F460499
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 534 | 242 | 532 | 75 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10002169|Ga0070676_100021697 |
| Length | 85 |
| Sequence | MAILVRLDEMLHERRMTLTELATRVDITVANLSILKTGKAKAIRFSTLEAICVALDCQPGELLEYCREGQPNDAVSADAGEGAHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 2 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 168 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 169 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 170 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 173 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 176 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 177 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 178 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 179 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 180 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 187 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 188 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 193 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 194 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 197 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 198 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 199 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 200 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 201 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 202 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 203 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 204 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 205 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 206 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 207 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 208 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 209 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 210 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 213 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 224 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 227 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 230 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 231 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 232 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 233 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 234 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 236 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 241 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 242 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.94 |
| Nodule | 0 |
| Rhizoplane | 1.5 |
| Rhizosphere | 94.94 |
| Stem | 0 |
| Stem Tuber | 0.19 |
| Unclassified | 2.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1009536 | 3300001915 | Bacteria | 1779 |
| 2 | JGI24741J21665_1061888 | 3300001915 | Bacteria | 553 |
| 3 | JGI24740J21852_10000281 | 3300001979 | Bacteria | 21617 |
| 4 | JGI24740J21852_10001858 | 3300001979 | Bacteria | 9669 |
| 5 | JGI24739J22299_10000453 | 3300001989 | Bacteria | 14331 |
| 6 | JGI24739J22299_10028526 | 3300001989 | Bacteria | 1946 |
| 7 | JGI24743J22301_10003697 | 3300001991 | Bacteria | 2442 |
| 8 | JGI24735J21928_10116153 | 3300002067 | Bacteria | 770 |
| 9 | JGI24735J21928_10205939 | 3300002067 | Bacteria | 571 |
| 10 | JGI24745J21846_1049948 | 3300002073 | Bacteria | 529 |
| 11 | JGI24738J21930_10000062 | 3300002075 | Bacteria | 22279 |
| 12 | JGI24738J21930_10007364 | 3300002075 | Bacteria | 2542 |
| 13 | JGI24034J26672_10056892 | 3300002239 | Bacteria | 681 |
| 14 | JGI24742J22300_10022402 | 3300002244 | Bacteria | 1083 |
| 15 | rootL2_10045740 | 3300003322 | Bacteria | 10955 |
| 16 | JGI26145J50221_1017606 | 3300003371 | Bacteria | 673 |
| 17 | Ga0055536_1000001 | 3300003781 | Bacteria | 630663 |
| 18 | Ga0055530_10002525 | 3300003791 | Bacteria | 11674 |
| 19 | Ga0065712_10392011 | 3300005290 | Bacteria | 737 |
| 20 | Ga0065715_10309893 | 3300005293 | Bacteria | 1001 |
| 21 | Ga0065715_10472983 | 3300005293 | Bacteria | 804 |
| 22 | Ga0065715_11180609 | 3300005293 | Bacteria | 502 |
| 23 | Ga0065707_10276566 | 3300005295 | Unclassified | 1058 |
| 24 | Ga0070658_10383998 | 3300005327 | Bacteria | 1205 |
| 25 | Ga0070676_10002169 | 3300005328 | Bacteria | 10013 |
| 26 | Ga0070676_10003504 | 3300005328 | Bacteria | 8192 |
| 27 | Ga0070676_10011228 | 3300005328 | Bacteria | 4871 |
| 28 | Ga0070683_100493296 | 3300005329 | Bacteria | 1170 |
| 29 | Ga0070690_100018652 | 3300005330 | Bacteria | 4194 |
| 30 | Ga0070670_100007258 | 3300005331 | Bacteria | 9393 |
| 31 | Ga0070670_100010365 | 3300005331 | Bacteria | 7955 |
| 32 | Ga0070670_100164833 | 3300005331 | Bacteria | 1921 |
| 33 | Ga0070670_100211938 | 3300005331 | Bacteria | 1684 |
| 34 | Ga0070677_10333173 | 3300005333 | Bacteria | 781 |
| 35 | Ga0070677_10387166 | 3300005333 | Bacteria | 734 |
| 36 | Ga0068869_100034193 | 3300005334 | Bacteria | 3594 |
| 37 | Ga0068869_100071883 | 3300005334 | Bacteria | 2562 |
| 38 | Ga0068869_101238510 | 3300005334 | Bacteria | 657 |
| 39 | Ga0070666_10072348 | 3300005335 | Bacteria | 2347 |
| 40 | Ga0070666_10213518 | 3300005335 | Bacteria | 1359 |
| 41 | Ga0070682_100265687 | 3300005337 | Bacteria | 1244 |
| 42 | Ga0068868_100000637 | 3300005338 | Bacteria | 23618 |
| 43 | Ga0068868_100403480 | 3300005338 | Bacteria | 1180 |
| 44 | Ga0068868_101275133 | 3300005338 | Bacteria | 682 |
| 45 | Ga0070660_100002082 | 3300005339 | Bacteria | 13818 |
| 46 | Ga0070660_100040988 | 3300005339 | Bacteria | 3527 |
| 47 | Ga0070660_101065505 | 3300005339 | Bacteria | 684 |
| 48 | Ga0070689_100009615 | 3300005340 | Bacteria | 6863 |
| 49 | Ga0070689_101006175 | 3300005340 | Bacteria | 742 |
| 50 | Ga0070687_100235595 | 3300005343 | Bacteria | 1129 |
| 51 | Ga0070661_100061480 | 3300005344 | Bacteria | 2757 |
| 52 | Ga0070661_100338365 | 3300005344 | Bacteria | 1178 |
| 53 | Ga0070668_100005175 | 3300005347 | Bacteria | 9673 |
| 54 | Ga0070668_100032860 | 3300005347 | Bacteria | 3949 |
| 55 | Ga0070668_100070106 | 3300005347 | Bacteria | 2728 |
| 56 | Ga0070668_100142841 | 3300005347 | Bacteria | 1930 |
| 57 | Ga0070668_100727650 | 3300005347 | Bacteria | 877 |
| 58 | Ga0070668_100985284 | 3300005347 | Bacteria | 757 |
| 59 | Ga0070668_101213518 | 3300005347 | Bacteria | 684 |
| 60 | Ga0070669_100000862 | 3300005353 | Bacteria | 22037 |
| 61 | Ga0070669_100059502 | 3300005353 | Bacteria | 2805 |
| 62 | Ga0070669_100118774 | 3300005353 | Bacteria | 2014 |
| 63 | Ga0070669_100968027 | 3300005353 | Bacteria | 729 |
| 64 | Ga0070675_100047334 | 3300005354 | Bacteria | 3524 |
| 65 | Ga0070675_100057554 | 3300005354 | Bacteria | 3205 |
| 66 | Ga0070675_100237497 | 3300005354 | Bacteria | 1592 |
| 67 | Ga0070671_100094852 | 3300005355 | Bacteria | 2501 |
| 68 | Ga0070671_100157220 | 3300005355 | Bacteria | 1921 |
| 69 | Ga0070671_100158914 | 3300005355 | Bacteria | 1910 |
| 70 | Ga0070671_100224615 | 3300005355 | Bacteria | 1593 |
| 71 | Ga0070674_100001982 | 3300005356 | Bacteria | 11206 |
| 72 | Ga0070674_100051087 | 3300005356 | Bacteria | 2848 |
| 73 | Ga0070674_100054275 | 3300005356 | Bacteria | 2771 |
| 74 | Ga0070674_102013308 | 3300005356 | Bacteria | 526 |
| 75 | Ga0070673_100000209 | 3300005364 | Bacteria | 29078 |
| 76 | Ga0070673_100050975 | 3300005364 | Bacteria | 3239 |
| 77 | Ga0070673_100096310 | 3300005364 | Bacteria | 2428 |
| 78 | Ga0070673_100392851 | 3300005364 | Bacteria | 1239 |
| 79 | Ga0070673_100446684 | 3300005364 | Bacteria | 1163 |
| 80 | Ga0070673_102075286 | 3300005364 | Bacteria | 540 |
| 81 | Ga0070688_100046454 | 3300005365 | Bacteria | 2689 |
| 82 | Ga0070659_100007835 | 3300005366 | Bacteria | 7774 |
| 83 | Ga0070659_100019869 | 3300005366 | Bacteria | 5098 |
| 84 | Ga0070659_100679062 | 3300005366 | Bacteria | 889 |
| 85 | Ga0070667_100004734 | 3300005367 | Bacteria | 11402 |
| 86 | Ga0070667_100021153 | 3300005367 | Bacteria | 5405 |
| 87 | Ga0070667_100047130 | 3300005367 | Bacteria | 3626 |
| 88 | Ga0070667_100090330 | 3300005367 | Bacteria | 2632 |
| 89 | Ga0070667_100277726 | 3300005367 | Bacteria | 1504 |
| 90 | Ga0070663_100090984 | 3300005455 | Bacteria | 2260 |
| 91 | Ga0070663_100186768 | 3300005455 | Bacteria | 1611 |
| 92 | Ga0070678_100009113 | 3300005456 | Bacteria | 5989 |
| 93 | Ga0070678_100123475 | 3300005456 | Bacteria | 2046 |
| 94 | Ga0070678_101126115 | 3300005456 | Bacteria | 725 |
| 95 | Ga0070662_100001955 | 3300005457 | Bacteria | 12662 |
| 96 | Ga0070662_100023820 | 3300005457 | Bacteria | 4210 |
| 97 | Ga0070662_100257974 | 3300005457 | Bacteria | 1404 |
| 98 | Ga0068867_100000633 | 3300005459 | Bacteria | 23213 |
| 99 | Ga0068867_100011413 | 3300005459 | Bacteria | 6269 |
| 100 | Ga0068867_100280746 | 3300005459 | Bacteria | 1366 |
| 101 | Ga0068867_100426594 | 3300005459 | Bacteria | 1124 |
| 102 | Ga0068867_101247915 | 3300005459 | Bacteria | 684 |
| 103 | Ga0070685_10627910 | 3300005466 | Bacteria | 776 |
| 104 | Ga0070685_11421709 | 3300005466 | Bacteria | 533 |
| 105 | Ga0070684_100172293 | 3300005535 | Bacteria | 1966 |
| 106 | Ga0070684_100274351 | 3300005535 | Bacteria | 1544 |
| 107 | Ga0068853_100002063 | 3300005539 | Bacteria | 14889 |
| 108 | Ga0068853_100072330 | 3300005539 | Bacteria | 3004 |
| 109 | Ga0068853_100367506 | 3300005539 | Bacteria | 1341 |
| 110 | Ga0068853_100523933 | 3300005539 | Bacteria | 1121 |
| 111 | Ga0068853_101221415 | 3300005539 | Bacteria | 726 |
| 112 | Ga0070672_100000770 | 3300005543 | Bacteria | 19069 |
| 113 | Ga0070672_100017202 | 3300005543 | Bacteria | 5199 |
| 114 | Ga0070672_100232470 | 3300005543 | Bacteria | 1549 |
| 115 | Ga0070686_100432174 | 3300005544 | Bacteria | 1008 |
| 116 | Ga0070665_100020763 | 3300005548 | Bacteria | 6600 |
| 117 | Ga0070665_100113415 | 3300005548 | Bacteria | 2713 |
| 118 | Ga0070665_100205173 | 3300005548 | Bacteria | 1972 |
| 119 | Ga0070665_100219334 | 3300005548 | Bacteria | 1902 |
| 120 | Ga0070665_100772776 | 3300005548 | Bacteria | 973 |
| 121 | Ga0070665_101677195 | 3300005548 | Bacteria | 643 |
| 122 | Ga0070665_102245599 | 3300005548 | Bacteria | 549 |
| 123 | Ga0068855_100032514 | 3300005563 | Bacteria | 6228 |
| 124 | Ga0068855_100039372 | 3300005563 | Bacteria | 5611 |
| 125 | Ga0068855_102198285 | 3300005563 | Bacteria | 554 |
| 126 | Ga0070664_100009081 | 3300005564 | Bacteria | 8067 |
| 127 | Ga0070664_100535128 | 3300005564 | Bacteria | 1082 |
| 128 | Ga0068857_100004161 | 3300005577 | Bacteria | 12189 |
| 129 | Ga0068857_100055828 | 3300005577 | Bacteria | 3504 |
| 130 | Ga0068857_100112891 | 3300005577 | Bacteria | 2443 |
| 131 | Ga0068857_100123051 | 3300005577 | Bacteria | 2337 |
| 132 | Ga0068854_100000614 | 3300005578 | Bacteria | 21116 |
| 133 | Ga0068854_100174976 | 3300005578 | Bacteria | 1672 |
| 134 | Ga0068856_101558655 | 3300005614 | Bacteria | 674 |
| 135 | Ga0068852_100000804 | 3300005616 | Bacteria | 20664 |
| 136 | Ga0068852_100040971 | 3300005616 | Bacteria | 3911 |
| 137 | Ga0068852_100046769 | 3300005616 | Bacteria | 3688 |
| 138 | Ga0068852_100845172 | 3300005616 | Bacteria | 931 |
| 139 | Ga0068852_101668583 | 3300005616 | Bacteria | 660 |
| 140 | Ga0068859_100000478 | 3300005617 | Bacteria | 39430 |
| 141 | Ga0068859_100081304 | 3300005617 | Bacteria | 3282 |
| 142 | Ga0068859_100362012 | 3300005617 | Bacteria | 1546 |
| 143 | Ga0068859_100423511 | 3300005617 | Bacteria | 1427 |
| 144 | Ga0068859_101715419 | 3300005617 | Unclassified | 694 |
| 145 | Ga0068859_101824558 | 3300005617 | Bacteria | 672 |
| 146 | Ga0068864_100000174 | 3300005618 | Bacteria | 59338 |
| 147 | Ga0068864_100080716 | 3300005618 | Bacteria | 2850 |
| 148 | Ga0068864_101021095 | 3300005618 | Bacteria | 821 |
| 149 | Ga0068864_101048728 | 3300005618 | Bacteria | 810 |
| 150 | Ga0068866_10167121 | 3300005718 | Bacteria | 1288 |
| 151 | Ga0068861_100010621 | 3300005719 | Bacteria | 6394 |
| 152 | Ga0068861_100466169 | 3300005719 | Bacteria | 1135 |
| 153 | Ga0068851_11006818 | 3300005834 | Bacteria | 526 |
| 154 | Ga0068870_10123162 | 3300005840 | Bacteria | 1496 |
| 155 | Ga0068870_10170620 | 3300005840 | Bacteria | 1298 |
| 156 | Ga0068870_10740287 | 3300005840 | Bacteria | 682 |
| 157 | Ga0068863_100004878 | 3300005841 | Bacteria | 13216 |
| 158 | Ga0068863_100076008 | 3300005841 | Bacteria | 3177 |
| 159 | Ga0068863_100106113 | 3300005841 | Bacteria | 2672 |
| 160 | Ga0068863_101086016 | 3300005841 | Bacteria | 804 |
| 161 | Ga0068858_100068281 | 3300005842 | Bacteria | 3294 |
| 162 | Ga0068858_100372130 | 3300005842 | Bacteria | 1370 |
| 163 | Ga0068858_100374413 | 3300005842 | Bacteria | 1366 |
| 164 | Ga0068860_100005690 | 3300005843 | Bacteria | 12583 |
| 165 | Ga0068860_100005831 | 3300005843 | Bacteria | 12397 |
| 166 | Ga0068860_100412817 | 3300005843 | Bacteria | 1337 |
| 167 | Ga0068862_100071036 | 3300005844 | Bacteria | 3006 |
| 168 | Ga0068862_100121478 | 3300005844 | Bacteria | 2303 |
| 169 | Ga0068862_100315881 | 3300005844 | Bacteria | 1441 |
| 170 | Ga0068862_100468845 | 3300005844 | Bacteria | 1190 |
| 171 | Ga0068862_100726929 | 3300005844 | Bacteria | 964 |
| 172 | Ga0081540_1007109 | 3300005983 | Bacteria | 8035 |
| 173 | Ga0097621_100013235 | 3300006237 | Bacteria | 6141 |
| 174 | Ga0097621_100688329 | 3300006237 | Bacteria | 940 |
| 175 | Ga0097621_102337665 | 3300006237 | Bacteria | 511 |
| 176 | Ga0068871_100003110 | 3300006358 | Bacteria | 11392 |
| 177 | Ga0068871_100031973 | 3300006358 | Bacteria | 4152 |
| 178 | Ga0068871_100135529 | 3300006358 | Bacteria | 2091 |
| 179 | Ga0068871_100687354 | 3300006358 | Bacteria | 936 |
| 180 | Ga0075428_100146442 | 3300006844 | Bacteria | 2567 |
| 181 | Ga0075433_10946217 | 3300006852 | Bacteria | 751 |
| 182 | Ga0068865_100000240 | 3300006881 | Bacteria | 30384 |
| 183 | Ga0068865_100078003 | 3300006881 | Bacteria | 2369 |
| 184 | Ga0068865_100805832 | 3300006881 | Bacteria | 810 |
| 185 | Ga0068865_101771005 | 3300006881 | Bacteria | 558 |
| 186 | Ga0068865_101851568 | 3300006881 | Bacteria | 546 |
| 187 | Ga0097620_100000478 | 3300006931 | Bacteria | 39430 |
| 188 | Ga0097620_100081305 | 3300006931 | Bacteria | 3282 |
| 189 | Ga0097620_100361978 | 3300006931 | Bacteria | 1546 |
| 190 | Ga0097620_100423530 | 3300006931 | Bacteria | 1427 |
| 191 | Ga0097620_101715365 | 3300006931 | Unclassified | 694 |
| 192 | Ga0097620_101824533 | 3300006931 | Bacteria | 672 |
| 193 | Ga0099795_10000031 | 3300007788 | Bacteria | 38284 |
| 194 | Ga0105240_10073297 | 3300009093 | Bacteria | 4228 |
| 195 | Ga0105240_10985831 | 3300009093 | Bacteria | 902 |
| 196 | Ga0111539_11596326 | 3300009094 | Bacteria | 757 |
| 197 | Ga0105245_10000300 | 3300009098 | Bacteria | 47446 |
| 198 | Ga0105245_10242820 | 3300009098 | Bacteria | 1746 |
| 199 | Ga0105243_10963662 | 3300009148 | Bacteria | 853 |
| 200 | Ga0105241_10022584 | 3300009174 | Bacteria | 4661 |
| 201 | Ga0105241_10107661 | 3300009174 | Bacteria | 2227 |
| 202 | Ga0105242_11861058 | 3300009176 | Bacteria | 641 |
| 203 | Ga0105248_10002741 | 3300009177 | Bacteria | 19562 |
| 204 | Ga0105248_10071273 | 3300009177 | Bacteria | 3904 |
| 205 | Ga0105248_10320192 | 3300009177 | Bacteria | 1747 |
| 206 | Ga0105248_11904888 | 3300009177 | Bacteria | 675 |
| 207 | Ga0105237_10104344 | 3300009545 | Bacteria | 2826 |
| 208 | Ga0105237_10747342 | 3300009545 | Bacteria | 985 |
| 209 | Ga0105238_10173045 | 3300009551 | Bacteria | 2136 |
| 210 | Ga0105249_10248255 | 3300009553 | Bacteria | 1763 |
| 211 | Ga0105249_10846682 | 3300009553 | Bacteria | 980 |
| 212 | Ga0105249_10849157 | 3300009553 | Bacteria | 979 |
| 213 | Ga0099796_10000003 | 3300010159 | Bacteria | 81717 |
| 214 | Ga0105239_10001674 | 3300010375 | Bacteria | 29219 |
| 215 | Ga0105239_10044676 | 3300010375 | Bacteria | 4856 |
| 216 | Ga0105239_12470039 | 3300010375 | Bacteria | 605 |
| 217 | Ga0105246_10021355 | 3300011119 | Bacteria | 4166 |
| 218 | Ga0105246_10657715 | 3300011119 | Bacteria | 913 |
| 219 | Ga0157316_1021749 | 3300012510 | Bacteria | 708 |
| 220 | Ga0157373_10006164 | 3300013100 | Bacteria | 8961 |
| 221 | Ga0157373_10048822 | 3300013100 | Bacteria | 3017 |
| 222 | Ga0157371_10000677 | 3300013102 | Bacteria | 40414 |
| 223 | Ga0157371_10244322 | 3300013102 | Bacteria | 1292 |
| 224 | Ga0157371_10343656 | 3300013102 | Bacteria | 1086 |
| 225 | Ga0157374_10274529 | 3300013296 | Bacteria | 1663 |
| 226 | Ga0157378_10000319 | 3300013297 | Bacteria | 47265 |
| 227 | Ga0157378_10002011 | 3300013297 | Bacteria | 18196 |
| 228 | Ga0157378_10553955 | 3300013297 | Bacteria | 1155 |
| 229 | Ga0157378_12100620 | 3300013297 | Bacteria | 615 |
| 230 | Ga0163162_10092140 | 3300013306 | Bacteria | 3114 |
| 231 | Ga0163162_10148645 | 3300013306 | Bacteria | 2460 |
| 232 | Ga0163162_10329052 | 3300013306 | Bacteria | 1660 |
| 233 | Ga0163162_12907011 | 3300013306 | Bacteria | 551 |
| 234 | Ga0157372_10045485 | 3300013307 | Bacteria | 4870 |
| 235 | Ga0157372_10118298 | 3300013307 | Bacteria | 3040 |
| 236 | Ga0157375_11153230 | 3300013308 | Bacteria | 908 |
| 237 | Ga0157375_11548194 | 3300013308 | Bacteria | 783 |
| 238 | Ga0157375_11975236 | 3300013308 | Bacteria | 693 |
| 239 | Ga0157375_12141719 | 3300013308 | Bacteria | 666 |
| 240 | Ga0163163_11351369 | 3300014325 | Bacteria | 774 |
| 241 | Ga0157380_10146412 | 3300014326 | Bacteria | 2036 |
| 242 | Ga0157380_12540990 | 3300014326 | Bacteria | 578 |
| 243 | Ga0157380_12900403 | 3300014326 | Bacteria | 546 |
| 244 | Ga0182008_10140682 | 3300014497 | Bacteria | 1207 |
| 245 | Ga0157377_11375320 | 3300014745 | Bacteria | 555 |
| 246 | Ga0157379_10004109 | 3300014968 | Bacteria | 12417 |
| 247 | Ga0157379_10524957 | 3300014968 | Bacteria | 1099 |
| 248 | Ga0157376_10943343 | 3300014969 | Bacteria | 883 |
| 249 | Ga0157376_11044200 | 3300014969 | Bacteria | 841 |
| 250 | Ga0157376_11463066 | 3300014969 | Bacteria | 716 |
| 251 | Ga0157376_11802179 | 3300014969 | Bacteria | 648 |
| 252 | Ga0163161_10257904 | 3300017792 | Bacteria | 1361 |
| 253 | Ga0163161_10274604 | 3300017792 | Bacteria | 1320 |
| 254 | Ga0163161_11755176 | 3300017792 | Bacteria | 551 |
| 255 | Ga0207697_10000026 | 3300025315 | Bacteria | 52498 |
| 256 | Ga0207697_10052837 | 3300025315 | Bacteria | 1682 |
| 257 | Ga0207682_10100070 | 3300025893 | Bacteria | 1266 |
| 258 | Ga0207682_10508763 | 3300025893 | Bacteria | 570 |
| 259 | Ga0207642_10103214 | 3300025899 | Bacteria | 1436 |
| 260 | Ga0207688_10000055 | 3300025901 | Bacteria | 41067 |
| 261 | Ga0207688_10281807 | 3300025901 | Bacteria | 1013 |
| 262 | Ga0207680_10032511 | 3300025903 | Bacteria | 2966 |
| 263 | Ga0207680_10169596 | 3300025903 | Bacteria | 1469 |
| 264 | Ga0207680_10913703 | 3300025903 | Bacteria | 629 |
| 265 | Ga0207647_10006361 | 3300025904 | Bacteria | 8588 |
| 266 | Ga0207647_10015895 | 3300025904 | Bacteria | 5148 |
| 267 | Ga0207645_10001667 | 3300025907 | Bacteria | 18069 |
| 268 | Ga0207645_10002100 | 3300025907 | Bacteria | 15942 |
| 269 | Ga0207645_10006444 | 3300025907 | Bacteria | 8421 |
| 270 | Ga0207645_10026689 | 3300025907 | Bacteria | 3731 |
| 271 | Ga0207643_10085558 | 3300025908 | Bacteria | 1831 |
| 272 | Ga0207643_10229397 | 3300025908 | Bacteria | 1139 |
| 273 | Ga0207643_10754082 | 3300025908 | Bacteria | 630 |
| 274 | Ga0207705_10312875 | 3300025909 | Bacteria | 1206 |
| 275 | Ga0207654_10033362 | 3300025911 | Bacteria | 2853 |
| 276 | Ga0207654_10226725 | 3300025911 | Bacteria | 1242 |
| 277 | Ga0207695_11677960 | 3300025913 | Bacteria | 516 |
| 278 | Ga0207662_10458958 | 3300025918 | Bacteria | 872 |
| 279 | Ga0207657_10003629 | 3300025919 | Bacteria | 16433 |
| 280 | Ga0207657_10019760 | 3300025919 | Bacteria | 6386 |
| 281 | Ga0207657_10616240 | 3300025919 | Bacteria | 846 |
| 282 | Ga0207649_10098452 | 3300025920 | Bacteria | 1930 |
| 283 | Ga0207649_10178691 | 3300025920 | Bacteria | 1484 |
| 284 | Ga0207681_10001514 | 3300025923 | Bacteria | 14993 |
| 285 | Ga0207681_10005327 | 3300025923 | Bacteria | 7903 |
| 286 | Ga0207681_10394526 | 3300025923 | Bacteria | 1116 |
| 287 | Ga0207681_10769166 | 3300025923 | Bacteria | 803 |
| 288 | Ga0207681_10862737 | 3300025923 | Bacteria | 757 |
| 289 | Ga0207694_10114373 | 3300025924 | Bacteria | 2149 |
| 290 | Ga0207650_10007009 | 3300025925 | Bacteria | 7688 |
| 291 | Ga0207650_10021094 | 3300025925 | Bacteria | 4604 |
| 292 | Ga0207650_10044004 | 3300025925 | Bacteria | 3280 |
| 293 | Ga0207650_10076214 | 3300025925 | Bacteria | 2533 |
| 294 | Ga0207650_10174316 | 3300025925 | Bacteria | 1711 |
| 295 | Ga0207659_10028105 | 3300025926 | Bacteria | 3818 |
| 296 | Ga0207659_10907981 | 3300025926 | Bacteria | 757 |
| 297 | Ga0207659_11408748 | 3300025926 | Bacteria | 597 |
| 298 | Ga0207687_10003666 | 3300025927 | Bacteria | 10346 |
| 299 | Ga0207687_10356146 | 3300025927 | Bacteria | 1193 |
| 300 | Ga0207644_10114557 | 3300025931 | Bacteria | 2043 |
| 301 | Ga0207644_10146332 | 3300025931 | Bacteria | 1824 |
| 302 | Ga0207644_10185868 | 3300025931 | Bacteria | 1631 |
| 303 | Ga0207690_10007026 | 3300025932 | Bacteria | 6676 |
| 304 | Ga0207690_10149315 | 3300025932 | Bacteria | 1731 |
| 305 | Ga0207706_10000278 | 3300025933 | Bacteria | 55758 |
| 306 | Ga0207706_10010239 | 3300025933 | Bacteria | 8573 |
| 307 | Ga0207706_10628496 | 3300025933 | Bacteria | 921 |
| 308 | Ga0207686_11371647 | 3300025934 | Bacteria | 581 |
| 309 | Ga0207709_11156602 | 3300025935 | Bacteria | 637 |
| 310 | Ga0207670_10049248 | 3300025936 | Bacteria | 2817 |
| 311 | Ga0207670_10333602 | 3300025936 | Bacteria | 1197 |
| 312 | Ga0207669_10013438 | 3300025937 | Bacteria | 4066 |
| 313 | Ga0207669_10253215 | 3300025937 | Bacteria | 1312 |
| 314 | Ga0207669_10584039 | 3300025937 | Bacteria | 906 |
| 315 | Ga0207669_11291413 | 3300025937 | Bacteria | 620 |
| 316 | Ga0207704_10005707 | 3300025938 | Bacteria | 5753 |
| 317 | Ga0207704_10783983 | 3300025938 | Bacteria | 795 |
| 318 | Ga0207691_10000045 | 3300025940 | Bacteria | 99798 |
| 319 | Ga0207691_10011068 | 3300025940 | Bacteria | 8659 |
| 320 | Ga0207691_10029849 | 3300025940 | Bacteria | 5099 |
| 321 | Ga0207711_10003154 | 3300025941 | Bacteria | 14370 |
| 322 | Ga0207711_10060382 | 3300025941 | Bacteria | 3267 |
| 323 | Ga0207711_10335816 | 3300025941 | Bacteria | 1398 |
| 324 | Ga0207711_10404093 | 3300025941 | Bacteria | 1269 |
| 325 | Ga0207689_10000182 | 3300025942 | Bacteria | 54476 |
| 326 | Ga0207689_10065887 | 3300025942 | Bacteria | 2979 |
| 327 | Ga0207689_11050887 | 3300025942 | Bacteria | 687 |
| 328 | Ga0207661_10497883 | 3300025944 | Bacteria | 1113 |
| 329 | Ga0207679_10044041 | 3300025945 | Bacteria | 3218 |
| 330 | Ga0207679_10067699 | 3300025945 | Bacteria | 2680 |
| 331 | Ga0207667_10007486 | 3300025949 | Bacteria | 13111 |
| 332 | Ga0207667_10013523 | 3300025949 | Bacteria | 9332 |
| 333 | Ga0207667_10735269 | 3300025949 | Bacteria | 987 |
| 334 | Ga0207667_11379433 | 3300025949 | Bacteria | 679 |
| 335 | Ga0207667_11383547 | 3300025949 | Bacteria | 678 |
| 336 | Ga0207651_10004393 | 3300025960 | Bacteria | 7096 |
| 337 | Ga0207651_10039220 | 3300025960 | Bacteria | 3121 |
| 338 | Ga0207651_10257550 | 3300025960 | Bacteria | 1431 |
| 339 | Ga0207651_10259317 | 3300025960 | Bacteria | 1426 |
| 340 | Ga0207651_10451071 | 3300025960 | Bacteria | 1103 |
| 341 | Ga0207712_10086969 | 3300025961 | Bacteria | 2291 |
| 342 | Ga0207712_10169636 | 3300025961 | Bacteria | 1704 |
| 343 | Ga0207712_10610657 | 3300025961 | Bacteria | 944 |
| 344 | Ga0207712_11047616 | 3300025961 | Bacteria | 725 |
| 345 | Ga0207668_10000050 | 3300025972 | Bacteria | 98767 |
| 346 | Ga0207668_10006477 | 3300025972 | Bacteria | 6924 |
| 347 | Ga0207668_10067122 | 3300025972 | Bacteria | 2546 |
| 348 | Ga0207668_10146889 | 3300025972 | Bacteria | 1820 |
| 349 | Ga0207668_11032761 | 3300025972 | Bacteria | 735 |
| 350 | Ga0207640_10000849 | 3300025981 | Bacteria | 17357 |
| 351 | Ga0207640_10727931 | 3300025981 | Bacteria | 853 |
| 352 | Ga0207658_10002786 | 3300025986 | Bacteria | 12583 |
| 353 | Ga0207658_10018210 | 3300025986 | Bacteria | 4846 |
| 354 | Ga0207658_10037004 | 3300025986 | Bacteria | 3503 |
| 355 | Ga0207658_10086859 | 3300025986 | Bacteria | 2413 |
| 356 | Ga0207658_10112529 | 3300025986 | Bacteria | 2154 |
| 357 | Ga0207658_10465319 | 3300025986 | Bacteria | 1121 |
| 358 | Ga0207658_10564545 | 3300025986 | Bacteria | 1019 |
| 359 | Ga0207658_10759345 | 3300025986 | Bacteria | 878 |
| 360 | Ga0207677_10003889 | 3300026023 | Bacteria | 7950 |
| 361 | Ga0207677_10124677 | 3300026023 | Bacteria | 1944 |
| 362 | Ga0207677_10486508 | 3300026023 | Bacteria | 1064 |
| 363 | Ga0207703_10012911 | 3300026035 | Bacteria | 6510 |
| 364 | Ga0207703_10075760 | 3300026035 | Bacteria | 2789 |
| 365 | Ga0207703_10330125 | 3300026035 | Bacteria | 1399 |
| 366 | Ga0207639_10002353 | 3300026041 | Bacteria | 12700 |
| 367 | Ga0207639_10091249 | 3300026041 | Bacteria | 2438 |
| 368 | Ga0207639_10092070 | 3300026041 | Bacteria | 2429 |
| 369 | Ga0207639_11581128 | 3300026041 | Bacteria | 615 |
| 370 | Ga0207678_10000680 | 3300026067 | Bacteria | 31116 |
| 371 | Ga0207678_10425495 | 3300026067 | Bacteria | 1152 |
| 372 | Ga0207702_10339198 | 3300026078 | Bacteria | 1435 |
| 373 | Ga0207641_10004210 | 3300026088 | Bacteria | 12546 |
| 374 | Ga0207641_10020495 | 3300026088 | Bacteria | 5430 |
| 375 | Ga0207641_10213268 | 3300026088 | Bacteria | 1786 |
| 376 | Ga0207641_10528199 | 3300026088 | Bacteria | 1148 |
| 377 | Ga0207641_11640595 | 3300026088 | Bacteria | 645 |
| 378 | Ga0207648_10000222 | 3300026089 | Bacteria | 61156 |
| 379 | Ga0207648_10000477 | 3300026089 | Bacteria | 44735 |
| 380 | Ga0207648_10003597 | 3300026089 | Bacteria | 16210 |
| 381 | Ga0207648_10217515 | 3300026089 | Bacteria | 1697 |
| 382 | Ga0207676_10000878 | 3300026095 | Bacteria | 23329 |
| 383 | Ga0207676_10895937 | 3300026095 | Bacteria | 870 |
| 384 | Ga0207676_11455844 | 3300026095 | Bacteria | 681 |
| 385 | Ga0207676_11898551 | 3300026095 | Bacteria | 594 |
| 386 | Ga0207674_10003802 | 3300026116 | Bacteria | 18408 |
| 387 | Ga0207674_10006997 | 3300026116 | Bacteria | 13192 |
| 388 | Ga0207674_10016334 | 3300026116 | Bacteria | 8131 |
| 389 | Ga0207674_10075903 | 3300026116 | Bacteria | 3370 |
| 390 | Ga0207674_11651563 | 3300026116 | Bacteria | 609 |
| 391 | Ga0207675_100017759 | 3300026118 | Bacteria | 6636 |
| 392 | Ga0207675_101720161 | 3300026118 | Bacteria | 647 |
| 393 | Ga0207683_10002113 | 3300026121 | Bacteria | 17472 |
| 394 | Ga0207683_10060194 | 3300026121 | Bacteria | 3338 |
| 395 | Ga0207683_10479182 | 3300026121 | Bacteria | 1148 |
| 396 | Ga0207698_10004080 | 3300026142 | Bacteria | 8867 |
| 397 | Ga0207698_10010501 | 3300026142 | Bacteria | 5958 |
| 398 | Ga0207698_10200038 | 3300026142 | Bacteria | 1788 |
| 399 | Ga0207698_10761921 | 3300026142 | Bacteria | 968 |
| 400 | Ga0209973_1038867 | 3300027252 | Bacteria | 692 |
| 401 | Ga0209969_1016551 | 3300027360 | Bacteria | 1082 |
| 402 | Ga0210000_1013298 | 3300027462 | Bacteria | 1227 |
| 403 | Ga0209995_1060033 | 3300027471 | Bacteria | 647 |
| 404 | Ga0209179_1000014 | 3300027512 | Bacteria | 53305 |
| 405 | Ga0209982_1026794 | 3300027552 | Bacteria | 900 |
| 406 | Ga0209970_1010294 | 3300027614 | Bacteria | 1529 |
| 407 | Ga0209983_1033212 | 3300027665 | Bacteria | 1104 |
| 408 | Ga0209971_1003425 | 3300027682 | Bacteria | 3764 |
| 409 | Ga0209974_10006175 | 3300027876 | Bacteria | 4197 |
| 410 | Ga0268266_10002448 | 3300028379 | Bacteria | 19913 |
| 411 | Ga0268266_10035224 | 3300028379 | Bacteria | 4258 |
| 412 | Ga0268266_10088810 | 3300028379 | Bacteria | 2705 |
| 413 | Ga0268266_10490393 | 3300028379 | Bacteria | 1172 |
| 414 | Ga0268266_10763707 | 3300028379 | Bacteria | 933 |
| 415 | Ga0268265_10093811 | 3300028380 | Bacteria | 2405 |
| 416 | Ga0268265_10094838 | 3300028380 | Bacteria | 2394 |
| 417 | Ga0268265_10192299 | 3300028380 | Bacteria | 1763 |
| 418 | Ga0268265_10218757 | 3300028380 | Bacteria | 1665 |
| 419 | Ga0268265_10872528 | 3300028380 | Bacteria | 882 |
| 420 | Ga0268265_12370466 | 3300028380 | Bacteria | 537 |
| 421 | Ga0268264_10000645 | 3300028381 | Bacteria | 41090 |
| 422 | Ga0268264_10073507 | 3300028381 | Bacteria | 2902 |
| 423 | Ga0268264_10387047 | 3300028381 | Bacteria | 1340 |
| 424 | Ga0268264_11221639 | 3300028381 | Bacteria | 761 |
| 425 | Ga0307515_10275765 | 3300028794 | Bacteria | 1396 |
| 426 | Ga0307511_10204396 | 3300030521 | Bacteria | 1019 |
| 427 | Ga0265340_10193634 | 3300031247 | Bacteria | 916 |
| 428 | Ga0307513_10038130 | 3300031456 | Bacteria | 5339 |
| 429 | Ga0307513_10082408 | 3300031456 | Bacteria | 3312 |
| 430 | Ga0307408_100661092 | 3300031548 | Bacteria | 935 |
| 431 | Ga0316579_10399559 | 3300031691 | Unclassified | 664 |
| 432 | Ga0307516_10025610 | 3300031730 | Bacteria | 6005 |
| 433 | Ga0307405_11438230 | 3300031731 | Bacteria | 604 |
| 434 | Ga0316577_10382028 | 3300031733 | Unclassified | 800 |
| 435 | Ga0307413_10193415 | 3300031824 | Bacteria | 1462 |
| 436 | Ga0307413_11639359 | 3300031824 | Bacteria | 572 |
| 437 | Ga0307410_10444340 | 3300031852 | Bacteria | 1056 |
| 438 | Ga0307410_11529302 | 3300031852 | Bacteria | 588 |
| 439 | Ga0307406_10126762 | 3300031901 | Bacteria | 1785 |
| 440 | Ga0307407_10057224 | 3300031903 | Bacteria | 2261 |
| 441 | Ga0307412_10634786 | 3300031911 | Bacteria | 909 |
| 442 | Ga0307409_100437225 | 3300031995 | Bacteria | 1259 |
| 443 | Ga0307409_100465863 | 3300031995 | Bacteria | 1223 |
| 444 | Ga0307409_101057544 | 3300031995 | Bacteria | 832 |
| 445 | Ga0307409_102476498 | 3300031995 | Bacteria | 548 |
| 446 | Ga0307416_103283820 | 3300032002 | Bacteria | 541 |
| 447 | Ga0307414_10573990 | 3300032004 | Bacteria | 1008 |
| 448 | Ga0307414_10955527 | 3300032004 | Bacteria | 787 |
| 449 | Ga0307414_11620255 | 3300032004 | Bacteria | 603 |
| 450 | Ga0307414_11660943 | 3300032004 | Bacteria | 596 |
| 451 | Ga0307411_10438491 | 3300032005 | Bacteria | 1089 |
| 452 | Ga0307415_100772668 | 3300032126 | Bacteria | 874 |
| 453 | Ga0373952_0266945 | 3300035092 | Bacteria | 523 |
| 454 | Ga0316584_0140423 | 3300036712 | Unclassified | 1802 |
| 455 | Ga0395899_0407272 | 3300037312 | Bacteria | 899 |
| 456 | Ga0395900_0253253 | 3300037418 | Bacteria | 1761 |
| 457 | Ga0395900_0298544 | 3300037418 | Bacteria | 1598 |
| 458 | Ga0395900_1058379 | 3300037418 | Bacteria | 729 |
| 459 | Ga0395905_0006451 | 3300037471 | Bacteria | 11809 |
| 460 | Ga0395905_0036802 | 3300037471 | Bacteria | 4597 |
| 461 | Ga0395905_0039424 | 3300037471 | Bacteria | 4432 |
| 462 | Ga0395905_0227237 | 3300037471 | Bacteria | 1745 |
| 463 | Ga0395905_0320091 | 3300037471 | Bacteria | 1441 |
| 464 | Ga0395901_0023925 | 3300038443 | Bacteria | 6266 |
| 465 | Ga0395901_0126078 | 3300038443 | Bacteria | 2691 |
| 466 | Ga0395901_0442995 | 3300038443 | Bacteria | 1329 |
| 467 | Ga0395901_0570200 | 3300038443 | Bacteria | 1145 |
| 468 | Ga0439436_0020648 | 3300041404 | Bacteria | 1961 |
| 469 | Ga0439436_0032372 | 3300041404 | Bacteria | 1516 |
| 470 | Ga0439465_0024130 | 3300041413 | Bacteria | 1916 |
| 471 | Ga0451800_0467010 | 3300041459 | Bacteria | 693 |
| 472 | Ga0451807_1240268 | 3300041486 | Bacteria | 1588 |
| 473 | Ga0451833_0733127 | 3300041491 | Bacteria | 912 |
| 474 | Ga0451853_0362294 | 3300041512 | Bacteria | 852 |
| 475 | Ga0451853_1185443 | 3300041512 | Bacteria | 856 |
| 476 | Ga0439433_0033126 | 3300041999 | Bacteria | 1187 |
| 477 | Ga0439432_007949 | 3300042006 | Bacteria | 3741 |
| 478 | Ga0439432_093964 | 3300042006 | Bacteria | 901 |
| 479 | Ga0439449_0022599 | 3300042007 | Bacteria | 2355 |
| 480 | Ga0439449_0053628 | 3300042007 | Bacteria | 1491 |
| 481 | Ga0439449_0298026 | 3300042007 | Bacteria | 608 |
| 482 | Ga0439452_057420 | 3300042010 | Bacteria | 878 |
| 483 | Ga0439455_0122717 | 3300042012 | Bacteria | 729 |
| 484 | Ga0439457_159056 | 3300042014 | Bacteria | 546 |
| 485 | Ga0439462_0006982 | 3300042015 | Bacteria | 2820 |
| 486 | Ga0450892_017013 | 3300042130 | Bacteria | 689 |
| 487 | Ga0439446_0061907 | 3300042156 | Bacteria | 1133 |
| 488 | Ga0439458_0132410 | 3300042157 | Bacteria | 661 |
| 489 | Ga0466969_0106570 | 3300044656 | Bacteria | 1315 |
| 490 | Ga0466966_0102078 | 3300044684 | Bacteria | 1773 |
| 491 | Ga0466961_0074249 | 3300044693 | Bacteria | 2156 |
| 492 | Ga0466970_0243789 | 3300044765 | Bacteria | 1006 |
| 493 | Ga0466959_0456053 | 3300045049 | Bacteria | 866 |
| 494 | Ga0495638_0445815 | 3300046460 | Bacteria | 662 |
| 495 | Ga0495663_0012698 | 3300046525 | Bacteria | 2349 |
| 496 | Ga0495663_0042795 | 3300046525 | Bacteria | 1381 |
| 497 | Ga0495663_0239231 | 3300046525 | Bacteria | 642 |
| 498 | Ga0495598_0016997 | 3300046537 | Bacteria | 1868 |
| 499 | Ga0495621_0002303 | 3300046539 | Bacteria | 5122 |
| 500 | Ga0495621_0017566 | 3300046539 | Bacteria | 2314 |
| 501 | Ga0495621_0107625 | 3300046539 | Bacteria | 1066 |
| 502 | Ga0495621_0241441 | 3300046539 | Bacteria | 736 |
| 503 | Ga0495633_0031366 | 3300046558 | Bacteria | 2577 |
| 504 | Ga0495633_0219991 | 3300046558 | Bacteria | 869 |
| 505 | Ga0495625_0601671 | 3300046660 | Bacteria | 660 |
| 506 | Ga0495669_0013113 | 3300046684 | Bacteria | 3530 |
| 507 | Ga0495669_0086314 | 3300046684 | Bacteria | 1445 |
| 508 | Ga0495670_0016612 | 3300046691 | Bacteria | 3619 |
| 509 | Ga0495670_0039391 | 3300046691 | Bacteria | 2357 |
| 510 | Ga0495604_0804532 | 3300047317 | Bacteria | 592 |
| 511 | Ga0495677_0098825 | 3300047445 | Bacteria | 1104 |
| 512 | Ga0496104_1154589 | 3300048907 | Bacteria | 678 |
| 513 | Ga0496106_0241385 | 3300048909 | Bacteria | 1444 |
| 514 | Ga0496109_0951085 | 3300048912 | Bacteria | 797 |
| 515 | Ga0496110_0362933 | 3300048913 | Bacteria | 1320 |
| 516 | Ga0496111_0485344 | 3300048914 | Bacteria | 910 |
| 517 | Ga0496114_0033955 | 3300048917 | Bacteria | 4206 |
| 518 | Ga0496121_0323272 | 3300048924 | Bacteria | 1038 |
| 519 | Ga0496124_0502407 | 3300048927 | Bacteria | 813 |
| 520 | Ga0496125_0384236 | 3300048928 | Bacteria | 826 |
| 521 | Ga0501198_094406 | 3300049649 | Bacteria | 598 |
| 522 | Ga0501217_197217 | 3300049661 | Bacteria | 625 |
| 523 | Ga0501223_036730 | 3300049663 | Bacteria | 952 |
| 524 | Ga0501223_084624 | 3300049663 | Bacteria | 638 |
| 525 | Ga0501250_077319 | 3300049680 | Bacteria | 560 |
| 526 | Ga0501045_0582660 | 3300049824 | Bacteria | 829 |
| 527 | nmdc:mga08y16_1269840_c1 | 3300050511 | Bacteria | 704 |
| 528 | nmdc:mga0a205_770596_c1 | 3300050515 | Bacteria | 810 |
| 529 | Ga0495612_0577198 | 3300053078 | Bacteria | 519 |
| 530 | Ga0500651_0002997 | 3300053093 | Bacteria | 9108 |
| 531 | Ga0500628_063816 | 3300053129 | Bacteria | 906 |
| 532 | Ga0500568_0156005 | 3300053139 | Bacteria | 844 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035092 | Ga0373952_0266945 | Ga0373952_0266945_21_251 | 61 |
| 2 | 3300003781 | Ga0055536_1000001 | Ga0055536_1000001131 | 66 |
| 3 | 3300003791 | Ga0055530_10002525 | Ga0055530_100025259 | 66 |
| 4 | iso_pu_bacteria | 2643221695 | 2644529059 | 66 |
| 5 | iso_pu_bacteria | 2885427238 | 2885429251 | 66 |
| 6 | 3300005290 | Ga0065712_10392011 | Ga0065712_103920112 | 68 |
| 7 | 3300005293 | Ga0065715_10309893 | Ga0065715_103098932 | 68 |
| 8 | 3300005293 | Ga0065715_10472983 | Ga0065715_104729832 | 68 |
| 9 | 3300005331 | Ga0070670_100164833 | Ga0070670_1001648333 | 68 |
| 10 | 3300005339 | Ga0070660_101065505 | Ga0070660_1010655052 | 68 |
| 11 | 3300005347 | Ga0070668_100985284 | Ga0070668_1009852842 | 68 |
| 12 | 3300005353 | Ga0070669_100968027 | Ga0070669_1009680272 | 68 |
| 13 | 3300005354 | Ga0070675_100057554 | Ga0070675_1000575542 | 68 |
| 14 | 3300005364 | Ga0070673_100392851 | Ga0070673_1003928511 | 68 |
| 15 | 3300005366 | Ga0070659_100019869 | Ga0070659_1000198692 | 68 |
| 16 | 3300005457 | Ga0070662_100257974 | Ga0070662_1002579742 | 68 |
| 17 | 3300005535 | Ga0070684_100172293 | Ga0070684_1001722934 | 68 |
| 18 | 3300005539 | Ga0068853_100523933 | Ga0068853_1005239331 | 68 |
| 19 | 3300005543 | Ga0070672_100232470 | Ga0070672_1002324703 | 68 |
| 20 | 3300013100 | Ga0157373_10048822 | Ga0157373_100488224 | 68 |
| 21 | 3300013102 | Ga0157371_10343656 | Ga0157371_103436562 | 68 |
| 22 | 3300044656 | Ga0466969_0106570 | Ga0466969_0106570_761_976 | 68 |
| 23 | 3300044684 | Ga0466966_0102078 | Ga0466966_0102078_579_794 | 68 |
| 24 | 3300044693 | Ga0466961_0074249 | Ga0466961_0074249_998_1213 | 68 |
| 25 | 3300044765 | Ga0466970_0243789 | Ga0466970_0243789_614_829 | 68 |
| 26 | 3300045049 | Ga0466959_0456053 | Ga0466959_0456053_523_738 | 68 |
| 27 | 3300001915 | JGI24741J21665_1061888 | JGI24741J21665_10618882 | 69 |
| 28 | 3300005577 | Ga0068857_100112891 | Ga0068857_1001128913 | 69 |
| 29 | 3300026116 | Ga0207674_10003802 | Ga0207674_1000380214 | 69 |
| 30 | 3300028794 | Ga0307515_10275765 | Ga0307515_102757652 | 69 |
| 31 | 3300031247 | Ga0265340_10193634 | Ga0265340_101936342 | 69 |
| 32 | 3300031456 | Ga0307513_10038130 | Ga0307513_100381308 | 69 |
| 33 | 3300031456 | Ga0307513_10082408 | Ga0307513_100824082 | 69 |
| 34 | 3300031824 | Ga0307413_10193415 | Ga0307413_101934152 | 69 |
| 35 | 3300031852 | Ga0307410_10444340 | Ga0307410_104443402 | 69 |
| 36 | 3300031903 | Ga0307407_10057224 | Ga0307407_100572243 | 69 |
| 37 | 3300031995 | Ga0307409_100437225 | Ga0307409_1004372252 | 69 |
| 38 | 3300032004 | Ga0307414_10955527 | Ga0307414_109555272 | 69 |
| 39 | 3300037312 | Ga0395899_0407272 | Ga0395899_0407272_91_300 | 69 |
| 40 | 3300037418 | Ga0395900_0298544 | Ga0395900_0298544_1043_1252 | 69 |
| 41 | 3300037471 | Ga0395905_0036802 | Ga0395905_0036802_2950_3159 | 69 |
| 42 | 3300037471 | Ga0395905_0320091 | Ga0395905_0320091_969_1178 | 69 |
| 43 | 3300038443 | Ga0395901_0126078 | Ga0395901_0126078_1737_1946 | 69 |
| 44 | 3300038443 | Ga0395901_0570200 | Ga0395901_0570200_617_826 | 69 |
| 45 | 3300001915 | JGI24741J21665_1009536 | JGI24741J21665_10095363 | 70 |
| 46 | 3300001979 | JGI24740J21852_10000281 | JGI24740J21852_1000028115 | 70 |
| 47 | 3300001979 | JGI24740J21852_10001858 | JGI24740J21852_1000185810 | 70 |
| 48 | 3300001989 | JGI24739J22299_10000453 | JGI24739J22299_100004537 | 70 |
| 49 | 3300001989 | JGI24739J22299_10028526 | JGI24739J22299_100285263 | 70 |
| 50 | 3300001991 | JGI24743J22301_10003697 | JGI24743J22301_100036973 | 70 |
| 51 | 3300002067 | JGI24735J21928_10116153 | JGI24735J21928_101161532 | 70 |
| 52 | 3300002067 | JGI24735J21928_10205939 | JGI24735J21928_102059392 | 70 |
| 53 | 3300002073 | JGI24745J21846_1049948 | JGI24745J21846_10499482 | 70 |
| 54 | 3300002075 | JGI24738J21930_10000062 | JGI24738J21930_1000006219 | 70 |
| 55 | 3300002075 | JGI24738J21930_10007364 | JGI24738J21930_100073643 | 70 |
| 56 | 3300002239 | JGI24034J26672_10056892 | JGI24034J26672_100568922 | 70 |
| 57 | 3300002244 | JGI24742J22300_10022402 | JGI24742J22300_100224023 | 70 |
| 58 | 3300003322 | rootL2_10045740 | rootL2_100457406 | 70 |
| 59 | 3300003371 | JGI26145J50221_1017606 | JGI26145J50221_10176062 | 70 |
| 60 | 3300005293 | Ga0065715_11180609 | Ga0065715_111806092 | 70 |
| 61 | 3300005295 | Ga0065707_10276566 | Ga0065707_102765663 | 70 |
| 62 | 3300005327 | Ga0070658_10383998 | Ga0070658_103839982 | 70 |
| 63 | 3300005328 | Ga0070676_10002169 | Ga0070676_100021697 | 70 |
| 64 | 3300005328 | Ga0070676_10003504 | Ga0070676_100035044 | 70 |
| 65 | 3300005328 | Ga0070676_10011228 | Ga0070676_100112284 | 70 |
| 66 | 3300005329 | Ga0070683_100493296 | Ga0070683_1004932962 | 70 |
| 67 | 3300005330 | Ga0070690_100018652 | Ga0070690_1000186525 | 70 |
| 68 | 3300005331 | Ga0070670_100007258 | Ga0070670_10000725810 | 70 |
| 69 | 3300005331 | Ga0070670_100010365 | Ga0070670_1000103659 | 70 |
| 70 | 3300005331 | Ga0070670_100211938 | Ga0070670_1002119382 | 70 |
| 71 | 3300005333 | Ga0070677_10333173 | Ga0070677_103331732 | 70 |
| 72 | 3300005333 | Ga0070677_10387166 | Ga0070677_103871661 | 70 |
| 73 | 3300005334 | Ga0068869_100034193 | Ga0068869_1000341936 | 70 |
| 74 | 3300005334 | Ga0068869_100071883 | Ga0068869_1000718832 | 70 |
| 75 | 3300005334 | Ga0068869_101238510 | Ga0068869_1012385102 | 70 |
| 76 | 3300005335 | Ga0070666_10072348 | Ga0070666_100723482 | 70 |
| 77 | 3300005335 | Ga0070666_10213518 | Ga0070666_102135182 | 70 |
| 78 | 3300005337 | Ga0070682_100265687 | Ga0070682_1002656872 | 70 |
| 79 | 3300005338 | Ga0068868_100000637 | Ga0068868_1000006378 | 70 |
| 80 | 3300005338 | Ga0068868_100403480 | Ga0068868_1004034803 | 70 |
| 81 | 3300005338 | Ga0068868_101275133 | Ga0068868_1012751332 | 70 |
| 82 | 3300005339 | Ga0070660_100002082 | Ga0070660_10000208212 | 70 |
| 83 | 3300005339 | Ga0070660_100040988 | Ga0070660_1000409884 | 70 |
| 84 | 3300005340 | Ga0070689_100009615 | Ga0070689_1000096155 | 70 |
| 85 | 3300005340 | Ga0070689_101006175 | Ga0070689_1010061752 | 70 |
| 86 | 3300005343 | Ga0070687_100235595 | Ga0070687_1002355952 | 70 |
| 87 | 3300005344 | Ga0070661_100061480 | Ga0070661_1000614804 | 70 |
| 88 | 3300005344 | Ga0070661_100338365 | Ga0070661_1003383652 | 70 |
| 89 | 3300005347 | Ga0070668_100005175 | Ga0070668_10000517512 | 70 |
| 90 | 3300005347 | Ga0070668_100032860 | Ga0070668_1000328603 | 70 |
| 91 | 3300005347 | Ga0070668_100070106 | Ga0070668_1000701063 | 70 |
| 92 | 3300005347 | Ga0070668_100142841 | Ga0070668_1001428412 | 70 |
| 93 | 3300005347 | Ga0070668_100727650 | Ga0070668_1007276502 | 70 |
| 94 | 3300005347 | Ga0070668_101213518 | Ga0070668_1012135182 | 70 |
| 95 | 3300005353 | Ga0070669_100000862 | Ga0070669_1000008626 | 70 |
| 96 | 3300005353 | Ga0070669_100059502 | Ga0070669_1000595023 | 70 |
| 97 | 3300005353 | Ga0070669_100118774 | Ga0070669_1001187743 | 70 |
| 98 | 3300005354 | Ga0070675_100047334 | Ga0070675_1000473343 | 70 |
| 99 | 3300005354 | Ga0070675_100237497 | Ga0070675_1002374972 | 70 |
| 100 | 3300005355 | Ga0070671_100094852 | Ga0070671_1000948524 | 70 |
| 101 | 3300005355 | Ga0070671_100157220 | Ga0070671_1001572202 | 70 |
| 102 | 3300005355 | Ga0070671_100158914 | Ga0070671_1001589141 | 70 |
| 103 | 3300005355 | Ga0070671_100224615 | Ga0070671_1002246152 | 70 |
| 104 | 3300005356 | Ga0070674_100001982 | Ga0070674_1000019825 | 70 |
| 105 | 3300005356 | Ga0070674_100051087 | Ga0070674_1000510872 | 70 |
| 106 | 3300005356 | Ga0070674_100054275 | Ga0070674_1000542752 | 70 |
| 107 | 3300005356 | Ga0070674_102013308 | Ga0070674_1020133081 | 70 |
| 108 | 3300005364 | Ga0070673_100000209 | Ga0070673_10000020911 | 70 |
| 109 | 3300005364 | Ga0070673_100050975 | Ga0070673_1000509753 | 70 |
| 110 | 3300005364 | Ga0070673_100096310 | Ga0070673_1000963102 | 70 |
| 111 | 3300005364 | Ga0070673_100446684 | Ga0070673_1004466843 | 70 |
| 112 | 3300005364 | Ga0070673_102075286 | Ga0070673_1020752861 | 70 |
| 113 | 3300005365 | Ga0070688_100046454 | Ga0070688_1000464544 | 70 |
| 114 | 3300005366 | Ga0070659_100007835 | Ga0070659_1000078356 | 70 |
| 115 | 3300005366 | Ga0070659_100679062 | Ga0070659_1006790621 | 70 |
| 116 | 3300005367 | Ga0070667_100004734 | Ga0070667_1000047347 | 70 |
| 117 | 3300005367 | Ga0070667_100021153 | Ga0070667_1000211536 | 70 |
| 118 | 3300005367 | Ga0070667_100047130 | Ga0070667_1000471303 | 70 |
| 119 | 3300005367 | Ga0070667_100090330 | Ga0070667_1000903303 | 70 |
| 120 | 3300005367 | Ga0070667_100277726 | Ga0070667_1002777262 | 70 |
| 121 | 3300005455 | Ga0070663_100090984 | Ga0070663_1000909843 | 70 |
| 122 | 3300005455 | Ga0070663_100186768 | Ga0070663_1001867682 | 70 |
| 123 | 3300005456 | Ga0070678_100009113 | Ga0070678_1000091136 | 70 |
| 124 | 3300005456 | Ga0070678_100123475 | Ga0070678_1001234753 | 70 |
| 125 | 3300005456 | Ga0070678_101126115 | Ga0070678_1011261151 | 70 |
| 126 | 3300005457 | Ga0070662_100001955 | Ga0070662_1000019555 | 70 |
| 127 | 3300005457 | Ga0070662_100023820 | Ga0070662_1000238204 | 70 |
| 128 | 3300005459 | Ga0068867_100000633 | Ga0068867_10000063326 | 70 |
| 129 | 3300005459 | Ga0068867_100011413 | Ga0068867_1000114135 | 70 |
| 130 | 3300005459 | Ga0068867_100280746 | Ga0068867_1002807462 | 70 |
| 131 | 3300005459 | Ga0068867_100426594 | Ga0068867_1004265942 | 70 |
| 132 | 3300005459 | Ga0068867_101247915 | Ga0068867_1012479152 | 70 |
| 133 | 3300005466 | Ga0070685_10627910 | Ga0070685_106279102 | 70 |
| 134 | 3300005466 | Ga0070685_11421709 | Ga0070685_114217091 | 70 |
| 135 | 3300005535 | Ga0070684_100274351 | Ga0070684_1002743513 | 70 |
| 136 | 3300005539 | Ga0068853_100002063 | Ga0068853_10000206315 | 70 |
| 137 | 3300005539 | Ga0068853_100072330 | Ga0068853_1000723302 | 70 |
| 138 | 3300005539 | Ga0068853_100367506 | Ga0068853_1003675062 | 70 |
| 139 | 3300005539 | Ga0068853_101221415 | Ga0068853_1012214152 | 70 |
| 140 | 3300005543 | Ga0070672_100000770 | Ga0070672_10000077017 | 70 |
| 141 | 3300005543 | Ga0070672_100017202 | Ga0070672_1000172026 | 70 |
| 142 | 3300005544 | Ga0070686_100432174 | Ga0070686_1004321742 | 70 |
| 143 | 3300005548 | Ga0070665_100020763 | Ga0070665_1000207633 | 70 |
| 144 | 3300005548 | Ga0070665_100113415 | Ga0070665_1001134153 | 70 |
| 145 | 3300005548 | Ga0070665_100205173 | Ga0070665_1002051734 | 70 |
| 146 | 3300005548 | Ga0070665_100219334 | Ga0070665_1002193343 | 70 |
| 147 | 3300005548 | Ga0070665_100772776 | Ga0070665_1007727762 | 70 |
| 148 | 3300005548 | Ga0070665_101677195 | Ga0070665_1016771952 | 70 |
| 149 | 3300005548 | Ga0070665_102245599 | Ga0070665_1022455992 | 70 |
| 150 | 3300005563 | Ga0068855_100032514 | Ga0068855_1000325145 | 70 |
| 151 | 3300005563 | Ga0068855_100039372 | Ga0068855_1000393726 | 70 |
| 152 | 3300005563 | Ga0068855_102198285 | Ga0068855_1021982852 | 70 |
| 153 | 3300005564 | Ga0070664_100009081 | Ga0070664_1000090815 | 70 |
| 154 | 3300005564 | Ga0070664_100535128 | Ga0070664_1005351281 | 70 |
| 155 | 3300005577 | Ga0068857_100004161 | Ga0068857_1000041615 | 70 |
| 156 | 3300005577 | Ga0068857_100055828 | Ga0068857_1000558284 | 70 |
| 157 | 3300005577 | Ga0068857_100123051 | Ga0068857_1001230513 | 70 |
| 158 | 3300005578 | Ga0068854_100000614 | Ga0068854_10000061420 | 70 |
| 159 | 3300005578 | Ga0068854_100174976 | Ga0068854_1001749763 | 70 |
| 160 | 3300005614 | Ga0068856_101558655 | Ga0068856_1015586552 | 70 |
| 161 | 3300005616 | Ga0068852_100000804 | Ga0068852_10000080421 | 70 |
| 162 | 3300005616 | Ga0068852_100040971 | Ga0068852_1000409713 | 70 |
| 163 | 3300005616 | Ga0068852_100046769 | Ga0068852_1000467691 | 70 |
| 164 | 3300005616 | Ga0068852_100845172 | Ga0068852_1008451722 | 70 |
| 165 | 3300005616 | Ga0068852_101668583 | Ga0068852_1016685832 | 70 |
| 166 | 3300005617 | Ga0068859_100000478 | Ga0068859_10000047835 | 70 |
| 167 | 3300005617 | Ga0068859_100081304 | Ga0068859_1000813044 | 70 |
| 168 | 3300005617 | Ga0068859_100362012 | Ga0068859_1003620122 | 70 |
| 169 | 3300005617 | Ga0068859_100423511 | Ga0068859_1004235112 | 70 |
| 170 | 3300005617 | Ga0068859_101715419 | Ga0068859_1017154192 | 70 |
| 171 | 3300005617 | Ga0068859_101824558 | Ga0068859_1018245582 | 70 |
| 172 | 3300005618 | Ga0068864_100000174 | Ga0068864_10000017470 | 70 |
| 173 | 3300005618 | Ga0068864_100080716 | Ga0068864_1000807162 | 70 |
| 174 | 3300005618 | Ga0068864_101021095 | Ga0068864_1010210951 | 70 |
| 175 | 3300005618 | Ga0068864_101048728 | Ga0068864_1010487281 | 70 |
| 176 | 3300005718 | Ga0068866_10167121 | Ga0068866_101671213 | 70 |
| 177 | 3300005719 | Ga0068861_100010621 | Ga0068861_1000106213 | 70 |
| 178 | 3300005719 | Ga0068861_100466169 | Ga0068861_1004661692 | 70 |
| 179 | 3300005834 | Ga0068851_11006818 | Ga0068851_110068182 | 70 |
| 180 | 3300005840 | Ga0068870_10123162 | Ga0068870_101231623 | 70 |
| 181 | 3300005840 | Ga0068870_10170620 | Ga0068870_101706202 | 70 |
| 182 | 3300005840 | Ga0068870_10740287 | Ga0068870_107402872 | 70 |
| 183 | 3300005841 | Ga0068863_100004878 | Ga0068863_1000048786 | 70 |
| 184 | 3300005841 | Ga0068863_100076008 | Ga0068863_1000760082 | 70 |
| 185 | 3300005841 | Ga0068863_100106113 | Ga0068863_1001061133 | 70 |
| 186 | 3300005841 | Ga0068863_101086016 | Ga0068863_1010860162 | 70 |
| 187 | 3300005842 | Ga0068858_100068281 | Ga0068858_1000682813 | 70 |
| 188 | 3300005842 | Ga0068858_100372130 | Ga0068858_1003721302 | 70 |
| 189 | 3300005842 | Ga0068858_100374413 | Ga0068858_1003744131 | 70 |
| 190 | 3300005843 | Ga0068860_100005690 | Ga0068860_10000569010 | 70 |
| 191 | 3300005843 | Ga0068860_100005831 | Ga0068860_1000058313 | 70 |
| 192 | 3300005843 | Ga0068860_100412817 | Ga0068860_1004128172 | 70 |
| 193 | 3300005844 | Ga0068862_100071036 | Ga0068862_1000710363 | 70 |
| 194 | 3300005844 | Ga0068862_100121478 | Ga0068862_1001214781 | 70 |
| 195 | 3300005844 | Ga0068862_100315881 | Ga0068862_1003158811 | 70 |
| 196 | 3300005844 | Ga0068862_100468845 | Ga0068862_1004688452 | 70 |
| 197 | 3300005844 | Ga0068862_100726929 | Ga0068862_1007269292 | 70 |
| 198 | 3300005983 | Ga0081540_1007109 | Ga0081540_10071098 | 70 |
| 199 | 3300006237 | Ga0097621_100013235 | Ga0097621_1000132355 | 70 |
| 200 | 3300006237 | Ga0097621_100688329 | Ga0097621_1006883292 | 70 |
| 201 | 3300006237 | Ga0097621_102337665 | Ga0097621_1023376651 | 70 |
| 202 | 3300006358 | Ga0068871_100003110 | Ga0068871_1000031108 | 70 |
| 203 | 3300006358 | Ga0068871_100031973 | Ga0068871_1000319732 | 70 |
| 204 | 3300006358 | Ga0068871_100135529 | Ga0068871_1001355295 | 70 |
| 205 | 3300006358 | Ga0068871_100687354 | Ga0068871_1006873542 | 70 |
| 206 | 3300006844 | Ga0075428_100146442 | Ga0075428_1001464422 | 70 |
| 207 | 3300006852 | Ga0075433_10946217 | Ga0075433_109462172 | 70 |
| 208 | 3300006881 | Ga0068865_100000240 | Ga0068865_10000024018 | 70 |
| 209 | 3300006881 | Ga0068865_100078003 | Ga0068865_1000780032 | 70 |
| 210 | 3300006881 | Ga0068865_100805832 | Ga0068865_1008058322 | 70 |
| 211 | 3300006881 | Ga0068865_101771005 | Ga0068865_1017710052 | 70 |
| 212 | 3300006881 | Ga0068865_101851568 | Ga0068865_1018515682 | 70 |
| 213 | 3300006931 | Ga0097620_100000478 | Ga0097620_10000047835 | 70 |
| 214 | 3300006931 | Ga0097620_100081305 | Ga0097620_1000813054 | 70 |
| 215 | 3300006931 | Ga0097620_100361978 | Ga0097620_1003619782 | 70 |
| 216 | 3300006931 | Ga0097620_100423530 | Ga0097620_1004235302 | 70 |
| 217 | 3300006931 | Ga0097620_101715365 | Ga0097620_1017153652 | 70 |
| 218 | 3300006931 | Ga0097620_101824533 | Ga0097620_1018245332 | 70 |
| 219 | 3300007788 | Ga0099795_10000031 | Ga0099795_1000003120 | 70 |
| 220 | 3300009093 | Ga0105240_10073297 | Ga0105240_100732974 | 70 |
| 221 | 3300009093 | Ga0105240_10985831 | Ga0105240_109858313 | 70 |
| 222 | 3300009094 | Ga0111539_11596326 | Ga0111539_115963262 | 70 |
| 223 | 3300009098 | Ga0105245_10000300 | Ga0105245_1000030026 | 70 |
| 224 | 3300009098 | Ga0105245_10242820 | Ga0105245_102428202 | 70 |
| 225 | 3300009148 | Ga0105243_10963662 | Ga0105243_109636621 | 70 |
| 226 | 3300009174 | Ga0105241_10022584 | Ga0105241_100225846 | 70 |
| 227 | 3300009174 | Ga0105241_10107661 | Ga0105241_101076614 | 70 |
| 228 | 3300009176 | Ga0105242_11861058 | Ga0105242_118610582 | 70 |
| 229 | 3300009177 | Ga0105248_10002741 | Ga0105248_1000274113 | 70 |
| 230 | 3300009177 | Ga0105248_10071273 | Ga0105248_100712733 | 70 |
| 231 | 3300009177 | Ga0105248_10320192 | Ga0105248_103201923 | 70 |
| 232 | 3300009177 | Ga0105248_11904888 | Ga0105248_119048882 | 70 |
| 233 | 3300009545 | Ga0105237_10104344 | Ga0105237_101043442 | 70 |
| 234 | 3300009545 | Ga0105237_10747342 | Ga0105237_107473422 | 70 |
| 235 | 3300009551 | Ga0105238_10173045 | Ga0105238_101730453 | 70 |
| 236 | 3300009553 | Ga0105249_10248255 | Ga0105249_102482553 | 70 |
| 237 | 3300009553 | Ga0105249_10846682 | Ga0105249_108466823 | 70 |
| 238 | 3300009553 | Ga0105249_10849157 | Ga0105249_108491572 | 70 |
| 239 | 3300010159 | Ga0099796_10000003 | Ga0099796_100000034 | 70 |
| 240 | 3300010375 | Ga0105239_10001674 | Ga0105239_1000167413 | 70 |
| 241 | 3300010375 | Ga0105239_10044676 | Ga0105239_100446766 | 70 |
| 242 | 3300010375 | Ga0105239_12470039 | Ga0105239_124700391 | 70 |
| 243 | 3300011119 | Ga0105246_10021355 | Ga0105246_100213552 | 70 |
| 244 | 3300011119 | Ga0105246_10657715 | Ga0105246_106577152 | 70 |
| 245 | 3300012510 | Ga0157316_1021749 | Ga0157316_10217492 | 70 |
| 246 | 3300013100 | Ga0157373_10006164 | Ga0157373_100061645 | 70 |
| 247 | 3300013102 | Ga0157371_10000677 | Ga0157371_1000067729 | 70 |
| 248 | 3300013102 | Ga0157371_10244322 | Ga0157371_102443223 | 70 |
| 249 | 3300013296 | Ga0157374_10274529 | Ga0157374_102745292 | 70 |
| 250 | 3300013297 | Ga0157378_10000319 | Ga0157378_1000031924 | 70 |
| 251 | 3300013297 | Ga0157378_10002011 | Ga0157378_1000201114 | 70 |
| 252 | 3300013297 | Ga0157378_10553955 | Ga0157378_105539552 | 70 |
| 253 | 3300013297 | Ga0157378_12100620 | Ga0157378_121006202 | 70 |
| 254 | 3300013306 | Ga0163162_10092140 | Ga0163162_100921403 | 70 |
| 255 | 3300013306 | Ga0163162_10148645 | Ga0163162_101486453 | 70 |
| 256 | 3300013306 | Ga0163162_10329052 | Ga0163162_103290522 | 70 |
| 257 | 3300013306 | Ga0163162_12907011 | Ga0163162_129070111 | 70 |
| 258 | 3300013307 | Ga0157372_10045485 | Ga0157372_100454855 | 70 |
| 259 | 3300013307 | Ga0157372_10118298 | Ga0157372_101182984 | 70 |
| 260 | 3300013308 | Ga0157375_11153230 | Ga0157375_111532302 | 70 |
| 261 | 3300013308 | Ga0157375_11548194 | Ga0157375_115481942 | 70 |
| 262 | 3300013308 | Ga0157375_11975236 | Ga0157375_119752362 | 70 |
| 263 | 3300013308 | Ga0157375_12141719 | Ga0157375_121417192 | 70 |
| 264 | 3300014325 | Ga0163163_11351369 | Ga0163163_113513692 | 70 |
| 265 | 3300014326 | Ga0157380_10146412 | Ga0157380_101464123 | 70 |
| 266 | 3300014326 | Ga0157380_12540990 | Ga0157380_125409902 | 70 |
| 267 | 3300014326 | Ga0157380_12900403 | Ga0157380_129004032 | 70 |
| 268 | 3300014497 | Ga0182008_10140682 | Ga0182008_101406822 | 70 |
| 269 | 3300014745 | Ga0157377_11375320 | Ga0157377_113753201 | 70 |
| 270 | 3300014968 | Ga0157379_10004109 | Ga0157379_1000410913 | 70 |
| 271 | 3300014968 | Ga0157379_10524957 | Ga0157379_105249572 | 70 |
| 272 | 3300014969 | Ga0157376_10943343 | Ga0157376_109433432 | 70 |
| 273 | 3300014969 | Ga0157376_11044200 | Ga0157376_110442002 | 70 |
| 274 | 3300014969 | Ga0157376_11463066 | Ga0157376_114630662 | 70 |
| 275 | 3300014969 | Ga0157376_11802179 | Ga0157376_118021792 | 70 |
| 276 | 3300017792 | Ga0163161_10257904 | Ga0163161_102579042 | 70 |
| 277 | 3300017792 | Ga0163161_10274604 | Ga0163161_102746041 | 70 |
| 278 | 3300017792 | Ga0163161_11755176 | Ga0163161_117551762 | 70 |
| 279 | 3300025315 | Ga0207697_10000026 | Ga0207697_1000002635 | 70 |
| 280 | 3300025315 | Ga0207697_10052837 | Ga0207697_100528372 | 70 |
| 281 | 3300025893 | Ga0207682_10100070 | Ga0207682_101000702 | 70 |
| 282 | 3300025893 | Ga0207682_10508763 | Ga0207682_105087632 | 70 |
| 283 | 3300025899 | Ga0207642_10103214 | Ga0207642_101032142 | 70 |
| 284 | 3300025901 | Ga0207688_10000055 | Ga0207688_1000005513 | 70 |
| 285 | 3300025901 | Ga0207688_10281807 | Ga0207688_102818072 | 70 |
| 286 | 3300025903 | Ga0207680_10032511 | Ga0207680_100325114 | 70 |
| 287 | 3300025903 | Ga0207680_10169596 | Ga0207680_101695961 | 70 |
| 288 | 3300025903 | Ga0207680_10913703 | Ga0207680_109137032 | 70 |
| 289 | 3300025904 | Ga0207647_10006361 | Ga0207647_1000636110 | 70 |
| 290 | 3300025904 | Ga0207647_10015895 | Ga0207647_100158956 | 70 |
| 291 | 3300025907 | Ga0207645_10001667 | Ga0207645_1000166716 | 70 |
| 292 | 3300025907 | Ga0207645_10002100 | Ga0207645_100021007 | 70 |
| 293 | 3300025907 | Ga0207645_10006444 | Ga0207645_100064445 | 70 |
| 294 | 3300025907 | Ga0207645_10026689 | Ga0207645_100266893 | 70 |
| 295 | 3300025908 | Ga0207643_10085558 | Ga0207643_100855582 | 70 |
| 296 | 3300025908 | Ga0207643_10229397 | Ga0207643_102293973 | 70 |
| 297 | 3300025908 | Ga0207643_10754082 | Ga0207643_107540821 | 70 |
| 298 | 3300025909 | Ga0207705_10312875 | Ga0207705_103128752 | 70 |
| 299 | 3300025911 | Ga0207654_10033362 | Ga0207654_100333624 | 70 |
| 300 | 3300025911 | Ga0207654_10226725 | Ga0207654_102267252 | 70 |
| 301 | 3300025913 | Ga0207695_11677960 | Ga0207695_116779602 | 70 |
| 302 | 3300025918 | Ga0207662_10458958 | Ga0207662_104589582 | 70 |
| 303 | 3300025919 | Ga0207657_10003629 | Ga0207657_1000362913 | 70 |
| 304 | 3300025919 | Ga0207657_10019760 | Ga0207657_100197603 | 70 |
| 305 | 3300025919 | Ga0207657_10616240 | Ga0207657_106162402 | 70 |
| 306 | 3300025920 | Ga0207649_10098452 | Ga0207649_100984523 | 70 |
| 307 | 3300025920 | Ga0207649_10178691 | Ga0207649_101786914 | 70 |
| 308 | 3300025923 | Ga0207681_10001514 | Ga0207681_1000151413 | 70 |
| 309 | 3300025923 | Ga0207681_10005327 | Ga0207681_100053274 | 70 |
| 310 | 3300025923 | Ga0207681_10394526 | Ga0207681_103945261 | 70 |
| 311 | 3300025923 | Ga0207681_10769166 | Ga0207681_107691662 | 70 |
| 312 | 3300025923 | Ga0207681_10862737 | Ga0207681_108627372 | 70 |
| 313 | 3300025924 | Ga0207694_10114373 | Ga0207694_101143732 | 70 |
| 314 | 3300025925 | Ga0207650_10007009 | Ga0207650_100070094 | 70 |
| 315 | 3300025925 | Ga0207650_10021094 | Ga0207650_100210942 | 70 |
| 316 | 3300025925 | Ga0207650_10044004 | Ga0207650_100440045 | 70 |
| 317 | 3300025925 | Ga0207650_10076214 | Ga0207650_100762142 | 70 |
| 318 | 3300025925 | Ga0207650_10174316 | Ga0207650_101743163 | 70 |
| 319 | 3300025926 | Ga0207659_10028105 | Ga0207659_100281053 | 70 |
| 320 | 3300025926 | Ga0207659_10907981 | Ga0207659_109079812 | 70 |
| 321 | 3300025926 | Ga0207659_11408748 | Ga0207659_114087482 | 70 |
| 322 | 3300025927 | Ga0207687_10003666 | Ga0207687_100036664 | 70 |
| 323 | 3300025927 | Ga0207687_10356146 | Ga0207687_103561462 | 70 |
| 324 | 3300025931 | Ga0207644_10114557 | Ga0207644_101145572 | 70 |
| 325 | 3300025931 | Ga0207644_10146332 | Ga0207644_101463323 | 70 |
| 326 | 3300025931 | Ga0207644_10185868 | Ga0207644_101858682 | 70 |
| 327 | 3300025932 | Ga0207690_10007026 | Ga0207690_100070265 | 70 |
| 328 | 3300025932 | Ga0207690_10149315 | Ga0207690_101493153 | 70 |
| 329 | 3300025933 | Ga0207706_10000278 | Ga0207706_1000027825 | 70 |
| 330 | 3300025933 | Ga0207706_10010239 | Ga0207706_100102397 | 70 |
| 331 | 3300025933 | Ga0207706_10628496 | Ga0207706_106284963 | 70 |
| 332 | 3300025934 | Ga0207686_11371647 | Ga0207686_113716472 | 70 |
| 333 | 3300025935 | Ga0207709_11156602 | Ga0207709_111566022 | 70 |
| 334 | 3300025936 | Ga0207670_10049248 | Ga0207670_100492483 | 70 |
| 335 | 3300025936 | Ga0207670_10333602 | Ga0207670_103336022 | 70 |
| 336 | 3300025937 | Ga0207669_10013438 | Ga0207669_100134383 | 70 |
| 337 | 3300025937 | Ga0207669_10253215 | Ga0207669_102532152 | 70 |
| 338 | 3300025937 | Ga0207669_10584039 | Ga0207669_105840392 | 70 |
| 339 | 3300025937 | Ga0207669_11291413 | Ga0207669_112914132 | 70 |
| 340 | 3300025938 | Ga0207704_10005707 | Ga0207704_100057077 | 70 |
| 341 | 3300025938 | Ga0207704_10783983 | Ga0207704_107839832 | 70 |
| 342 | 3300025940 | Ga0207691_10000045 | Ga0207691_1000004525 | 70 |
| 343 | 3300025940 | Ga0207691_10011068 | Ga0207691_100110682 | 70 |
| 344 | 3300025940 | Ga0207691_10029849 | Ga0207691_100298494 | 70 |
| 345 | 3300025941 | Ga0207711_10003154 | Ga0207711_100031546 | 70 |
| 346 | 3300025941 | Ga0207711_10060382 | Ga0207711_100603824 | 70 |
| 347 | 3300025941 | Ga0207711_10335816 | Ga0207711_103358161 | 70 |
| 348 | 3300025941 | Ga0207711_10404093 | Ga0207711_104040932 | 70 |
| 349 | 3300025942 | Ga0207689_10000182 | Ga0207689_1000018232 | 70 |
| 350 | 3300025942 | Ga0207689_10065887 | Ga0207689_100658874 | 70 |
| 351 | 3300025942 | Ga0207689_11050887 | Ga0207689_110508872 | 70 |
| 352 | 3300025944 | Ga0207661_10497883 | Ga0207661_104978832 | 70 |
| 353 | 3300025945 | Ga0207679_10044041 | Ga0207679_100440413 | 70 |
| 354 | 3300025945 | Ga0207679_10067699 | Ga0207679_100676992 | 70 |
| 355 | 3300025949 | Ga0207667_10007486 | Ga0207667_1000748612 | 70 |
| 356 | 3300025949 | Ga0207667_10013523 | Ga0207667_100135232 | 70 |
| 357 | 3300025949 | Ga0207667_10735269 | Ga0207667_107352693 | 70 |
| 358 | 3300025949 | Ga0207667_11379433 | Ga0207667_113794332 | 70 |
| 359 | 3300025949 | Ga0207667_11383547 | Ga0207667_113835472 | 70 |
| 360 | 3300025960 | Ga0207651_10004393 | Ga0207651_100043939 | 70 |
| 361 | 3300025960 | Ga0207651_10039220 | Ga0207651_100392204 | 70 |
| 362 | 3300025960 | Ga0207651_10257550 | Ga0207651_102575502 | 70 |
| 363 | 3300025960 | Ga0207651_10259317 | Ga0207651_102593173 | 70 |
| 364 | 3300025960 | Ga0207651_10451071 | Ga0207651_104510712 | 70 |
| 365 | 3300025961 | Ga0207712_10086969 | Ga0207712_100869692 | 70 |
| 366 | 3300025961 | Ga0207712_10169636 | Ga0207712_101696363 | 70 |
| 367 | 3300025961 | Ga0207712_10610657 | Ga0207712_106106573 | 70 |
| 368 | 3300025961 | Ga0207712_11047616 | Ga0207712_110476162 | 70 |
| 369 | 3300025972 | Ga0207668_10000050 | Ga0207668_10000050111 | 70 |
| 370 | 3300025972 | Ga0207668_10006477 | Ga0207668_100064773 | 70 |
| 371 | 3300025972 | Ga0207668_10067122 | Ga0207668_100671222 | 70 |
| 372 | 3300025972 | Ga0207668_10146889 | Ga0207668_101468892 | 70 |
| 373 | 3300025972 | Ga0207668_11032761 | Ga0207668_110327612 | 70 |
| 374 | 3300025981 | Ga0207640_10000849 | Ga0207640_1000084912 | 70 |
| 375 | 3300025981 | Ga0207640_10727931 | Ga0207640_107279312 | 70 |
| 376 | 3300025986 | Ga0207658_10002786 | Ga0207658_100027863 | 70 |
| 377 | 3300025986 | Ga0207658_10018210 | Ga0207658_100182107 | 70 |
| 378 | 3300025986 | Ga0207658_10037004 | Ga0207658_100370042 | 70 |
| 379 | 3300025986 | Ga0207658_10086859 | Ga0207658_100868592 | 70 |
| 380 | 3300025986 | Ga0207658_10112529 | Ga0207658_101125293 | 70 |
| 381 | 3300025986 | Ga0207658_10465319 | Ga0207658_104653192 | 70 |
| 382 | 3300025986 | Ga0207658_10564545 | Ga0207658_105645452 | 70 |
| 383 | 3300025986 | Ga0207658_10759345 | Ga0207658_107593452 | 70 |
| 384 | 3300026023 | Ga0207677_10003889 | Ga0207677_100038896 | 70 |
| 385 | 3300026023 | Ga0207677_10124677 | Ga0207677_101246773 | 70 |
| 386 | 3300026023 | Ga0207677_10486508 | Ga0207677_104865082 | 70 |
| 387 | 3300026035 | Ga0207703_10012911 | Ga0207703_1001291110 | 70 |
| 388 | 3300026035 | Ga0207703_10075760 | Ga0207703_100757602 | 70 |
| 389 | 3300026035 | Ga0207703_10330125 | Ga0207703_103301251 | 70 |
| 390 | 3300026041 | Ga0207639_10002353 | Ga0207639_100023535 | 70 |
| 391 | 3300026041 | Ga0207639_10091249 | Ga0207639_100912494 | 70 |
| 392 | 3300026041 | Ga0207639_10092070 | Ga0207639_100920702 | 70 |
| 393 | 3300026041 | Ga0207639_11581128 | Ga0207639_115811282 | 70 |
| 394 | 3300026067 | Ga0207678_10000680 | Ga0207678_1000068026 | 70 |
| 395 | 3300026067 | Ga0207678_10425495 | Ga0207678_104254952 | 70 |
| 396 | 3300026078 | Ga0207702_10339198 | Ga0207702_103391981 | 70 |
| 397 | 3300026088 | Ga0207641_10004210 | Ga0207641_100042109 | 70 |
| 398 | 3300026088 | Ga0207641_10020495 | Ga0207641_100204956 | 70 |
| 399 | 3300026088 | Ga0207641_10213268 | Ga0207641_102132682 | 70 |
| 400 | 3300026088 | Ga0207641_10528199 | Ga0207641_105281992 | 70 |
| 401 | 3300026088 | Ga0207641_11640595 | Ga0207641_116405952 | 70 |
| 402 | 3300026089 | Ga0207648_10000222 | Ga0207648_1000022238 | 70 |
| 403 | 3300026089 | Ga0207648_10000477 | Ga0207648_1000047749 | 70 |
| 404 | 3300026089 | Ga0207648_10003597 | Ga0207648_100035973 | 70 |
| 405 | 3300026089 | Ga0207648_10217515 | Ga0207648_102175153 | 70 |
| 406 | 3300026095 | Ga0207676_10000878 | Ga0207676_1000087821 | 70 |
| 407 | 3300026095 | Ga0207676_10895937 | Ga0207676_108959372 | 70 |
| 408 | 3300026095 | Ga0207676_11455844 | Ga0207676_114558442 | 70 |
| 409 | 3300026095 | Ga0207676_11898551 | Ga0207676_118985511 | 70 |
| 410 | 3300026116 | Ga0207674_10006997 | Ga0207674_1000699712 | 70 |
| 411 | 3300026116 | Ga0207674_10016334 | Ga0207674_100163346 | 70 |
| 412 | 3300026116 | Ga0207674_10075903 | Ga0207674_100759033 | 70 |
| 413 | 3300026116 | Ga0207674_11651563 | Ga0207674_116515632 | 70 |
| 414 | 3300026118 | Ga0207675_100017759 | Ga0207675_1000177593 | 70 |
| 415 | 3300026118 | Ga0207675_101720161 | Ga0207675_1017201612 | 70 |
| 416 | 3300026121 | Ga0207683_10002113 | Ga0207683_100021133 | 70 |
| 417 | 3300026121 | Ga0207683_10060194 | Ga0207683_100601943 | 70 |
| 418 | 3300026121 | Ga0207683_10479182 | Ga0207683_104791821 | 70 |
| 419 | 3300026142 | Ga0207698_10004080 | Ga0207698_1000408011 | 70 |
| 420 | 3300026142 | Ga0207698_10010501 | Ga0207698_100105011 | 70 |
| 421 | 3300026142 | Ga0207698_10200038 | Ga0207698_102000382 | 70 |
| 422 | 3300026142 | Ga0207698_10761921 | Ga0207698_107619212 | 70 |
| 423 | 3300027252 | Ga0209973_1038867 | Ga0209973_10388672 | 70 |
| 424 | 3300027360 | Ga0209969_1016551 | Ga0209969_10165512 | 70 |
| 425 | 3300027462 | Ga0210000_1013298 | Ga0210000_10132982 | 70 |
| 426 | 3300027471 | Ga0209995_1060033 | Ga0209995_10600332 | 70 |
| 427 | 3300027512 | Ga0209179_1000014 | Ga0209179_100001418 | 70 |
| 428 | 3300027552 | Ga0209982_1026794 | Ga0209982_10267942 | 70 |
| 429 | 3300027614 | Ga0209970_1010294 | Ga0209970_10102942 | 70 |
| 430 | 3300027665 | Ga0209983_1033212 | Ga0209983_10332122 | 70 |
| 431 | 3300027682 | Ga0209971_1003425 | Ga0209971_10034252 | 70 |
| 432 | 3300027876 | Ga0209974_10006175 | Ga0209974_100061755 | 70 |
| 433 | 3300028379 | Ga0268266_10002448 | Ga0268266_1000244812 | 70 |
| 434 | 3300028379 | Ga0268266_10035224 | Ga0268266_100352244 | 70 |
| 435 | 3300028379 | Ga0268266_10088810 | Ga0268266_100888103 | 70 |
| 436 | 3300028379 | Ga0268266_10490393 | Ga0268266_104903933 | 70 |
| 437 | 3300028379 | Ga0268266_10763707 | Ga0268266_107637072 | 70 |
| 438 | 3300028380 | Ga0268265_10093811 | Ga0268265_100938112 | 70 |
| 439 | 3300028380 | Ga0268265_10094838 | Ga0268265_100948385 | 70 |
| 440 | 3300028380 | Ga0268265_10192299 | Ga0268265_101922991 | 70 |
| 441 | 3300028380 | Ga0268265_10218757 | Ga0268265_102187572 | 70 |
| 442 | 3300028380 | Ga0268265_10872528 | Ga0268265_108725282 | 70 |
| 443 | 3300028380 | Ga0268265_12370466 | Ga0268265_123704662 | 70 |
| 444 | 3300028381 | Ga0268264_10000645 | Ga0268264_1000064514 | 70 |
| 445 | 3300028381 | Ga0268264_10073507 | Ga0268264_100735074 | 70 |
| 446 | 3300028381 | Ga0268264_10387047 | Ga0268264_103870472 | 70 |
| 447 | 3300028381 | Ga0268264_11221639 | Ga0268264_112216392 | 70 |
| 448 | 3300030521 | Ga0307511_10204396 | Ga0307511_102043962 | 70 |
| 449 | 3300031548 | Ga0307408_100661092 | Ga0307408_1006610922 | 70 |
| 450 | 3300031691 | Ga0316579_10399559 | Ga0316579_103995591 | 70 |
| 451 | 3300031730 | Ga0307516_10025610 | Ga0307516_100256106 | 70 |
| 452 | 3300031731 | Ga0307405_11438230 | Ga0307405_114382301 | 70 |
| 453 | 3300031733 | Ga0316577_10382028 | Ga0316577_103820282 | 70 |
| 454 | 3300031824 | Ga0307413_11639359 | Ga0307413_116393592 | 70 |
| 455 | 3300031852 | Ga0307410_11529302 | Ga0307410_115293021 | 70 |
| 456 | 3300031901 | Ga0307406_10126762 | Ga0307406_101267622 | 70 |
| 457 | 3300031911 | Ga0307412_10634786 | Ga0307412_106347862 | 70 |
| 458 | 3300031995 | Ga0307409_100465863 | Ga0307409_1004658632 | 70 |
| 459 | 3300031995 | Ga0307409_101057544 | Ga0307409_1010575442 | 70 |
| 460 | 3300031995 | Ga0307409_102476498 | Ga0307409_1024764982 | 70 |
| 461 | 3300032002 | Ga0307416_103283820 | Ga0307416_1032838202 | 70 |
| 462 | 3300032004 | Ga0307414_10573990 | Ga0307414_105739902 | 70 |
| 463 | 3300032004 | Ga0307414_11620255 | Ga0307414_116202552 | 70 |
| 464 | 3300032004 | Ga0307414_11660943 | Ga0307414_116609431 | 70 |
| 465 | 3300032005 | Ga0307411_10438491 | Ga0307411_104384913 | 70 |
| 466 | 3300032126 | Ga0307415_100772668 | Ga0307415_1007726682 | 70 |
| 467 | 3300036712 | Ga0316584_0140423 | Ga0316584_0140423_842_1081 | 70 |
| 468 | 3300037418 | Ga0395900_0253253 | Ga0395900_0253253_1493_1729 | 70 |
| 469 | 3300037418 | Ga0395900_1058379 | Ga0395900_1058379_298_510 | 70 |
| 470 | 3300037471 | Ga0395905_0006451 | Ga0395905_0006451_232_468 | 70 |
| 471 | 3300037471 | Ga0395905_0039424 | Ga0395905_0039424_2307_2519 | 70 |
| 472 | 3300037471 | Ga0395905_0227237 | Ga0395905_0227237_658_912 | 70 |
| 473 | 3300038443 | Ga0395901_0023925 | Ga0395901_0023925_5674_5886 | 70 |
| 474 | 3300038443 | Ga0395901_0442995 | Ga0395901_0442995_454_690 | 70 |
| 475 | 3300041404 | Ga0439436_0020648 | Ga0439436_0020648_420_635 | 70 |
| 476 | 3300041404 | Ga0439436_0032372 | Ga0439436_0032372_137_358 | 70 |
| 477 | 3300041413 | Ga0439465_0024130 | Ga0439465_0024130_461_676 | 70 |
| 478 | 3300041459 | Ga0451800_0467010 | Ga0451800_0467010_60_281 | 70 |
| 479 | 3300041486 | Ga0451807_1240268 | Ga0451807_1240268_451_690 | 70 |
| 480 | 3300041491 | Ga0451833_0733127 | Ga0451833_0733127_359_598 | 70 |
| 481 | 3300041512 | Ga0451853_0362294 | Ga0451853_0362294_516_755 | 70 |
| 482 | 3300041512 | Ga0451853_1185443 | Ga0451853_1185443_77_325 | 70 |
| 483 | 3300041999 | Ga0439433_0033126 | Ga0439433_0033126_476_697 | 70 |
| 484 | 3300042006 | Ga0439432_007949 | Ga0439432_007949_3255_3476 | 70 |
| 485 | 3300042006 | Ga0439432_093964 | Ga0439432_093964_410_631 | 70 |
| 486 | 3300042007 | Ga0439449_0022599 | Ga0439449_0022599_728_943 | 70 |
| 487 | 3300042007 | Ga0439449_0053628 | Ga0439449_0053628_1069_1290 | 70 |
| 488 | 3300042007 | Ga0439449_0298026 | Ga0439449_0298026_120_377 | 70 |
| 489 | 3300042010 | Ga0439452_057420 | Ga0439452_057420_365_586 | 70 |
| 490 | 3300042012 | Ga0439455_0122717 | Ga0439455_0122717_48_272 | 70 |
| 491 | 3300042014 | Ga0439457_159056 | Ga0439457_159056_177_398 | 70 |
| 492 | 3300042015 | Ga0439462_0006982 | Ga0439462_0006982_1828_2049 | 70 |
| 493 | 3300042130 | Ga0450892_017013 | Ga0450892_017013_327_545 | 70 |
| 494 | 3300042156 | Ga0439446_0061907 | Ga0439446_0061907_432_671 | 70 |
| 495 | 3300042157 | Ga0439458_0132410 | Ga0439458_0132410_32_256 | 70 |
| 496 | 3300046460 | Ga0495638_0445815 | Ga0495638_0445815_363_581 | 70 |
| 497 | 3300046525 | Ga0495663_0012698 | Ga0495663_0012698_605_823 | 70 |
| 498 | 3300046525 | Ga0495663_0042795 | Ga0495663_0042795_360_578 | 70 |
| 499 | 3300046525 | Ga0495663_0239231 | Ga0495663_0239231_180_416 | 70 |
| 500 | 3300046537 | Ga0495598_0016997 | Ga0495598_0016997_323_541 | 70 |
| 501 | 3300046539 | Ga0495621_0002303 | Ga0495621_0002303_3636_3854 | 70 |
| 502 | 3300046539 | Ga0495621_0017566 | Ga0495621_0017566_817_1035 | 70 |
| 503 | 3300046539 | Ga0495621_0107625 | Ga0495621_0107625_536_754 | 70 |
| 504 | 3300046539 | Ga0495621_0241441 | Ga0495621_0241441_122_340 | 70 |
| 505 | 3300046558 | Ga0495633_0031366 | Ga0495633_0031366_442_660 | 70 |
| 506 | 3300046558 | Ga0495633_0219991 | Ga0495633_0219991_201_419 | 70 |
| 507 | 3300046660 | Ga0495625_0601671 | Ga0495625_0601671_10_228 | 70 |
| 508 | 3300046684 | Ga0495669_0013113 | Ga0495669_0013113_1939_2157 | 70 |
| 509 | 3300046684 | Ga0495669_0086314 | Ga0495669_0086314_1050_1286 | 70 |
| 510 | 3300046691 | Ga0495670_0016612 | Ga0495670_0016612_3077_3295 | 70 |
| 511 | 3300046691 | Ga0495670_0039391 | Ga0495670_0039391_2091_2309 | 70 |
| 512 | 3300047317 | Ga0495604_0804532 | Ga0495604_0804532_103_345 | 70 |
| 513 | 3300047445 | Ga0495677_0098825 | Ga0495677_0098825_711_929 | 70 |
| 514 | 3300048907 | Ga0496104_1154589 | Ga0496104_1154589_89_346 | 70 |
| 515 | 3300048909 | Ga0496106_0241385 | Ga0496106_0241385_363_620 | 70 |
| 516 | 3300048912 | Ga0496109_0951085 | Ga0496109_0951085_75_332 | 70 |
| 517 | 3300048913 | Ga0496110_0362933 | Ga0496110_0362933_582_839 | 70 |
| 518 | 3300048914 | Ga0496111_0485344 | Ga0496111_0485344_41_262 | 70 |
| 519 | 3300048917 | Ga0496114_0033955 | Ga0496114_0033955_3352_3573 | 70 |
| 520 | 3300048924 | Ga0496121_0323272 | Ga0496121_0323272_569_826 | 70 |
| 521 | 3300048927 | Ga0496124_0502407 | Ga0496124_0502407_437_652 | 70 |
| 522 | 3300048928 | Ga0496125_0384236 | Ga0496125_0384236_407_622 | 70 |
| 523 | 3300049649 | Ga0501198_094406 | Ga0501198_094406_245_466 | 70 |
| 524 | 3300049661 | Ga0501217_197217 | Ga0501217_197217_266_487 | 70 |
| 525 | 3300049663 | Ga0501223_036730 | Ga0501223_036730_211_432 | 70 |
| 526 | 3300049663 | Ga0501223_084624 | Ga0501223_084624_304_525 | 70 |
| 527 | 3300049680 | Ga0501250_077319 | Ga0501250_077319_260_481 | 70 |
| 528 | 3300049824 | Ga0501045_0582660 | Ga0501045_0582660_55_267 | 70 |
| 529 | 3300050511 | nmdc:mga08y16_1269840_c1 | nmdc:mga08y16_1269840_c1_264_482 | 70 |
| 530 | 3300050515 | nmdc:mga0a205_770596_c1 | nmdc:mga0a205_770596_c1_121_339 | 70 |
| 531 | 3300053078 | Ga0495612_0577198 | Ga0495612_0577198_212_451 | 70 |
| 532 | 3300053093 | Ga0500651_0002997 | Ga0500651_0002997_828_1073 | 70 |
| 533 | 3300053129 | Ga0500628_063816 | Ga0500628_063816_74_328 | 70 |
| 534 | 3300053139 | Ga0500568_0156005 | Ga0500568_0156005_481_693 | 70 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1b0n-assembly1.cif.gz_A | sinr protein/sini protein complex | 0.9377 | 9 | 57 |
| 3pxp-assembly1.cif.gz_A | crystal structure of a pas and dna binding domain containing protein (caur_2278) from chloroflexus aurantiacus j-10-fl at 2.30 a resolution | 0.9271 | 16 | 55 |
| 3zkc-assembly1.cif.gz_A | crystal structure of the master regulator for biofilm formation sinr in complex with dna. | 0.9251 | 9 | 58 |
| 3zkc-assembly1.cif.gz_B | crystal structure of the master regulator for biofilm formation sinr in complex with dna. | 0.9239 | 9 | 58 |
| 7o81-assembly1.cif.gz_AU | rabbit 80s ribosome colliding in another ribosome stalled by the sars-cov-2 pseudoknot | 0.9196 | 9 | 56 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qq6B00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9393 | 9 | 58 | 1.10.260.40 |
| 1b0nA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9377 | 9 | 57 | 1.10.260.40 |
| 3zkcA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9251 | 9 | 58 | 1.10.260.40 |
| 3zkcB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9239 | 9 | 58 | 1.10.260.40 |
| 2b5aB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9227 | 7 | 58 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F9MVV8-F1-model_v4 | deleted | 0.977 | 3 | 68 |
|
| AF-I9WD21-F1-model_v4 | Putative transcriptional regulator | 0.9744 | 2 | 67 |
GO:0003677
|
| AF-C1FTK8-F1-model_v4 | Transcription regulator, Cro/CI family-related protein | 0.9734 | 3 | 64 |
GO:0003677
|
| AF-A0A0E1TWW2-F1-model_v4 | deleted | 0.9701 | 2 | 68 |
|
| AF-A0A074M4N3-F1-model_v4 | Cro/Cl family transcriptional regulator | 0.9693 | 2 | 65 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar