Bacteria 1255
245 Ga0207667_10970506 3300025949 Bacteria 838
246 Ga0207712_10378106 3300025961 Bacteria 1184
247 Ga0207712_10553083 3300025961 Bacteria 990
248 Ga0207640_11230432 3300025981 Bacteria 667
249 Ga0207658_10304699 3300025986 Bacteria 1374
250 Ga0207677_11242109 3300026023 Bacteria 683
251 Ga0207703_10969328 3300026035 Bacteria 815
252 Ga0207639_10032995 3300026041 Bacteria 3816
253 Ga0207639_10041338 3300026041 Bacteria 3448
254 Ga0207639_10116089 3300026041 Bacteria 2191
255 Ga0207639_10137598 3300026041 Bacteria 2031
256 Ga0207639_10374588 3300026041 Bacteria 1277
257 Ga0207639_10937771 3300026041 Bacteria 810
258 Ga0207639_11252188 3300026041 Bacteria 696
259 Ga0207678_10400338 3300026067 Bacteria 1189
260 Ga0207678_10754573 3300026067 Bacteria 858
261 Ga0207702_10490471 3300026078 Bacteria 1197
262 Ga0207702_10538332 3300026078 Bacteria 1141
263 Ga0207702_10558739 3300026078 Bacteria 1120
264 Ga0207641_10624052 3300026088 Bacteria 1057
265 Ga0207648_10900386 3300026089 Bacteria 826
266 Ga0207676_10870312 3300026095 Bacteria 882
267 Ga0207674_11463402 3300026116 Bacteria 652
268 Ga0207683_10343114 3300026121 Bacteria 1370
269 Ga0207698_10604318 3300026142 Bacteria 1082
270 Ga0209813_10139309 3300027866 Bacteria 860
271 Ga0268266_10000003 3300028379 Bacteria 1701703
272 Ga0268266_10637065 3300028379 Bacteria 1025
273 Ga0268265_10350263 3300028380 Bacteria 1348
274 Ga0268265_12615466 3300028380 Bacteria 510
275 Ga0268264_10768591 3300028381 Bacteria 961
276 Ga0268264_11922177 3300028381 Bacteria 601
277 Ga0268264_11935062 3300028381 Bacteria 599
278 Ga0265337_1024371 3300028556 Bacteria 1851
279 Ga0265337_1167597 3300028556 Bacteria 595
280 Ga0307517_10063633 3300028786 Bacteria 3446
281 Ga0307517_10356145 3300028786 Bacteria 792
282 Ga0307515_10011325 3300028794 Bacteria 16927
283 Ga0265338_10039064 3300028800 Bacteria 4485
284 Ga0307511_10012287 3300030521 Bacteria 8408
285 Ga0307512_10370032 3300030522 Bacteria 619
286 Ga0265770_1055653 3300030878 Bacteria 725
287 Ga0265327_10000442 3300031251 Bacteria 75162
288 Ga0265327_10001057 3300031251 Bacteria 38486
289 Ga0307513_10000045 3300031456 Bacteria 158626
290 Ga0307513_10000649 3300031456 Bacteria 50063
291 Ga0307513_10031552 3300031456 Bacteria 5997
292 Ga0307513_10050286 3300031456 Bacteria 4507
293 Ga0307513_10280783 3300031456 Bacteria 1443
294 Ga0307513_10281522 3300031456 Bacteria 1440
295 Ga0307408_101434894 3300031548 Bacteria 651
296 Ga0265314_10183612 3300031711 Bacteria 1251
297 Ga0307413_10078837 3300031824 Bacteria 2103
298 Ga0307410_11518408 3300031852 Bacteria 590
299 Ga0307406_10018011 3300031901 Bacteria 4120
300 Ga0307412_10039666 3300031911 Bacteria 3042
301 Ga0307416_102100574 3300032002 Bacteria 667
302 Ga0307414_10014394 3300032004 Bacteria 4742
303 Ga0307414_10170011 3300032004 Bacteria 1741
304 Ga0307414_10186348 3300032004 Bacteria 1674
305 Ga0307414_10248688 3300032004 Bacteria 1476
306 Ga0307414_10292105 3300032004 Bacteria 1374
307 Ga0307414_10315513 3300032004 Bacteria 1328
308 Ga0307414_10405971 3300032004 Bacteria 1184
309 Ga0307414_10464012 3300032004 Bacteria 1113
310 Ga0307414_10562745 3300032004 Bacteria 1017
311 Ga0307411_11950826 3300032005 Bacteria 547
312 Ga0307510_10003321 3300033180 Bacteria 18743
313 Ga0307510_10020409 3300033180 Bacteria 7742
314 Ga0373944_0027524 3300035089 Bacteria 1686
315 Ga0373945_0270158 3300035116 Bacteria 722
316 Ga0373956_0612160 3300035119 Bacteria 520
317 Ga0373943_0089776 3300035170 Bacteria 1590
318 Ga0373943_0285502 3300035170 Bacteria 934
319 Ga0373946_0376866 3300035171 Bacteria 713
320 Ga0373931_0425236 3300035691 Bacteria 845
321 Ga0373947_0409026 3300035725 Bacteria 916
322 Ga0373925_0000199 3300037068 Bacteria 65400
323 Ga0373925_0475872 3300037068 Bacteria 1024
324 Ga0395899_0000991 3300037312 Bacteria 26130
325 Ga0395900_0000002 3300037418 Bacteria 671103
326 Ga0395898_0013424 3300037466 Bacteria 8437
327 Ga0395905_0353551 3300037471 Bacteria 1361
328 Ga0395905_0992285 3300037471 Bacteria 743
329 Ga0436364_1078406 3300037853 Bacteria 545
330 Ga0395901_0000021 3300038443 Bacteria 307734
331 Ga0395901_1439020 3300038443 Bacteria 647
332 Ga0436365_1373116 3300039437 Bacteria 3294
333 Ga0436360_1137802 3300039438 Bacteria 653
334 Ga0436361_0030985 3300039447 Bacteria 20368
335 Ga0436361_0249034 3300039447 Bacteria 500
336 Ga0436361_0503454 3300039447 Bacteria 5147
337 Ga0436361_1086913 3300039447 Bacteria 566
338 Ga0451791_1146831 3300041451 Bacteria 514
339 Ga0451793_0618349 3300041452 Bacteria 544
340 Ga0451793_1875585 3300041452 Bacteria 745
341 Ga0451798_0079263 3300041458 Bacteria 516
342 Ga0451800_1434722 3300041459 Bacteria 536
343 Ga0451839_0234978 3300041496 Bacteria 1075
344 Ga0451841_0673893 3300041498 Bacteria 505
345 Ga0451855_1752724 3300041511 Bacteria 533
346 Ga0451853_0376336 3300041512 Bacteria 796
347 Ga0439445_0135033 3300042004 Bacteria 713
348 Ga0450890_029171 3300042127 Bacteria 779
349 Ga0439446_0003888 3300042156 Bacteria 3750
350 Ga0439459_0034174 3300042438 Bacteria 1050
351 Ga0466966_0493769 3300044684 Unclassified 736
352 Ga0466961_0090099 3300044693 Bacteria 1937
353 Ga0466964_0246123 3300044706 Bacteria 879
354 Ga0466957_1179847 3300044842 Bacteria 553
355 Ga0466960_0424193 3300044901 Bacteria 769
356 Ga0495617_259478 3300046452 Bacteria 534
357 Ga0495627_000508 3300046453 Bacteria 32410
358 Ga0495638_0000403 3300046460 Bacteria 52881
359 Ga0495638_0001416 3300046460 Bacteria 21777
360 Ga0495638_0008799 3300046460 Bacteria 7129
361 Ga0495638_0047592 3300046460 Bacteria 2688
362 Ga0495638_0097790 3300046460 Bacteria 1759
363 Ga0495638_0149775 3300046460 Bacteria 1354
364 Ga0495650_0028332 3300046471 Bacteria 2574
365 Ga0495650_0149542 3300046471 Bacteria 839
366 Ga0495580_0737783 3300046472 Bacteria 642
367 Ga0495585_0047761 3300046492 Bacteria 2383
368 Ga0495583_0000025 3300046506 Bacteria 263775
369 Ga0495583_0029134 3300046506 Bacteria 2705
370 Ga0495583_0253466 3300046506 Bacteria 705
371 Ga0495606_0014729 3300046507 Bacteria 6080
372 Ga0495606_0092696 3300046507 Bacteria 1855
373 Ga0495606_0135610 3300046507 Bacteria 1458
374 Ga0495606_0453655 3300046507 Bacteria 656
375 Ga0495610_0000507 3300046512 Bacteria 39719
376 Ga0495610_0004190 3300046512 Bacteria 10769
377 Ga0495616_0000458 3300046513 Bacteria 31083
378 Ga0495632_0004692 3300046519 Bacteria 9233
379 Ga0495637_0008261 3300046520 Bacteria 5118
380 Ga0495637_0099495 3300046520 Bacteria 1138
381 Ga0495637_0271778 3300046520 Bacteria 606
382 Ga0495643_0184483 3300046522 Bacteria 1011
383 Ga0495643_0507059 3300046522 Bacteria 518
384 Ga0495648_0173912 3300046524 Bacteria 1101
385 Ga0495663_0023356 3300046525 Bacteria 1790
386 Ga0495642_0006049 3300046528 Bacteria 4647
387 Ga0495642_0149417 3300046528 Bacteria 1010
388 Ga0495642_0353393 3300046528 Bacteria 646
389 Ga0495654_0070729 3300046530 Bacteria 1654
390 Ga0495665_0344269 3300046531 Bacteria 760
391 Ga0495597_0071402 3300046542 Bacteria 1495
392 Ga0495597_0137316 3300046542 Bacteria 1010
393 Ga0495597_0238523 3300046542 Bacteria 718
394 Ga0495597_0248927 3300046542 Bacteria 699
395 Ga0495645_0655876 3300046543 Bacteria 641
396 Ga0495633_0438718 3300046558 Bacteria 590
397 Ga0495668_0040226 3300046616 Bacteria 2608
398 Ga0495668_0047393 3300046616 Bacteria 2386
399 Ga0495668_0098733 3300046616 Bacteria 1598
400 Ga0495668_0303492 3300046616 Bacteria 875
401 Ga0495611_0269497 3300046648 Bacteria 787
402 Ga0495625_0000043 3300046660 Bacteria 205715
403 Ga0495625_0002221 3300046660 Bacteria 21452
404 Ga0495625_0017877 3300046660 Bacteria 5542
405 Ga0495625_0061106 3300046660 Bacteria 2667
406 Ga0495625_0065064 3300046660 Bacteria 2571
407 Ga0495625_0077380 3300046660 Bacteria 2324
408 Ga0495625_0079917 3300046660 Bacteria 2278
409 Ga0495625_0152098 3300046660 Bacteria 1555
410 Ga0495625_0495580 3300046660 Bacteria 748
411 Ga0495669_0000014 3300046684 Bacteria 140832
412 Ga0495669_0000222 3300046684 Bacteria 34149
413 Ga0495669_0062880 3300046684 Bacteria 1683
414 Ga0495669_0149432 3300046684 Bacteria 1105
415 Ga0495670_0312747 3300046691 Bacteria 843
416 Ga0495589_0008147 3300046794 Bacteria 5479
417 Ga0495660_0123446 3300046810 Bacteria 1307
418 Ga0495660_0228295 3300046810 Bacteria 874
419 Ga0495660_0411753 3300046810 Bacteria 590
420 Ga0495636_0078544 3300047318 Bacteria 1418
421 Ga0495672_0001670 3300047320 Bacteria 21514
422 Ga0495672_0420897 3300047320 Bacteria 607
423 Ga0495683_0108043 3300047323 Bacteria 1331
424 Ga0495677_0017610 3300047445 Bacteria 2590
425 Ga0495677_0021804 3300047445 Bacteria 2321
426 Ga0495677_0112364 3300047445 Bacteria 1036
427 Ga0495679_060102 3300047446 Bacteria 1116
428 Ga0495673_0000340 3300047469 Bacteria 59502
429 Ga0495673_0001397 3300047469 Bacteria 19412
430 Ga0495681_0088711 3300047470 Bacteria 1369
431 Ga0495681_0229434 3300047470 Bacteria 741
432 Ga0495686_0025616 3300047472 Bacteria 3865
433 Ga0495686_0035838 3300047472 Bacteria 3186
434 Ga0495686_0037836 3300047472 Bacteria 3089
435 Ga0495686_0056568 3300047472 Bacteria 2450
436 Ga0495686_0138920 3300047472 Bacteria 1435
437 Ga0495686_0332668 3300047472 Bacteria 830
438 Ga0495686_0502693 3300047472 Bacteria 638
439 Ga0496100_0629196 3300048903 Bacteria 835
440 Ga0496101_1623555 3300048904 Bacteria 502
441 Ga0496106_0451977 3300048909 Bacteria 1032
442 Ga0496107_0118635 3300048910 Bacteria 1948
443 Ga0496112_0966166 3300048915 Bacteria 772
444 Ga0496115_0001700 3300048918 Bacteria 15774
445 Ga0496115_0036869 3300048918 Bacteria 3872
446 Ga0496115_0037132 3300048918 Bacteria 3860
447 Ga0496115_0104288 3300048918 Bacteria 2327
448 Ga0496115_0126491 3300048918 Bacteria 2105
449 Ga0496115_0404674 3300048918 Bacteria 1107
450 Ga0496121_0551066 3300048924 Bacteria 721
451 Ga0496123_0149296 3300048926 Bacteria 1264
452 Ga0496124_0006743 3300048927 Bacteria 12418
453 Ga0496124_0896786 3300048927 Bacteria 538
454 Ga0496126_0045491 3300048929 Bacteria 4033
455 Ga0496126_0071919 3300048929 Bacteria 3078
456 Ga0495678_101481 3300049459 Bacteria 996
457 Ga0501032_1045571 3300049569 Bacteria 512
458 Ga0501033_1194895 3300049570 Bacteria 504
459 Ga0501033_1206272 3300049570 Bacteria 501
460 Ga0501034_0431139 3300049571 Bacteria 1238
461 Ga0501034_0555471 3300049571 Bacteria 1057
462 Ga0501036_1012812 3300049572 Bacteria 680
463 Ga0501047_0508400 3300049581 Bacteria 1031
464 Ga0501047_0575207 3300049581 Bacteria 950
465 Ga0501067_0129971 3300049583 Bacteria 1402
466 Ga0501238_000791 3300049671 Bacteria 3584
467 Ga0501238_000834 3300049671 Bacteria 3503
468 Ga0501273_096557 3300049770 Bacteria 508
469 nmdc:mga03683_140170_c1 3300050489 Bacteria 1087
470 nmdc:mga03n38_28417_c1 3300050490 Bacteria 2331
471 nmdc:mga03n38_297937_c1 3300050490 Bacteria 865
472 nmdc:mga00v17_3414_c1 3300050491 Bacteria 8209
473 nmdc:mga0k408_15526_c1 3300050493 Bacteria 4211
474 nmdc:mga0k408_24716_c1 3300050493 Bacteria 3398
475 nmdc:mga0k408_58044_c1 3300050493 Bacteria 2248
476 nmdc:mga06z11_51432_c1 3300050494 Bacteria 2110
477 nmdc:mga04h51_5466_c1 3300050495 Bacteria 3241
478 nmdc:mga07m45_32653_c1 3300050496 Bacteria 2887
479 nmdc:mga07m45_457877_c1 3300050496 Bacteria 740
480 nmdc:mga07m45_884302_c1 3300050496 Bacteria 511
481 nmdc:mga05p37_1675952_c1 3300050507 Bacteria 621
482 nmdc:mga0sz30_2263_c1 3300050516 Bacteria 6886
483 nmdc:mga0sz30_73368_c1 3300050516 Bacteria 1475
484 Ga0495612_0138594 3300053078 Bacteria 1054
485 Ga0500643_063744 3300053087 Bacteria 1031
486 Ga0500641_0109535 3300053096 Bacteria 1188
487 Ga0500650_0049221 3300053098 Bacteria 1956
488 Ga0500650_0284190 3300053098 Bacteria 735
489 Ga0500554_003848 3300053102 Bacteria 3114
490 Ga0500556_0002669 3300053104 Bacteria 5559
491 Ga0500562_000558 3300053108 Bacteria 8992
492 Ga0500562_047245 3300053108 Bacteria 1148
493 Ga0500595_018188 3300053119 Bacteria 2575
494 Ga0500595_051890 3300053119 Bacteria 1268
495 Ga0500595_169538 3300053119 Bacteria 607
496 Ga0500608_000105 3300053122 Bacteria 34366
497 Ga0500608_097725 3300053122 Bacteria 1364
498 Ga0500614_006173 3300053123 Bacteria 2517
499 Ga0500618_000022 3300053125 Bacteria 157907
500 Ga0500642_0034007 3300053130 Bacteria 2153
501 Ga0500642_0169671 3300053130 Bacteria 1021
502 Ga0500655_030393 3300053133 Bacteria 1039
503 Ga0500658_0089400 3300053134 Bacteria 1329
504 Ga0500559_0000806 3300053136 Bacteria 20467
505 Ga0500559_0002565 3300053136 Bacteria 9318
506 Ga0500559_0021623 3300053136 Bacteria 2727
507 Ga0500573_0334719 3300053140 Bacteria 742
508 Ga0500573_0496584 3300053140 Bacteria 552
509 Ga0500577_0302181 3300053142 Bacteria 698
510 Ga0500622_0010724 3300053156 Bacteria 5015
511 Ga0500622_0015383 3300053156 Bacteria 4097
512 Ga0500645_006258 3300053730 Bacteria 4270
513 Ga0500645_206546 3300053730 Bacteria 528
514 Ga0500609_001881 3300053731 Bacteria 3044
515 Ga0500656_014429 3300053732 Bacteria 915
516 Ga0590077_088360 3300059426 Bacteria 718
517 2511122821 2510917020 Bacteria 5657507
518 2587919800 2585428106 Bacteria 5179711
519 2643884621 2643221574 Bacteria 2789653
520 2643922674 2643221583 Bacteria 5218014
521 2644087511 2643221614 Bacteria 4260023
522 2644223573 2643221640 Bacteria 5258820
523 2644236337 2643221642 Bacteria 5357871
524 2644344445 2643221661 Bacteria 4267604
525 2644351461 2643221663 Bacteria 3425771
526 2644366871 2643221666 Bacteria 4265935
527 2644548990 2643221699 Bacteria 5731501
528 2644553278 2643221699 Bacteria 5731501
529 2792459283 2791355048 Bacteria 5832535
530 2843744794 2843744320 Bacteria 5659202
531 2851156839 2851153111 Bacteria 5542585
532 2898330587 2898329390 Bacteria 5168154
533 2928531940 2928531327 Bacteria 5101314
534 nmdc:mga08y16_945481_c1
535 JGI25157J39369_1024890
536 JGI25153J46596_10064298
537 JGI25153J46596_10096101
538 rootH1_10013055
539 Ga0055526_1033927
540 Ga0055526_1071185
541 Ga0055537_1001045
542 Ga0055524_1008150
543 Ga0055536_1000251
544 Ga0055536_1000815
545 Ga0055536_1000953
546 Ga0055528_1036338
547 Ga0055530_10001790
548 Ga0055540_1084968
549 Ga0055531_10000541
550 Ga0055531_10001885
551 Ga0055531_10006083
552 Ga0055531_10035697
553 Ga0055531_10100001
554 Ga0065165_1001044
555 Ga0065165_1001092
556 Ga0065165_1007051
557 Ga0070658_10053138
558 Ga0070658_10378644
559 Ga0070658_10733975
560 Ga0070658_10793886
561 Ga0070658_10799549
562 Ga0070658_11692136
563 Ga0070683_101623281
564 Ga0070670_102154267
565 Ga0068869_100056322
566 Ga0068869_101177912
567 Ga0070680_100038033
568 Ga0068868_101306108
569 Ga0070660_100072343
570 Ga0070660_100233029
571 Ga0070660_100283553
572 Ga0070689_100432816
573 Ga0070691_10006066
574 Ga0070661_100864505
575 Ga0070661_101357772
576 Ga0070669_101619193
577 Ga0070671_100054034
578 Ga0070659_100000194
579 Ga0070659_100032719
580 Ga0070713_101275693
581 Ga0070663_101215042
582 Ga0070663_101741556
583 Ga0070678_101424909
584 Ga0070681_10059209
585 Ga0070681_10059441
586 Ga0068867_100520199
587 Ga0070685_10941751
588 Ga0070706_101432950
589 Ga0070679_100096921
590 Ga0070679_100211985
591 Ga0070684_101225650
592 Ga0070684_101339394
593 Ga0068853_100032141
594 Ga0068853_100048356
595 Ga0068853_100056100
596 Ga0068853_100062463
597 Ga0068853_100506930
598 Ga0068853_101171813
599 Ga0068853_101269176
600 Ga0070665_100002063
601 Ga0070665_100907510
602 Ga0068855_100042938
603 Ga0068855_100060640
604 Ga0068855_100145212
605 Ga0068855_100146004
606 Ga0068855_100687767
607 Ga0070664_100219279
608 Ga0070664_100761822
609 Ga0068857_100550636
610 Ga0068857_101666256
611 Ga0068854_100829462
612 Ga0068856_100269610
613 Ga0068856_102303605
614 Ga0068852_100642958
615 Ga0068864_102473513
616 Ga0068861_101180464
617 Ga0068858_100834011
618 Ga0068860_100590148
619 Ga0068862_100116994
620 Ga0075365_11013137
621 Ga0075363_100305763
622 Ga0075363_100347410
623 Ga0075364_10004307
624 Ga0075362_10094624
625 Ga0075367_10009900
626 Ga0075367_10916221
627 Ga0075369_10001212
628 Ga0075366_10020867
629 Ga0075366_10033211
630 Ga0075366_10045389
631 Ga0097621_102352995
632 Ga0075370_10080534
633 Ga0075370_10333441
634 Ga0075370_10979776
635 Ga0075428_100573098
636 Ga0075433_11391549
637 Ga0097620_100199603
638 Ga0105240_10000428
639 Ga0105240_10145877
640 Ga0105240_10368547
641 Ga0105240_10572717
642 Ga0105240_11279787
643 Ga0105240_12688895
644 Ga0105240_12748459
645 Ga0105245_11019500
646 Ga0114129_13346022
647 Ga0105243_11250635
648 Ga0105243_12421989
649 Ga0105241_10846526
650 Ga0105241_11187202
651 Ga0105242_10829404
652 Ga0105248_10069725
653 Ga0105238_10026580
654 Ga0105238_10340545
655 Ga0105238_10558448
656 Ga0105238_10722664
657 Ga0105238_10970347
658 Ga0105238_11753142
659 Ga0105238_11809870
660 Ga0105238_12335893
661 Ga0105249_10283738
662 Ga0105249_10373222
663 Ga0105249_10414507
664 Ga0105249_10680527
665 Ga0105239_10254380
666 Ga0105239_12952528
667 Ga0105239_12970933
668 Ga0105246_11775007
669 Ga0157327_1067875
670 Ga0157373_10000756
671 Ga0157373_10000769
672 Ga0157370_10022429
673 Ga0157370_10288805
674 Ga0157370_10302797
675 Ga0157369_10030310
676 Ga0157369_11270304
677 Ga0157378_12447330
678 Ga0163162_10380349
679 Ga0163162_10532111
680 Ga0163162_11535507
681 Ga0157372_10764189
682 Ga0157372_11813750
683 Ga0157375_12088204
684 Ga0157375_13509827
685 Ga0163163_10039963
686 Ga0163163_10310256
687 Ga0163163_11706918
688 Ga0163163_13308693
689 Ga0182008_10037576
690 Ga0182008_10382859
691 Ga0157376_11354677
692 Ga0157376_11686266
693 Ga0163161_11371235
694 Ga0163161_11819394
695 Ga0213872_10005118
696 Ga0213872_10008379
697 Ga0213872_10130761
698 Ga0213876_10214927
699 Ga0209026_1001360
700 Ga0209026_1030874
701 Ga0209148_1031715
702 Ga0209565_1000798
703 Ga0209455_1028122
704 Ga0209673_1005598
705 Ga0209673_1052705
706 Ga0209675_1015100
707 Ga0209675_1076884
708 Ga0209676_1000038
709 Ga0209676_1000169
710 Ga0209676_1000319
711 Ga0209676_1095142
712 Ga0209564_1007084
713 Ga0209564_1018803
714 Ga0209564_1033664
715 Ga0209758_1000852
716 Ga0209758_1005712
717 Ga0209758_1011442
718 Ga0209050_1000053
719 Ga0209050_1000281
720 Ga0209050_1000722
721 Ga0209050_1031075
722 Ga0209256_1003409
723 Ga0209256_1006386
724 Ga0209256_1014428
725 Ga0209051_1001156
726 Ga0209257_1000036
727 Ga0209257_1000289
728 Ga0209257_1000433
729 Ga0209257_1000845
730 Ga0209257_1003375
731 Ga0207705_10003058
732 Ga0207705_10116372
733 Ga0207705_10319527
734 Ga0207705_10697700
735 Ga0207705_10882586
736 Ga0207684_10276041
737 Ga0207707_10103685
738 Ga0207707_10158906
739 Ga0207695_10001559
740 Ga0207695_10006445
741 Ga0207695_10116653
742 Ga0207695_10216015
743 Ga0207695_10398000
744 Ga0207695_10597703
745 Ga0207695_10719232
746 Ga0207660_10006424
747 Ga0207660_10579556
748 Ga0207657_10023711
749 Ga0207657_10034910
750 Ga0207657_10164152
751 Ga0207649_10314858
752 Ga0207649_10703776
753 Ga0207652_10007533
754 Ga0207652_10029023
755 Ga0207694_10071756
756 Ga0207694_10129299
757 Ga0207694_10132397
758 Ga0207694_10741958
759 Ga0207694_10949787
760 Ga0207694_11001330
761 Ga0207694_11162989
762 Ga0207687_11165078
763 Ga0207700_10142818
764 Ga0207700_10760866
765 Ga0207644_10119824
766 Ga0207690_10000142
767 Ga0207690_10042276
768 Ga0207686_10106673
769 Ga0207709_10229421
770 Ga0207669_10888909
771 Ga0207711_10106003
772 Ga0207689_10070978
773 Ga0207679_10126789
774 Ga0207679_10876398
775 Ga0207667_10024848
776 Ga0207667_10041397
777 Ga0207667_10484978
778 Ga0207667_10970506
779 Ga0207712_10378106
780 Ga0207712_10553083
781 Ga0207640_11230432
782 Ga0207658_10304699
783 Ga0207677_11242109
784 Ga0207703_10969328
785 Ga0207639_10032995
786 Ga0207639_10041338
787 Ga0207639_10116089
788 Ga0207639_10137598
789 Ga0207639_10374588
790 Ga0207639_10937771
791 Ga0207639_11252188
792 Ga0207678_10400338
793 Ga0207678_10754573
794 Ga0207702_10490471
795 Ga0207702_10538332
796 Ga0207702_10558739
797 Ga0207641_10624052
798 Ga0207648_10900386
799 Ga0207676_10870312
800 Ga0207674_11463402
801 Ga0207683_10343114
802 Ga0207698_10604318
803 Ga0209813_10139309
804 Ga0268266_10000003
805 Ga0268266_10637065
806 Ga0268265_10350263
807 Ga0268265_12615466
808 Ga0268264_10768591
809 Ga0268264_11922177
810 Ga0268264_11935062
811 Ga0265337_1024371
812 Ga0265337_1167597
813 Ga0307517_10063633
814 Ga0307517_10356145
815 Ga0307515_10011325
816 Ga0265338_10039064
817 Ga0307511_10012287
818 Ga0307512_10370032
819 Ga0265770_1055653
820 Ga0265327_10000442
821 Ga0265327_10001057
822 Ga0307513_10000045
823 Ga0307513_10000649
824 Ga0307513_10031552
825 Ga0307513_10050286
826 Ga0307513_10280783
827 Ga0307513_10281522
828 Ga0307408_101434894
829 Ga0265314_10183612
830 Ga0307413_10078837
831 Ga0307410_11518408
832 Ga0307406_10018011
833 Ga0307412_10039666
834 Ga0307416_102100574
835 Ga0307414_10014394
836 Ga0307414_10170011
837 Ga0307414_10186348
838 Ga0307414_10248688
839 Ga0307414_10292105
840 Ga0307414_10315513
841 Ga0307414_10405971
842 Ga0307414_10464012
843 Ga0307414_10562745
844 Ga0307411_11950826
845 Ga0307510_10003321
846 Ga0307510_10020409
847 Ga0373944_0027524
848 Ga0373945_0270158
849 Ga0373956_0612160
850 Ga0373943_0089776
851 Ga0373943_0285502
852 Ga0373946_0376866
853 Ga0373931_0425236
854 Ga0373947_0409026
855 Ga0373925_0000199
856 Ga0373925_0475872
857 Ga0395899_0000991
858 Ga0395900_0000002
859 Ga0395898_0013424
860 Ga0395905_0353551
861 Ga0395905_0992285
862 Ga0436364_1078406
863 Ga0395901_0000021
864 Ga0395901_1439020
865 Ga0436365_1373116
866 Ga0436360_1137802
867 Ga0436361_0030985
868 Ga0436361_0249034
869 Ga0436361_0503454
870 Ga0436361_1086913
871 Ga0451791_1146831
872 Ga0451793_0618349
873 Ga0451793_1875585
874 Ga0451798_0079263
875 Ga0451800_1434722
876 Ga0451839_0234978
877 Ga0451841_0673893
878 Ga0451855_1752724
879 Ga0451853_0376336
880 Ga0439445_0135033
881 Ga0450890_029171
882 Ga0439446_0003888
883 Ga0439459_0034174
884 Ga0466966_0493769
885 Ga0466961_0090099
886 Ga0466964_0246123
887 Ga0466957_1179847
888 Ga0466960_0424193
889 Ga0495617_259478
890 Ga0495627_000508
891 Ga0495638_0000403
892 Ga0495638_0001416
893 Ga0495638_0008799
894 Ga0495638_0047592
895 Ga0495638_0097790
896 Ga0495638_0149775
897 Ga0495650_0028332
898 Ga0495650_0149542
899 Ga0495580_0737783
900 Ga0495585_0047761
901 Ga0495583_0000025
902 Ga0495583_0029134
903 Ga0495583_0253466
904 Ga0495606_0014729
905 Ga0495606_0092696
906 Ga0495606_0135610
907 Ga0495606_0453655
908 Ga0495610_0000507
909 Ga0495610_0004190
910 Ga0495616_0000458
911 Ga0495632_0004692
912 Ga0495637_0008261
913 Ga0495637_0099495
914 Ga0495637_0271778
915 Ga0495643_0184483
916 Ga0495643_0507059
917 Ga0495648_0173912
918 Ga0495663_0023356
919 Ga0495642_0006049
920 Ga0495642_0149417
921 Ga0495642_0353393
922 Ga0495654_0070729
923 Ga0495665_0344269
924 Ga0495597_0071402
925 Ga0495597_0137316
926 Ga0495597_0238523
927 Ga0495597_0248927
928 Ga0495645_0655876
929 Ga0495633_0438718
930 Ga0495668_0040226
931 Ga0495668_0047393
932 Ga0495668_0098733
933 Ga0495668_0303492
934 Ga0495611_0269497
935 Ga0495625_0000043
936 Ga0495625_0002221
937 Ga0495625_0017877
938 Ga0495625_0061106
939 Ga0495625_0065064
940 Ga0495625_0077380
941 Ga0495625_0079917
942 Ga0495625_0152098
943 Ga0495625_0495580
944 Ga0495669_0000014
945 Ga0495669_0000222
946 Ga0495669_0062880
947 Ga0495669_0149432
948 Ga0495670_0312747
949 Ga0495589_0008147
950 Ga0495660_0123446
951 Ga0495660_0228295
952 Ga0495660_0411753
953 Ga0495636_0078544
954 Ga0495672_0001670
955 Ga0495672_0420897
956 Ga0495683_0108043
957 Ga0495677_0017610
958 Ga0495677_0021804
959 Ga0495677_0112364
960 Ga0495679_060102
961 Ga0495673_0000340
962 Ga0495673_0001397
963 Ga0495681_0088711
964 Ga0495681_0229434
965 Ga0495686_0025616
966 Ga0495686_0035838
967 Ga0495686_0037836
968 Ga0495686_0056568
969 Ga0495686_0138920
970 Ga0495686_0332668
971 Ga0495686_0502693
972 Ga0496100_0629196
973 Ga0496101_1623555
974 Ga0496106_0451977
975 Ga0496107_0118635
976 Ga0496112_0966166
977 Ga0496115_0001700
978 Ga0496115_0036869
979 Ga0496115_0037132
980 Ga0496115_0104288
981 Ga0496115_0126491
982 Ga0496115_0404674
983 Ga0496121_0551066
984 Ga0496123_0149296
985 Ga0496124_0006743
986 Ga0496124_0896786
987 Ga0496126_0045491
988 Ga0496126_0071919
989 Ga0495678_101481
990 Ga0501032_1045571
991 Ga0501033_1194895
992 Ga0501033_1206272
993 Ga0501034_0431139
994 Ga0501034_0555471
995 Ga0501036_1012812
996 Ga0501047_0508400
997 Ga0501047_0575207
998 Ga0501067_0129971
999 Ga0501238_000791
1000 Ga0501238_000834
1001 Ga0501273_096557
1002 nmdc:mga03683_140170_c1
1003 nmdc:mga03n38_28417_c1
1004 nmdc:mga03n38_297937_c1
1005 nmdc:mga00v17_3414_c1
1006 nmdc:mga0k408_15526_c1
1007 nmdc:mga0k408_24716_c1
1008 nmdc:mga0k408_58044_c1
1009 nmdc:mga06z11_51432_c1
1010 nmdc:mga04h51_5466_c1
1011 nmdc:mga07m45_32653_c1
1012 nmdc:mga07m45_457877_c1
1013 nmdc:mga07m45_884302_c1
1014 nmdc:mga05p37_1675952_c1
1015 nmdc:mga0sz30_2263_c1
1016 nmdc:mga0sz30_73368_c1
1017 Ga0495612_0138594
1018 Ga0500643_063744
1019 Ga0500641_0109535
1020 Ga0500650_0049221
1021 Ga0500650_0284190
1022 Ga0500554_003848
1023 Ga0500556_0002669
1024 Ga0500562_000558
1025 Ga0500562_047245
1026 Ga0500595_018188
1027 Ga0500595_051890
1028 Ga0500595_169538
1029 Ga0500608_000105
1030 Ga0500608_097725
1031 Ga0500614_006173
1032 Ga0500618_000022
1033 Ga0500642_0034007
1034 Ga0500642_0169671
1035 Ga0500655_030393
1036 Ga0500658_0089400
1037 Ga0500559_0000806
1038 Ga0500559_0002565
1039 Ga0500559_0021623
1040 Ga0500573_0334719
1041 Ga0500573_0496584
1042 Ga0500577_0302181
1043 Ga0500622_0010724
1044 Ga0500622_0015383
1045 Ga0500645_006258
1046 Ga0500645_206546
1047 Ga0500609_001881
1048 Ga0500656_014429
1049 Ga0590077_088360
1050 2511122821
1051 2587919800
1052 2643884621
1053 2643922674
1054 2644087511
1055 2644223573
1056 2644236337
1057 2644344445
1058 2644351461
1059 2644366871
1060 2644548990
1061 2644553278
1062 2792459283
1063 2843744794
1064 2851156839
1065 2898330587
1066 2928531940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

6

68

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pxp-assembly1.cif.gz_A crystal structure of a pas and dna binding domain containing protein (caur_2278) from chloroflexus aurantiacus j-10-fl at 2.30 a resolution 0.9474 16 56
3zkc-assembly1.cif.gz_A crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9274 8 60
3zkc-assembly1.cif.gz_B crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.924 8 60
2xj3-assembly1.cif.gz_B high resolution structure of the t55c mutant of cylr2. 0.9219 5 66
2cro-assembly1.cif.gz_A structure of phage 434 cro protein at 2.35 angstroms resolution 0.9214 6 59
ID Description Score Start End Superfamily
3qq6B00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.931 6 59 1.10.260.40
3zkcA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9274 8 60 1.10.260.40
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.924 8 60 1.10.260.40
1b0nA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9198 8 61 1.10.260.40
1perR00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9146 8 59 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A7X6U6X3-F1-model_v4 Helix-turn-helix transcriptional regulator 0.99 3 66 GO:0003677
AF-A0A848QUX9-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9895 3 66 GO:0003677
AF-A0A7Z0BWH4-F1-model_v4 Putative transcriptional regulator 0.9886 3 66 GO:0003677
AF-A0A1H9FDC5-F1-model_v4 Putative transcriptional regulator 0.9859 3 65 GO:0003677
AF-A0A0N1B190-F1-model_v4 Cro/Cl family transcriptional regulator 0.9846 3 66 GO:0003677

Map