F460499

General Info

Members Datasets Scaffolds Average Seq Length
534 242 532 75

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10002169|Ga0070676_100021697
Length 85
Sequence MAILVRLDEMLHERRMTLTELATRVDITVANLSILKTGKAKAIRFSTLEAICVALDCQPGELLEYCREGQPNDAVSADAGEGAHA

Samples

Sample ID Description Type Environment
1 2643221695 Lysobacter sp. Root494 Isolate Unclassified
2 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
193 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
194 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
199 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
200 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
201 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
202 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
203 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
204 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
205 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
206 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
207 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
208 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
233 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
234 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
235 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
241 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
242 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 1.5
Rhizosphere 94.94
Stem 0
Stem Tuber 0.19
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1009536 3300001915 Bacteria 1779
2 JGI24741J21665_1061888 3300001915 Bacteria 553
3 JGI24740J21852_10000281 3300001979 Bacteria 21617
4 JGI24740J21852_10001858 3300001979 Bacteria 9669
5 JGI24739J22299_10000453 3300001989 Bacteria 14331
6 JGI24739J22299_10028526 3300001989 Bacteria 1946
7 JGI24743J22301_10003697 3300001991 Bacteria 2442
8 JGI24735J21928_10116153 3300002067 Bacteria 770
9 JGI24735J21928_10205939 3300002067 Bacteria 571
10 JGI24745J21846_1049948 3300002073 Bacteria 529
11 JGI24738J21930_10000062 3300002075 Bacteria 22279
12 JGI24738J21930_10007364 3300002075 Bacteria 2542
13 JGI24034J26672_10056892 3300002239 Bacteria 681
14 JGI24742J22300_10022402 3300002244 Bacteria 1083
15 rootL2_10045740 3300003322 Bacteria 10955
16 JGI26145J50221_1017606 3300003371 Bacteria 673
17 Ga0055536_1000001 3300003781 Bacteria 630663
18 Ga0055530_10002525 3300003791 Bacteria 11674
19 Ga0065712_10392011 3300005290 Bacteria 737
20 Ga0065715_10309893 3300005293 Bacteria 1001
21 Ga0065715_10472983 3300005293 Bacteria 804
22 Ga0065715_11180609 3300005293 Bacteria 502
23 Ga0065707_10276566 3300005295 Unclassified 1058
24 Ga0070658_10383998 3300005327 Bacteria 1205
25 Ga0070676_10002169 3300005328 Bacteria 10013
26 Ga0070676_10003504 3300005328 Bacteria 8192
27 Ga0070676_10011228 3300005328 Bacteria 4871
28 Ga0070683_100493296 3300005329 Bacteria 1170
29 Ga0070690_100018652 3300005330 Bacteria 4194
30 Ga0070670_100007258 3300005331 Bacteria 9393
31 Ga0070670_100010365 3300005331 Bacteria 7955
32 Ga0070670_100164833 3300005331 Bacteria 1921
33 Ga0070670_100211938 3300005331 Bacteria 1684
34 Ga0070677_10333173 3300005333 Bacteria 781
35 Ga0070677_10387166 3300005333 Bacteria 734
36 Ga0068869_100034193 3300005334 Bacteria 3594
37 Ga0068869_100071883 3300005334 Bacteria 2562
38 Ga0068869_101238510 3300005334 Bacteria 657
39 Ga0070666_10072348 3300005335 Bacteria 2347
40 Ga0070666_10213518 3300005335 Bacteria 1359
41 Ga0070682_100265687 3300005337 Bacteria 1244
42 Ga0068868_100000637 3300005338 Bacteria 23618
43 Ga0068868_100403480 3300005338 Bacteria 1180
44 Ga0068868_101275133 3300005338 Bacteria 682
45 Ga0070660_100002082 3300005339 Bacteria 13818
46 Ga0070660_100040988 3300005339 Bacteria 3527
47 Ga0070660_101065505 3300005339 Bacteria 684
48 Ga0070689_100009615 3300005340 Bacteria 6863
49 Ga0070689_101006175 3300005340 Bacteria 742
50 Ga0070687_100235595 3300005343 Bacteria 1129
51 Ga0070661_100061480 3300005344 Bacteria 2757
52 Ga0070661_100338365 3300005344 Bacteria 1178
53 Ga0070668_100005175 3300005347 Bacteria 9673
54 Ga0070668_100032860 3300005347 Bacteria 3949
55 Ga0070668_100070106 3300005347 Bacteria 2728
56 Ga0070668_100142841 3300005347 Bacteria 1930
57 Ga0070668_100727650 3300005347 Bacteria 877
58 Ga0070668_100985284 3300005347 Bacteria 757
59 Ga0070668_101213518 3300005347 Bacteria 684
60 Ga0070669_100000862 3300005353 Bacteria 22037
61 Ga0070669_100059502 3300005353 Bacteria 2805
62 Ga0070669_100118774 3300005353 Bacteria 2014
63 Ga0070669_100968027 3300005353 Bacteria 729
64 Ga0070675_100047334 3300005354 Bacteria 3524
65 Ga0070675_100057554 3300005354 Bacteria 3205
66 Ga0070675_100237497 3300005354 Bacteria 1592
67 Ga0070671_100094852 3300005355 Bacteria 2501
68 Ga0070671_100157220 3300005355 Bacteria 1921
69 Ga0070671_100158914 3300005355 Bacteria 1910
70 Ga0070671_100224615 3300005355 Bacteria 1593
71 Ga0070674_100001982 3300005356 Bacteria 11206
72 Ga0070674_100051087 3300005356 Bacteria 2848
73 Ga0070674_100054275 3300005356 Bacteria 2771
74 Ga0070674_102013308 3300005356 Bacteria 526
75 Ga0070673_100000209 3300005364 Bacteria 29078
76 Ga0070673_100050975 3300005364 Bacteria 3239
77 Ga0070673_100096310 3300005364 Bacteria 2428
78 Ga0070673_100392851 3300005364 Bacteria 1239
79 Ga0070673_100446684 3300005364 Bacteria 1163
80 Ga0070673_102075286 3300005364 Bacteria 540
81 Ga0070688_100046454 3300005365 Bacteria 2689
82 Ga0070659_100007835 3300005366 Bacteria 7774
83 Ga0070659_100019869 3300005366 Bacteria 5098
84 Ga0070659_100679062 3300005366 Bacteria 889
85 Ga0070667_100004734 3300005367 Bacteria 11402
86 Ga0070667_100021153 3300005367 Bacteria 5405
87 Ga0070667_100047130 3300005367 Bacteria 3626
88 Ga0070667_100090330 3300005367 Bacteria 2632
89 Ga0070667_100277726 3300005367 Bacteria 1504
90 Ga0070663_100090984 3300005455 Bacteria 2260
91 Ga0070663_100186768 3300005455 Bacteria 1611
92 Ga0070678_100009113 3300005456 Bacteria 5989
93 Ga0070678_100123475 3300005456 Bacteria 2046
94 Ga0070678_101126115 3300005456 Bacteria 725
95 Ga0070662_100001955 3300005457 Bacteria 12662
96 Ga0070662_100023820 3300005457 Bacteria 4210
97 Ga0070662_100257974 3300005457 Bacteria 1404
98 Ga0068867_100000633 3300005459 Bacteria 23213
99 Ga0068867_100011413 3300005459 Bacteria 6269
100 Ga0068867_100280746 3300005459 Bacteria 1366
101 Ga0068867_100426594 3300005459 Bacteria 1124
102 Ga0068867_101247915 3300005459 Bacteria 684
103 Ga0070685_10627910 3300005466 Bacteria 776
104 Ga0070685_11421709 3300005466 Bacteria 533
105 Ga0070684_100172293 3300005535 Bacteria 1966
106 Ga0070684_100274351 3300005535 Bacteria 1544
107 Ga0068853_100002063 3300005539 Bacteria 14889
108 Ga0068853_100072330 3300005539 Bacteria 3004
109 Ga0068853_100367506 3300005539 Bacteria 1341
110 Ga0068853_100523933 3300005539 Bacteria 1121
111 Ga0068853_101221415 3300005539 Bacteria 726
112 Ga0070672_100000770 3300005543 Bacteria 19069
113 Ga0070672_100017202 3300005543 Bacteria 5199
114 Ga0070672_100232470 3300005543 Bacteria 1549
115 Ga0070686_100432174 3300005544 Bacteria 1008
116 Ga0070665_100020763 3300005548 Bacteria 6600
117 Ga0070665_100113415 3300005548 Bacteria 2713
118 Ga0070665_100205173 3300005548 Bacteria 1972
119 Ga0070665_100219334 3300005548 Bacteria 1902
120 Ga0070665_100772776 3300005548 Bacteria 973
121 Ga0070665_101677195 3300005548 Bacteria 643
122 Ga0070665_102245599 3300005548 Bacteria 549
123 Ga0068855_100032514 3300005563 Bacteria 6228
124 Ga0068855_100039372 3300005563 Bacteria 5611
125 Ga0068855_102198285 3300005563 Bacteria 554
126 Ga0070664_100009081 3300005564 Bacteria 8067
127 Ga0070664_100535128 3300005564 Bacteria 1082
128 Ga0068857_100004161 3300005577 Bacteria 12189
129 Ga0068857_100055828 3300005577 Bacteria 3504
130 Ga0068857_100112891 3300005577 Bacteria 2443
131 Ga0068857_100123051 3300005577 Bacteria 2337
132 Ga0068854_100000614 3300005578 Bacteria 21116
133 Ga0068854_100174976 3300005578 Bacteria 1672
134 Ga0068856_101558655 3300005614 Bacteria 674
135 Ga0068852_100000804 3300005616 Bacteria 20664
136 Ga0068852_100040971 3300005616 Bacteria 3911
137 Ga0068852_100046769 3300005616 Bacteria 3688
138 Ga0068852_100845172 3300005616 Bacteria 931
139 Ga0068852_101668583 3300005616 Bacteria 660
140 Ga0068859_100000478 3300005617 Bacteria 39430
141 Ga0068859_100081304 3300005617 Bacteria 3282
142 Ga0068859_100362012 3300005617 Bacteria 1546
143 Ga0068859_100423511 3300005617 Bacteria 1427
144 Ga0068859_101715419 3300005617 Unclassified 694
145 Ga0068859_101824558 3300005617 Bacteria 672
146 Ga0068864_100000174 3300005618 Bacteria 59338
147 Ga0068864_100080716 3300005618 Bacteria 2850
148 Ga0068864_101021095 3300005618 Bacteria 821
149 Ga0068864_101048728 3300005618 Bacteria 810
150 Ga0068866_10167121 3300005718 Bacteria 1288
151 Ga0068861_100010621 3300005719 Bacteria 6394
152 Ga0068861_100466169 3300005719 Bacteria 1135
153 Ga0068851_11006818 3300005834 Bacteria 526
154 Ga0068870_10123162 3300005840 Bacteria 1496
155 Ga0068870_10170620 3300005840 Bacteria 1298
156 Ga0068870_10740287 3300005840 Bacteria 682
157 Ga0068863_100004878 3300005841 Bacteria 13216
158 Ga0068863_100076008 3300005841 Bacteria 3177
159 Ga0068863_100106113 3300005841 Bacteria 2672
160 Ga0068863_101086016 3300005841 Bacteria 804
161 Ga0068858_100068281 3300005842 Bacteria 3294
162 Ga0068858_100372130 3300005842 Bacteria 1370
163 Ga0068858_100374413 3300005842 Bacteria 1366
164 Ga0068860_100005690 3300005843 Bacteria 12583
165 Ga0068860_100005831 3300005843 Bacteria 12397
166 Ga0068860_100412817 3300005843 Bacteria 1337
167 Ga0068862_100071036 3300005844 Bacteria 3006
168 Ga0068862_100121478 3300005844 Bacteria 2303
169 Ga0068862_100315881 3300005844 Bacteria 1441
170 Ga0068862_100468845 3300005844 Bacteria 1190
171 Ga0068862_100726929 3300005844 Bacteria 964
172 Ga0081540_1007109 3300005983 Bacteria 8035
173 Ga0097621_100013235 3300006237 Bacteria 6141
174 Ga0097621_100688329 3300006237 Bacteria 940
175 Ga0097621_102337665 3300006237 Bacteria 511
176 Ga0068871_100003110 3300006358 Bacteria 11392
177 Ga0068871_100031973 3300006358 Bacteria 4152
178 Ga0068871_100135529 3300006358 Bacteria 2091
179 Ga0068871_100687354 3300006358 Bacteria 936
180 Ga0075428_100146442 3300006844 Bacteria 2567
181 Ga0075433_10946217 3300006852 Bacteria 751
182 Ga0068865_100000240 3300006881 Bacteria 30384
183 Ga0068865_100078003 3300006881 Bacteria 2369
184 Ga0068865_100805832 3300006881 Bacteria 810
185 Ga0068865_101771005 3300006881 Bacteria 558
186 Ga0068865_101851568 3300006881 Bacteria 546
187 Ga0097620_100000478 3300006931 Bacteria 39430
188 Ga0097620_100081305 3300006931 Bacteria 3282
189 Ga0097620_100361978 3300006931 Bacteria 1546
190 Ga0097620_100423530 3300006931 Bacteria 1427
191 Ga0097620_101715365 3300006931 Unclassified 694
192 Ga0097620_101824533 3300006931 Bacteria 672
193 Ga0099795_10000031 3300007788 Bacteria 38284
194 Ga0105240_10073297 3300009093 Bacteria 4228
195 Ga0105240_10985831 3300009093 Bacteria 902
196 Ga0111539_11596326 3300009094 Bacteria 757
197 Ga0105245_10000300 3300009098 Bacteria 47446
198 Ga0105245_10242820 3300009098 Bacteria 1746
199 Ga0105243_10963662 3300009148 Bacteria 853
200 Ga0105241_10022584 3300009174 Bacteria 4661
201 Ga0105241_10107661 3300009174 Bacteria 2227
202 Ga0105242_11861058 3300009176 Bacteria 641
203 Ga0105248_10002741 3300009177 Bacteria 19562
204 Ga0105248_10071273 3300009177 Bacteria 3904
205 Ga0105248_10320192 3300009177 Bacteria 1747
206 Ga0105248_11904888 3300009177 Bacteria 675
207 Ga0105237_10104344 3300009545 Bacteria 2826
208 Ga0105237_10747342 3300009545 Bacteria 985
209 Ga0105238_10173045 3300009551 Bacteria 2136
210 Ga0105249_10248255 3300009553 Bacteria 1763
211 Ga0105249_10846682 3300009553 Bacteria 980
212 Ga0105249_10849157 3300009553 Bacteria 979
213 Ga0099796_10000003 3300010159 Bacteria 81717
214 Ga0105239_10001674 3300010375 Bacteria 29219
215 Ga0105239_10044676 3300010375 Bacteria 4856
216 Ga0105239_12470039 3300010375 Bacteria 605
217 Ga0105246_10021355 3300011119 Bacteria 4166
218 Ga0105246_10657715 3300011119 Bacteria 913
219 Ga0157316_1021749 3300012510 Bacteria 708
220 Ga0157373_10006164 3300013100 Bacteria 8961
221 Ga0157373_10048822 3300013100 Bacteria 3017
222 Ga0157371_10000677 3300013102 Bacteria 40414
223 Ga0157371_10244322 3300013102 Bacteria 1292
224 Ga0157371_10343656 3300013102 Bacteria 1086
225 Ga0157374_10274529 3300013296 Bacteria 1663
226 Ga0157378_10000319 3300013297 Bacteria 47265
227 Ga0157378_10002011 3300013297 Bacteria 18196
228 Ga0157378_10553955 3300013297 Bacteria 1155
229 Ga0157378_12100620 3300013297 Bacteria 615
230 Ga0163162_10092140 3300013306 Bacteria 3114
231 Ga0163162_10148645 3300013306 Bacteria 2460
232 Ga0163162_10329052 3300013306 Bacteria 1660
233 Ga0163162_12907011 3300013306 Bacteria 551
234 Ga0157372_10045485 3300013307 Bacteria 4870
235 Ga0157372_10118298 3300013307 Bacteria 3040
236 Ga0157375_11153230 3300013308 Bacteria 908
237 Ga0157375_11548194 3300013308 Bacteria 783
238 Ga0157375_11975236 3300013308 Bacteria 693
239 Ga0157375_12141719 3300013308 Bacteria 666
240 Ga0163163_11351369 3300014325 Bacteria 774
241 Ga0157380_10146412 3300014326 Bacteria 2036
242 Ga0157380_12540990 3300014326 Bacteria 578
243 Ga0157380_12900403 3300014326 Bacteria 546
244 Ga0182008_10140682 3300014497 Bacteria 1207
245 Ga0157377_11375320 3300014745 Bacteria 555
246 Ga0157379_10004109 3300014968 Bacteria 12417
247 Ga0157379_10524957 3300014968 Bacteria 1099
248 Ga0157376_10943343 3300014969 Bacteria 883
249 Ga0157376_11044200 3300014969 Bacteria 841
250 Ga0157376_11463066 3300014969 Bacteria 716
251 Ga0157376_11802179 3300014969 Bacteria 648
252 Ga0163161_10257904 3300017792 Bacteria 1361
253 Ga0163161_10274604 3300017792 Bacteria 1320
254 Ga0163161_11755176 3300017792 Bacteria 551
255 Ga0207697_10000026 3300025315 Bacteria 52498
256 Ga0207697_10052837 3300025315 Bacteria 1682
257 Ga0207682_10100070 3300025893 Bacteria 1266
258 Ga0207682_10508763 3300025893 Bacteria 570
259 Ga0207642_10103214 3300025899 Bacteria 1436
260 Ga0207688_10000055 3300025901 Bacteria 41067
261 Ga0207688_10281807 3300025901 Bacteria 1013
262 Ga0207680_10032511 3300025903 Bacteria 2966
263 Ga0207680_10169596 3300025903 Bacteria 1469
264 Ga0207680_10913703 3300025903 Bacteria 629
265 Ga0207647_10006361 3300025904 Bacteria 8588
266 Ga0207647_10015895 3300025904 Bacteria 5148
267 Ga0207645_10001667 3300025907 Bacteria 18069
268 Ga0207645_10002100 3300025907 Bacteria 15942
269 Ga0207645_10006444 3300025907 Bacteria 8421
270 Ga0207645_10026689 3300025907 Bacteria 3731
271 Ga0207643_10085558 3300025908 Bacteria 1831
272 Ga0207643_10229397 3300025908 Bacteria 1139
273 Ga0207643_10754082 3300025908 Bacteria 630
274 Ga0207705_10312875 3300025909 Bacteria 1206
275 Ga0207654_10033362 3300025911 Bacteria 2853
276 Ga0207654_10226725 3300025911 Bacteria 1242
277 Ga0207695_11677960 3300025913 Bacteria 516
278 Ga0207662_10458958 3300025918 Bacteria 872
279 Ga0207657_10003629 3300025919 Bacteria 16433
280 Ga0207657_10019760 3300025919 Bacteria 6386
281 Ga0207657_10616240 3300025919 Bacteria 846
282 Ga0207649_10098452 3300025920 Bacteria 1930
283 Ga0207649_10178691 3300025920 Bacteria 1484
284 Ga0207681_10001514 3300025923 Bacteria 14993
285 Ga0207681_10005327 3300025923 Bacteria 7903
286 Ga0207681_10394526 3300025923 Bacteria 1116
287 Ga0207681_10769166 3300025923 Bacteria 803
288 Ga0207681_10862737 3300025923 Bacteria 757
289 Ga0207694_10114373 3300025924 Bacteria 2149
290 Ga0207650_10007009 3300025925 Bacteria 7688
291 Ga0207650_10021094 3300025925 Bacteria 4604
292 Ga0207650_10044004 3300025925 Bacteria 3280
293 Ga0207650_10076214 3300025925 Bacteria 2533
294 Ga0207650_10174316 3300025925 Bacteria 1711
295 Ga0207659_10028105 3300025926 Bacteria 3818
296 Ga0207659_10907981 3300025926 Bacteria 757
297 Ga0207659_11408748 3300025926 Bacteria 597
298 Ga0207687_10003666 3300025927 Bacteria 10346
299 Ga0207687_10356146 3300025927 Bacteria 1193
300 Ga0207644_10114557 3300025931 Bacteria 2043
301 Ga0207644_10146332 3300025931 Bacteria 1824
302 Ga0207644_10185868 3300025931 Bacteria 1631
303 Ga0207690_10007026 3300025932 Bacteria 6676
304 Ga0207690_10149315 3300025932 Bacteria 1731
305 Ga0207706_10000278 3300025933 Bacteria 55758
306 Ga0207706_10010239 3300025933 Bacteria 8573
307 Ga0207706_10628496 3300025933 Bacteria 921
308 Ga0207686_11371647 3300025934 Bacteria 581
309 Ga0207709_11156602 3300025935 Bacteria 637
310 Ga0207670_10049248 3300025936 Bacteria 2817
311 Ga0207670_10333602 3300025936 Bacteria 1197
312 Ga0207669_10013438 3300025937 Bacteria 4066
313 Ga0207669_10253215 3300025937 Bacteria 1312
314 Ga0207669_10584039 3300025937 Bacteria 906
315 Ga0207669_11291413 3300025937 Bacteria 620
316 Ga0207704_10005707 3300025938 Bacteria 5753
317 Ga0207704_10783983 3300025938 Bacteria 795
318 Ga0207691_10000045 3300025940 Bacteria 99798
319 Ga0207691_10011068 3300025940 Bacteria 8659
320 Ga0207691_10029849 3300025940 Bacteria 5099
321 Ga0207711_10003154 3300025941 Bacteria 14370
322 Ga0207711_10060382 3300025941 Bacteria 3267
323 Ga0207711_10335816 3300025941 Bacteria 1398
324 Ga0207711_10404093 3300025941 Bacteria 1269
325 Ga0207689_10000182 3300025942 Bacteria 54476
326 Ga0207689_10065887 3300025942 Bacteria 2979
327 Ga0207689_11050887 3300025942 Bacteria 687
328 Ga0207661_10497883 3300025944 Bacteria 1113
329 Ga0207679_10044041 3300025945 Bacteria 3218
330 Ga0207679_10067699 3300025945 Bacteria 2680
331 Ga0207667_10007486 3300025949 Bacteria 13111
332 Ga0207667_10013523 3300025949 Bacteria 9332
333 Ga0207667_10735269 3300025949 Bacteria 987
334 Ga0207667_11379433 3300025949 Bacteria 679
335 Ga0207667_11383547 3300025949 Bacteria 678
336 Ga0207651_10004393 3300025960 Bacteria 7096
337 Ga0207651_10039220 3300025960 Bacteria 3121
338 Ga0207651_10257550 3300025960 Bacteria 1431
339 Ga0207651_10259317 3300025960 Bacteria 1426
340 Ga0207651_10451071 3300025960 Bacteria 1103
341 Ga0207712_10086969 3300025961 Bacteria 2291
342 Ga0207712_10169636 3300025961 Bacteria 1704
343 Ga0207712_10610657 3300025961 Bacteria 944
344 Ga0207712_11047616 3300025961 Bacteria 725
345 Ga0207668_10000050 3300025972 Bacteria 98767
346 Ga0207668_10006477 3300025972 Bacteria 6924
347 Ga0207668_10067122 3300025972 Bacteria 2546
348 Ga0207668_10146889 3300025972 Bacteria 1820
349 Ga0207668_11032761 3300025972 Bacteria 735
350 Ga0207640_10000849 3300025981 Bacteria 17357
351 Ga0207640_10727931 3300025981 Bacteria 853
352 Ga0207658_10002786 3300025986 Bacteria 12583
353 Ga0207658_10018210 3300025986 Bacteria 4846
354 Ga0207658_10037004 3300025986 Bacteria 3503
355 Ga0207658_10086859 3300025986 Bacteria 2413
356 Ga0207658_10112529 3300025986 Bacteria 2154
357 Ga0207658_10465319 3300025986 Bacteria 1121
358 Ga0207658_10564545 3300025986 Bacteria 1019
359 Ga0207658_10759345 3300025986 Bacteria 878
360 Ga0207677_10003889 3300026023 Bacteria 7950
361 Ga0207677_10124677 3300026023 Bacteria 1944
362 Ga0207677_10486508 3300026023 Bacteria 1064
363 Ga0207703_10012911 3300026035 Bacteria 6510
364 Ga0207703_10075760 3300026035 Bacteria 2789
365 Ga0207703_10330125 3300026035 Bacteria 1399
366 Ga0207639_10002353 3300026041 Bacteria 12700
367 Ga0207639_10091249 3300026041 Bacteria 2438
368 Ga0207639_10092070 3300026041 Bacteria 2429
369 Ga0207639_11581128 3300026041 Bacteria 615
370 Ga0207678_10000680 3300026067 Bacteria 31116
371 Ga0207678_10425495 3300026067 Bacteria 1152
372 Ga0207702_10339198 3300026078 Bacteria 1435
373 Ga0207641_10004210 3300026088 Bacteria 12546
374 Ga0207641_10020495 3300026088 Bacteria 5430
375 Ga0207641_10213268 3300026088 Bacteria 1786
376 Ga0207641_10528199 3300026088 Bacteria 1148
377 Ga0207641_11640595 3300026088 Bacteria 645
378 Ga0207648_10000222 3300026089 Bacteria 61156
379 Ga0207648_10000477 3300026089 Bacteria 44735
380 Ga0207648_10003597 3300026089 Bacteria 16210
381 Ga0207648_10217515 3300026089 Bacteria 1697
382 Ga0207676_10000878 3300026095 Bacteria 23329
383 Ga0207676_10895937 3300026095 Bacteria 870
384 Ga0207676_11455844 3300026095 Bacteria 681
385 Ga0207676_11898551 3300026095 Bacteria 594
386 Ga0207674_10003802 3300026116 Bacteria 18408
387 Ga0207674_10006997 3300026116 Bacteria 13192
388 Ga0207674_10016334 3300026116 Bacteria 8131
389 Ga0207674_10075903 3300026116 Bacteria 3370
390 Ga0207674_11651563 3300026116 Bacteria 609
391 Ga0207675_100017759 3300026118 Bacteria 6636
392 Ga0207675_101720161 3300026118 Bacteria 647
393 Ga0207683_10002113 3300026121 Bacteria 17472
394 Ga0207683_10060194 3300026121 Bacteria 3338
395 Ga0207683_10479182 3300026121 Bacteria 1148
396 Ga0207698_10004080 3300026142 Bacteria 8867
397 Ga0207698_10010501 3300026142 Bacteria 5958
398 Ga0207698_10200038 3300026142 Bacteria 1788
399 Ga0207698_10761921 3300026142 Bacteria 968
400 Ga0209973_1038867 3300027252 Bacteria 692
401 Ga0209969_1016551 3300027360 Bacteria 1082
402 Ga0210000_1013298 3300027462 Bacteria 1227
403 Ga0209995_1060033 3300027471 Bacteria 647
404 Ga0209179_1000014 3300027512 Bacteria 53305
405 Ga0209982_1026794 3300027552 Bacteria 900
406 Ga0209970_1010294 3300027614 Bacteria 1529
407 Ga0209983_1033212 3300027665 Bacteria 1104
408 Ga0209971_1003425 3300027682 Bacteria 3764
409 Ga0209974_10006175 3300027876 Bacteria 4197
410 Ga0268266_10002448 3300028379 Bacteria 19913
411 Ga0268266_10035224 3300028379 Bacteria 4258
412 Ga0268266_10088810 3300028379 Bacteria 2705
413 Ga0268266_10490393 3300028379 Bacteria 1172
414 Ga0268266_10763707 3300028379 Bacteria 933
415 Ga0268265_10093811 3300028380 Bacteria 2405
416 Ga0268265_10094838 3300028380 Bacteria 2394
417 Ga0268265_10192299 3300028380 Bacteria 1763
418 Ga0268265_10218757 3300028380 Bacteria 1665
419 Ga0268265_10872528 3300028380 Bacteria 882
420 Ga0268265_12370466 3300028380 Bacteria 537
421 Ga0268264_10000645 3300028381 Bacteria 41090
422 Ga0268264_10073507 3300028381 Bacteria 2902
423 Ga0268264_10387047 3300028381 Bacteria 1340
424 Ga0268264_11221639 3300028381 Bacteria 761
425 Ga0307515_10275765 3300028794 Bacteria 1396
426 Ga0307511_10204396 3300030521 Bacteria 1019
427 Ga0265340_10193634 3300031247 Bacteria 916
428 Ga0307513_10038130 3300031456 Bacteria 5339
429 Ga0307513_10082408 3300031456 Bacteria 3312
430 Ga0307408_100661092 3300031548 Bacteria 935
431 Ga0316579_10399559 3300031691 Unclassified 664
432 Ga0307516_10025610 3300031730 Bacteria 6005
433 Ga0307405_11438230 3300031731 Bacteria 604
434 Ga0316577_10382028 3300031733 Unclassified 800
435 Ga0307413_10193415 3300031824 Bacteria 1462
436 Ga0307413_11639359 3300031824 Bacteria 572
437 Ga0307410_10444340 3300031852 Bacteria 1056
438 Ga0307410_11529302 3300031852 Bacteria 588
439 Ga0307406_10126762 3300031901 Bacteria 1785
440 Ga0307407_10057224 3300031903 Bacteria 2261
441 Ga0307412_10634786 3300031911 Bacteria 909
442 Ga0307409_100437225 3300031995 Bacteria 1259
443 Ga0307409_100465863 3300031995 Bacteria 1223
444 Ga0307409_101057544 3300031995 Bacteria 832
445 Ga0307409_102476498 3300031995 Bacteria 548
446 Ga0307416_103283820 3300032002 Bacteria 541
447 Ga0307414_10573990 3300032004 Bacteria 1008
448 Ga0307414_10955527 3300032004 Bacteria 787
449 Ga0307414_11620255 3300032004 Bacteria 603
450 Ga0307414_11660943 3300032004 Bacteria 596
451 Ga0307411_10438491 3300032005 Bacteria 1089
452 Ga0307415_100772668 3300032126 Bacteria 874
453 Ga0373952_0266945 3300035092 Bacteria 523
454 Ga0316584_0140423 3300036712 Unclassified 1802
455 Ga0395899_0407272 3300037312 Bacteria 899
456 Ga0395900_0253253 3300037418 Bacteria 1761
457 Ga0395900_0298544 3300037418 Bacteria 1598
458 Ga0395900_1058379 3300037418 Bacteria 729
459 Ga0395905_0006451 3300037471 Bacteria 11809
460 Ga0395905_0036802 3300037471 Bacteria 4597
461 Ga0395905_0039424 3300037471 Bacteria 4432
462 Ga0395905_0227237 3300037471 Bacteria 1745
463 Ga0395905_0320091 3300037471 Bacteria 1441
464 Ga0395901_0023925 3300038443 Bacteria 6266
465 Ga0395901_0126078 3300038443 Bacteria 2691
466 Ga0395901_0442995 3300038443 Bacteria 1329
467 Ga0395901_0570200 3300038443 Bacteria 1145
468 Ga0439436_0020648 3300041404 Bacteria 1961
469 Ga0439436_0032372 3300041404 Bacteria 1516
470 Ga0439465_0024130 3300041413 Bacteria 1916
471 Ga0451800_0467010 3300041459 Bacteria 693
472 Ga0451807_1240268 3300041486 Bacteria 1588
473 Ga0451833_0733127 3300041491 Bacteria 912
474 Ga0451853_0362294 3300041512 Bacteria 852
475 Ga0451853_1185443 3300041512 Bacteria 856
476 Ga0439433_0033126 3300041999 Bacteria 1187
477 Ga0439432_007949 3300042006 Bacteria 3741
478 Ga0439432_093964 3300042006 Bacteria 901
479 Ga0439449_0022599 3300042007 Bacteria 2355
480 Ga0439449_0053628 3300042007 Bacteria 1491
481 Ga0439449_0298026 3300042007 Bacteria 608
482 Ga0439452_057420 3300042010 Bacteria 878
483 Ga0439455_0122717 3300042012 Bacteria 729
484 Ga0439457_159056 3300042014 Bacteria 546
485 Ga0439462_0006982 3300042015 Bacteria 2820
486 Ga0450892_017013 3300042130 Bacteria 689
487 Ga0439446_0061907 3300042156 Bacteria 1133
488 Ga0439458_0132410 3300042157 Bacteria 661
489 Ga0466969_0106570 3300044656 Bacteria 1315
490 Ga0466966_0102078 3300044684 Bacteria 1773
491 Ga0466961_0074249 3300044693 Bacteria 2156
492 Ga0466970_0243789 3300044765 Bacteria 1006
493 Ga0466959_0456053 3300045049 Bacteria 866
494 Ga0495638_0445815 3300046460 Bacteria 662
495 Ga0495663_0012698 3300046525 Bacteria 2349
496 Ga0495663_0042795 3300046525 Bacteria 1381
497 Ga0495663_0239231 3300046525 Bacteria 642
498 Ga0495598_0016997 3300046537 Bacteria 1868
499 Ga0495621_0002303 3300046539 Bacteria 5122
500 Ga0495621_0017566 3300046539 Bacteria 2314
501 Ga0495621_0107625 3300046539 Bacteria 1066
502 Ga0495621_0241441 3300046539 Bacteria 736
503 Ga0495633_0031366 3300046558 Bacteria 2577
504 Ga0495633_0219991 3300046558 Bacteria 869
505 Ga0495625_0601671 3300046660 Bacteria 660
506 Ga0495669_0013113 3300046684 Bacteria 3530
507 Ga0495669_0086314 3300046684 Bacteria 1445
508 Ga0495670_0016612 3300046691 Bacteria 3619
509 Ga0495670_0039391 3300046691 Bacteria 2357
510 Ga0495604_0804532 3300047317 Bacteria 592
511 Ga0495677_0098825 3300047445 Bacteria 1104
512 Ga0496104_1154589 3300048907 Bacteria 678
513 Ga0496106_0241385 3300048909 Bacteria 1444
514 Ga0496109_0951085 3300048912 Bacteria 797
515 Ga0496110_0362933 3300048913 Bacteria 1320
516 Ga0496111_0485344 3300048914 Bacteria 910
517 Ga0496114_0033955 3300048917 Bacteria 4206
518 Ga0496121_0323272 3300048924 Bacteria 1038
519 Ga0496124_0502407 3300048927 Bacteria 813
520 Ga0496125_0384236 3300048928 Bacteria 826
521 Ga0501198_094406 3300049649 Bacteria 598
522 Ga0501217_197217 3300049661 Bacteria 625
523 Ga0501223_036730 3300049663 Bacteria 952
524 Ga0501223_084624 3300049663 Bacteria 638
525 Ga0501250_077319 3300049680 Bacteria 560
526 Ga0501045_0582660 3300049824 Bacteria 829
527 nmdc:mga08y16_1269840_c1 3300050511 Bacteria 704
528 nmdc:mga0a205_770596_c1 3300050515 Bacteria 810
529 Ga0495612_0577198 3300053078 Bacteria 519
530 Ga0500651_0002997 3300053093 Bacteria 9108
531 Ga0500628_063816 3300053129 Bacteria 906
532 Ga0500568_0156005 3300053139 Bacteria 844

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035092 Ga0373952_0266945 Ga0373952_0266945_21_251 61
2 3300003781 Ga0055536_1000001 Ga0055536_1000001131 66
3 3300003791 Ga0055530_10002525 Ga0055530_100025259 66
4 iso_pu_bacteria 2643221695 2644529059 66
5 iso_pu_bacteria 2885427238 2885429251 66
6 3300005290 Ga0065712_10392011 Ga0065712_103920112 68
7 3300005293 Ga0065715_10309893 Ga0065715_103098932 68
8 3300005293 Ga0065715_10472983 Ga0065715_104729832 68
9 3300005331 Ga0070670_100164833 Ga0070670_1001648333 68
10 3300005339 Ga0070660_101065505 Ga0070660_1010655052 68
11 3300005347 Ga0070668_100985284 Ga0070668_1009852842 68
12 3300005353 Ga0070669_100968027 Ga0070669_1009680272 68
13 3300005354 Ga0070675_100057554 Ga0070675_1000575542 68
14 3300005364 Ga0070673_100392851 Ga0070673_1003928511 68
15 3300005366 Ga0070659_100019869 Ga0070659_1000198692 68
16 3300005457 Ga0070662_100257974 Ga0070662_1002579742 68
17 3300005535 Ga0070684_100172293 Ga0070684_1001722934 68
18 3300005539 Ga0068853_100523933 Ga0068853_1005239331 68
19 3300005543 Ga0070672_100232470 Ga0070672_1002324703 68
20 3300013100 Ga0157373_10048822 Ga0157373_100488224 68
21 3300013102 Ga0157371_10343656 Ga0157371_103436562 68
22 3300044656 Ga0466969_0106570 Ga0466969_0106570_761_976 68
23 3300044684 Ga0466966_0102078 Ga0466966_0102078_579_794 68
24 3300044693 Ga0466961_0074249 Ga0466961_0074249_998_1213 68
25 3300044765 Ga0466970_0243789 Ga0466970_0243789_614_829 68
26 3300045049 Ga0466959_0456053 Ga0466959_0456053_523_738 68
27 3300001915 JGI24741J21665_1061888 JGI24741J21665_10618882 69
28 3300005577 Ga0068857_100112891 Ga0068857_1001128913 69
29 3300026116 Ga0207674_10003802 Ga0207674_1000380214 69
30 3300028794 Ga0307515_10275765 Ga0307515_102757652 69
31 3300031247 Ga0265340_10193634 Ga0265340_101936342 69
32 3300031456 Ga0307513_10038130 Ga0307513_100381308 69
33 3300031456 Ga0307513_10082408 Ga0307513_100824082 69
34 3300031824 Ga0307413_10193415 Ga0307413_101934152 69
35 3300031852 Ga0307410_10444340 Ga0307410_104443402 69
36 3300031903 Ga0307407_10057224 Ga0307407_100572243 69
37 3300031995 Ga0307409_100437225 Ga0307409_1004372252 69
38 3300032004 Ga0307414_10955527 Ga0307414_109555272 69
39 3300037312 Ga0395899_0407272 Ga0395899_0407272_91_300 69
40 3300037418 Ga0395900_0298544 Ga0395900_0298544_1043_1252 69
41 3300037471 Ga0395905_0036802 Ga0395905_0036802_2950_3159 69
42 3300037471 Ga0395905_0320091 Ga0395905_0320091_969_1178 69
43 3300038443 Ga0395901_0126078 Ga0395901_0126078_1737_1946 69
44 3300038443 Ga0395901_0570200 Ga0395901_0570200_617_826 69
45 3300001915 JGI24741J21665_1009536 JGI24741J21665_10095363 70
46 3300001979 JGI24740J21852_10000281 JGI24740J21852_1000028115 70
47 3300001979 JGI24740J21852_10001858 JGI24740J21852_1000185810 70
48 3300001989 JGI24739J22299_10000453 JGI24739J22299_100004537 70
49 3300001989 JGI24739J22299_10028526 JGI24739J22299_100285263 70
50 3300001991 JGI24743J22301_10003697 JGI24743J22301_100036973 70
51 3300002067 JGI24735J21928_10116153 JGI24735J21928_101161532 70
52 3300002067 JGI24735J21928_10205939 JGI24735J21928_102059392 70
53 3300002073 JGI24745J21846_1049948 JGI24745J21846_10499482 70
54 3300002075 JGI24738J21930_10000062 JGI24738J21930_1000006219 70
55 3300002075 JGI24738J21930_10007364 JGI24738J21930_100073643 70
56 3300002239 JGI24034J26672_10056892 JGI24034J26672_100568922 70
57 3300002244 JGI24742J22300_10022402 JGI24742J22300_100224023 70
58 3300003322 rootL2_10045740 rootL2_100457406 70
59 3300003371 JGI26145J50221_1017606 JGI26145J50221_10176062 70
60 3300005293 Ga0065715_11180609 Ga0065715_111806092 70
61 3300005295 Ga0065707_10276566 Ga0065707_102765663 70
62 3300005327 Ga0070658_10383998 Ga0070658_103839982 70
63 3300005328 Ga0070676_10002169 Ga0070676_100021697 70
64 3300005328 Ga0070676_10003504 Ga0070676_100035044 70
65 3300005328 Ga0070676_10011228 Ga0070676_100112284 70
66 3300005329 Ga0070683_100493296 Ga0070683_1004932962 70
67 3300005330 Ga0070690_100018652 Ga0070690_1000186525 70
68 3300005331 Ga0070670_100007258 Ga0070670_10000725810 70
69 3300005331 Ga0070670_100010365 Ga0070670_1000103659 70
70 3300005331 Ga0070670_100211938 Ga0070670_1002119382 70
71 3300005333 Ga0070677_10333173 Ga0070677_103331732 70
72 3300005333 Ga0070677_10387166 Ga0070677_103871661 70
73 3300005334 Ga0068869_100034193 Ga0068869_1000341936 70
74 3300005334 Ga0068869_100071883 Ga0068869_1000718832 70
75 3300005334 Ga0068869_101238510 Ga0068869_1012385102 70
76 3300005335 Ga0070666_10072348 Ga0070666_100723482 70
77 3300005335 Ga0070666_10213518 Ga0070666_102135182 70
78 3300005337 Ga0070682_100265687 Ga0070682_1002656872 70
79 3300005338 Ga0068868_100000637 Ga0068868_1000006378 70
80 3300005338 Ga0068868_100403480 Ga0068868_1004034803 70
81 3300005338 Ga0068868_101275133 Ga0068868_1012751332 70
82 3300005339 Ga0070660_100002082 Ga0070660_10000208212 70
83 3300005339 Ga0070660_100040988 Ga0070660_1000409884 70
84 3300005340 Ga0070689_100009615 Ga0070689_1000096155 70
85 3300005340 Ga0070689_101006175 Ga0070689_1010061752 70
86 3300005343 Ga0070687_100235595 Ga0070687_1002355952 70
87 3300005344 Ga0070661_100061480 Ga0070661_1000614804 70
88 3300005344 Ga0070661_100338365 Ga0070661_1003383652 70
89 3300005347 Ga0070668_100005175 Ga0070668_10000517512 70
90 3300005347 Ga0070668_100032860 Ga0070668_1000328603 70
91 3300005347 Ga0070668_100070106 Ga0070668_1000701063 70
92 3300005347 Ga0070668_100142841 Ga0070668_1001428412 70
93 3300005347 Ga0070668_100727650 Ga0070668_1007276502 70
94 3300005347 Ga0070668_101213518 Ga0070668_1012135182 70
95 3300005353 Ga0070669_100000862 Ga0070669_1000008626 70
96 3300005353 Ga0070669_100059502 Ga0070669_1000595023 70
97 3300005353 Ga0070669_100118774 Ga0070669_1001187743 70
98 3300005354 Ga0070675_100047334 Ga0070675_1000473343 70
99 3300005354 Ga0070675_100237497 Ga0070675_1002374972 70
100 3300005355 Ga0070671_100094852 Ga0070671_1000948524 70
101 3300005355 Ga0070671_100157220 Ga0070671_1001572202 70
102 3300005355 Ga0070671_100158914 Ga0070671_1001589141 70
103 3300005355 Ga0070671_100224615 Ga0070671_1002246152 70
104 3300005356 Ga0070674_100001982 Ga0070674_1000019825 70
105 3300005356 Ga0070674_100051087 Ga0070674_1000510872 70
106 3300005356 Ga0070674_100054275 Ga0070674_1000542752 70
107 3300005356 Ga0070674_102013308 Ga0070674_1020133081 70
108 3300005364 Ga0070673_100000209 Ga0070673_10000020911 70
109 3300005364 Ga0070673_100050975 Ga0070673_1000509753 70
110 3300005364 Ga0070673_100096310 Ga0070673_1000963102 70
111 3300005364 Ga0070673_100446684 Ga0070673_1004466843 70
112 3300005364 Ga0070673_102075286 Ga0070673_1020752861 70
113 3300005365 Ga0070688_100046454 Ga0070688_1000464544 70
114 3300005366 Ga0070659_100007835 Ga0070659_1000078356 70
115 3300005366 Ga0070659_100679062 Ga0070659_1006790621 70
116 3300005367 Ga0070667_100004734 Ga0070667_1000047347 70
117 3300005367 Ga0070667_100021153 Ga0070667_1000211536 70
118 3300005367 Ga0070667_100047130 Ga0070667_1000471303 70
119 3300005367 Ga0070667_100090330 Ga0070667_1000903303 70
120 3300005367 Ga0070667_100277726 Ga0070667_1002777262 70
121 3300005455 Ga0070663_100090984 Ga0070663_1000909843 70
122 3300005455 Ga0070663_100186768 Ga0070663_1001867682 70
123 3300005456 Ga0070678_100009113 Ga0070678_1000091136 70
124 3300005456 Ga0070678_100123475 Ga0070678_1001234753 70
125 3300005456 Ga0070678_101126115 Ga0070678_1011261151 70
126 3300005457 Ga0070662_100001955 Ga0070662_1000019555 70
127 3300005457 Ga0070662_100023820 Ga0070662_1000238204 70
128 3300005459 Ga0068867_100000633 Ga0068867_10000063326 70
129 3300005459 Ga0068867_100011413 Ga0068867_1000114135 70
130 3300005459 Ga0068867_100280746 Ga0068867_1002807462 70
131 3300005459 Ga0068867_100426594 Ga0068867_1004265942 70
132 3300005459 Ga0068867_101247915 Ga0068867_1012479152 70
133 3300005466 Ga0070685_10627910 Ga0070685_106279102 70
134 3300005466 Ga0070685_11421709 Ga0070685_114217091 70
135 3300005535 Ga0070684_100274351 Ga0070684_1002743513 70
136 3300005539 Ga0068853_100002063 Ga0068853_10000206315 70
137 3300005539 Ga0068853_100072330 Ga0068853_1000723302 70
138 3300005539 Ga0068853_100367506 Ga0068853_1003675062 70
139 3300005539 Ga0068853_101221415 Ga0068853_1012214152 70
140 3300005543 Ga0070672_100000770 Ga0070672_10000077017 70
141 3300005543 Ga0070672_100017202 Ga0070672_1000172026 70
142 3300005544 Ga0070686_100432174 Ga0070686_1004321742 70
143 3300005548 Ga0070665_100020763 Ga0070665_1000207633 70
144 3300005548 Ga0070665_100113415 Ga0070665_1001134153 70
145 3300005548 Ga0070665_100205173 Ga0070665_1002051734 70
146 3300005548 Ga0070665_100219334 Ga0070665_1002193343 70
147 3300005548 Ga0070665_100772776 Ga0070665_1007727762 70
148 3300005548 Ga0070665_101677195 Ga0070665_1016771952 70
149 3300005548 Ga0070665_102245599 Ga0070665_1022455992 70
150 3300005563 Ga0068855_100032514 Ga0068855_1000325145 70
151 3300005563 Ga0068855_100039372 Ga0068855_1000393726 70
152 3300005563 Ga0068855_102198285 Ga0068855_1021982852 70
153 3300005564 Ga0070664_100009081 Ga0070664_1000090815 70
154 3300005564 Ga0070664_100535128 Ga0070664_1005351281 70
155 3300005577 Ga0068857_100004161 Ga0068857_1000041615 70
156 3300005577 Ga0068857_100055828 Ga0068857_1000558284 70
157 3300005577 Ga0068857_100123051 Ga0068857_1001230513 70
158 3300005578 Ga0068854_100000614 Ga0068854_10000061420 70
159 3300005578 Ga0068854_100174976 Ga0068854_1001749763 70
160 3300005614 Ga0068856_101558655 Ga0068856_1015586552 70
161 3300005616 Ga0068852_100000804 Ga0068852_10000080421 70
162 3300005616 Ga0068852_100040971 Ga0068852_1000409713 70
163 3300005616 Ga0068852_100046769 Ga0068852_1000467691 70
164 3300005616 Ga0068852_100845172 Ga0068852_1008451722 70
165 3300005616 Ga0068852_101668583 Ga0068852_1016685832 70
166 3300005617 Ga0068859_100000478 Ga0068859_10000047835 70
167 3300005617 Ga0068859_100081304 Ga0068859_1000813044 70
168 3300005617 Ga0068859_100362012 Ga0068859_1003620122 70
169 3300005617 Ga0068859_100423511 Ga0068859_1004235112 70
170 3300005617 Ga0068859_101715419 Ga0068859_1017154192 70
171 3300005617 Ga0068859_101824558 Ga0068859_1018245582 70
172 3300005618 Ga0068864_100000174 Ga0068864_10000017470 70
173 3300005618 Ga0068864_100080716 Ga0068864_1000807162 70
174 3300005618 Ga0068864_101021095 Ga0068864_1010210951 70
175 3300005618 Ga0068864_101048728 Ga0068864_1010487281 70
176 3300005718 Ga0068866_10167121 Ga0068866_101671213 70
177 3300005719 Ga0068861_100010621 Ga0068861_1000106213 70
178 3300005719 Ga0068861_100466169 Ga0068861_1004661692 70
179 3300005834 Ga0068851_11006818 Ga0068851_110068182 70
180 3300005840 Ga0068870_10123162 Ga0068870_101231623 70
181 3300005840 Ga0068870_10170620 Ga0068870_101706202 70
182 3300005840 Ga0068870_10740287 Ga0068870_107402872 70
183 3300005841 Ga0068863_100004878 Ga0068863_1000048786 70
184 3300005841 Ga0068863_100076008 Ga0068863_1000760082 70
185 3300005841 Ga0068863_100106113 Ga0068863_1001061133 70
186 3300005841 Ga0068863_101086016 Ga0068863_1010860162 70
187 3300005842 Ga0068858_100068281 Ga0068858_1000682813 70
188 3300005842 Ga0068858_100372130 Ga0068858_1003721302 70
189 3300005842 Ga0068858_100374413 Ga0068858_1003744131 70
190 3300005843 Ga0068860_100005690 Ga0068860_10000569010 70
191 3300005843 Ga0068860_100005831 Ga0068860_1000058313 70
192 3300005843 Ga0068860_100412817 Ga0068860_1004128172 70
193 3300005844 Ga0068862_100071036 Ga0068862_1000710363 70
194 3300005844 Ga0068862_100121478 Ga0068862_1001214781 70
195 3300005844 Ga0068862_100315881 Ga0068862_1003158811 70
196 3300005844 Ga0068862_100468845 Ga0068862_1004688452 70
197 3300005844 Ga0068862_100726929 Ga0068862_1007269292 70
198 3300005983 Ga0081540_1007109 Ga0081540_10071098 70
199 3300006237 Ga0097621_100013235 Ga0097621_1000132355 70
200 3300006237 Ga0097621_100688329 Ga0097621_1006883292 70
201 3300006237 Ga0097621_102337665 Ga0097621_1023376651 70
202 3300006358 Ga0068871_100003110 Ga0068871_1000031108 70
203 3300006358 Ga0068871_100031973 Ga0068871_1000319732 70
204 3300006358 Ga0068871_100135529 Ga0068871_1001355295 70
205 3300006358 Ga0068871_100687354 Ga0068871_1006873542 70
206 3300006844 Ga0075428_100146442 Ga0075428_1001464422 70
207 3300006852 Ga0075433_10946217 Ga0075433_109462172 70
208 3300006881 Ga0068865_100000240 Ga0068865_10000024018 70
209 3300006881 Ga0068865_100078003 Ga0068865_1000780032 70
210 3300006881 Ga0068865_100805832 Ga0068865_1008058322 70
211 3300006881 Ga0068865_101771005 Ga0068865_1017710052 70
212 3300006881 Ga0068865_101851568 Ga0068865_1018515682 70
213 3300006931 Ga0097620_100000478 Ga0097620_10000047835 70
214 3300006931 Ga0097620_100081305 Ga0097620_1000813054 70
215 3300006931 Ga0097620_100361978 Ga0097620_1003619782 70
216 3300006931 Ga0097620_100423530 Ga0097620_1004235302 70
217 3300006931 Ga0097620_101715365 Ga0097620_1017153652 70
218 3300006931 Ga0097620_101824533 Ga0097620_1018245332 70
219 3300007788 Ga0099795_10000031 Ga0099795_1000003120 70
220 3300009093 Ga0105240_10073297 Ga0105240_100732974 70
221 3300009093 Ga0105240_10985831 Ga0105240_109858313 70
222 3300009094 Ga0111539_11596326 Ga0111539_115963262 70
223 3300009098 Ga0105245_10000300 Ga0105245_1000030026 70
224 3300009098 Ga0105245_10242820 Ga0105245_102428202 70
225 3300009148 Ga0105243_10963662 Ga0105243_109636621 70
226 3300009174 Ga0105241_10022584 Ga0105241_100225846 70
227 3300009174 Ga0105241_10107661 Ga0105241_101076614 70
228 3300009176 Ga0105242_11861058 Ga0105242_118610582 70
229 3300009177 Ga0105248_10002741 Ga0105248_1000274113 70
230 3300009177 Ga0105248_10071273 Ga0105248_100712733 70
231 3300009177 Ga0105248_10320192 Ga0105248_103201923 70
232 3300009177 Ga0105248_11904888 Ga0105248_119048882 70
233 3300009545 Ga0105237_10104344 Ga0105237_101043442 70
234 3300009545 Ga0105237_10747342 Ga0105237_107473422 70
235 3300009551 Ga0105238_10173045 Ga0105238_101730453 70
236 3300009553 Ga0105249_10248255 Ga0105249_102482553 70
237 3300009553 Ga0105249_10846682 Ga0105249_108466823 70
238 3300009553 Ga0105249_10849157 Ga0105249_108491572 70
239 3300010159 Ga0099796_10000003 Ga0099796_100000034 70
240 3300010375 Ga0105239_10001674 Ga0105239_1000167413 70
241 3300010375 Ga0105239_10044676 Ga0105239_100446766 70
242 3300010375 Ga0105239_12470039 Ga0105239_124700391 70
243 3300011119 Ga0105246_10021355 Ga0105246_100213552 70
244 3300011119 Ga0105246_10657715 Ga0105246_106577152 70
245 3300012510 Ga0157316_1021749 Ga0157316_10217492 70
246 3300013100 Ga0157373_10006164 Ga0157373_100061645 70
247 3300013102 Ga0157371_10000677 Ga0157371_1000067729 70
248 3300013102 Ga0157371_10244322 Ga0157371_102443223 70
249 3300013296 Ga0157374_10274529 Ga0157374_102745292 70
250 3300013297 Ga0157378_10000319 Ga0157378_1000031924 70
251 3300013297 Ga0157378_10002011 Ga0157378_1000201114 70
252 3300013297 Ga0157378_10553955 Ga0157378_105539552 70
253 3300013297 Ga0157378_12100620 Ga0157378_121006202 70
254 3300013306 Ga0163162_10092140 Ga0163162_100921403 70
255 3300013306 Ga0163162_10148645 Ga0163162_101486453 70
256 3300013306 Ga0163162_10329052 Ga0163162_103290522 70
257 3300013306 Ga0163162_12907011 Ga0163162_129070111 70
258 3300013307 Ga0157372_10045485 Ga0157372_100454855 70
259 3300013307 Ga0157372_10118298 Ga0157372_101182984 70
260 3300013308 Ga0157375_11153230 Ga0157375_111532302 70
261 3300013308 Ga0157375_11548194 Ga0157375_115481942 70
262 3300013308 Ga0157375_11975236 Ga0157375_119752362 70
263 3300013308 Ga0157375_12141719 Ga0157375_121417192 70
264 3300014325 Ga0163163_11351369 Ga0163163_113513692 70
265 3300014326 Ga0157380_10146412 Ga0157380_101464123 70
266 3300014326 Ga0157380_12540990 Ga0157380_125409902 70
267 3300014326 Ga0157380_12900403 Ga0157380_129004032 70
268 3300014497 Ga0182008_10140682 Ga0182008_101406822 70
269 3300014745 Ga0157377_11375320 Ga0157377_113753201 70
270 3300014968 Ga0157379_10004109 Ga0157379_1000410913 70
271 3300014968 Ga0157379_10524957 Ga0157379_105249572 70
272 3300014969 Ga0157376_10943343 Ga0157376_109433432 70
273 3300014969 Ga0157376_11044200 Ga0157376_110442002 70
274 3300014969 Ga0157376_11463066 Ga0157376_114630662 70
275 3300014969 Ga0157376_11802179 Ga0157376_118021792 70
276 3300017792 Ga0163161_10257904 Ga0163161_102579042 70
277 3300017792 Ga0163161_10274604 Ga0163161_102746041 70
278 3300017792 Ga0163161_11755176 Ga0163161_117551762 70
279 3300025315 Ga0207697_10000026 Ga0207697_1000002635 70
280 3300025315 Ga0207697_10052837 Ga0207697_100528372 70
281 3300025893 Ga0207682_10100070 Ga0207682_101000702 70
282 3300025893 Ga0207682_10508763 Ga0207682_105087632 70
283 3300025899 Ga0207642_10103214 Ga0207642_101032142 70
284 3300025901 Ga0207688_10000055 Ga0207688_1000005513 70
285 3300025901 Ga0207688_10281807 Ga0207688_102818072 70
286 3300025903 Ga0207680_10032511 Ga0207680_100325114 70
287 3300025903 Ga0207680_10169596 Ga0207680_101695961 70
288 3300025903 Ga0207680_10913703 Ga0207680_109137032 70
289 3300025904 Ga0207647_10006361 Ga0207647_1000636110 70
290 3300025904 Ga0207647_10015895 Ga0207647_100158956 70
291 3300025907 Ga0207645_10001667 Ga0207645_1000166716 70
292 3300025907 Ga0207645_10002100 Ga0207645_100021007 70
293 3300025907 Ga0207645_10006444 Ga0207645_100064445 70
294 3300025907 Ga0207645_10026689 Ga0207645_100266893 70
295 3300025908 Ga0207643_10085558 Ga0207643_100855582 70
296 3300025908 Ga0207643_10229397 Ga0207643_102293973 70
297 3300025908 Ga0207643_10754082 Ga0207643_107540821 70
298 3300025909 Ga0207705_10312875 Ga0207705_103128752 70
299 3300025911 Ga0207654_10033362 Ga0207654_100333624 70
300 3300025911 Ga0207654_10226725 Ga0207654_102267252 70
301 3300025913 Ga0207695_11677960 Ga0207695_116779602 70
302 3300025918 Ga0207662_10458958 Ga0207662_104589582 70
303 3300025919 Ga0207657_10003629 Ga0207657_1000362913 70
304 3300025919 Ga0207657_10019760 Ga0207657_100197603 70
305 3300025919 Ga0207657_10616240 Ga0207657_106162402 70
306 3300025920 Ga0207649_10098452 Ga0207649_100984523 70
307 3300025920 Ga0207649_10178691 Ga0207649_101786914 70
308 3300025923 Ga0207681_10001514 Ga0207681_1000151413 70
309 3300025923 Ga0207681_10005327 Ga0207681_100053274 70
310 3300025923 Ga0207681_10394526 Ga0207681_103945261 70
311 3300025923 Ga0207681_10769166 Ga0207681_107691662 70
312 3300025923 Ga0207681_10862737 Ga0207681_108627372 70
313 3300025924 Ga0207694_10114373 Ga0207694_101143732 70
314 3300025925 Ga0207650_10007009 Ga0207650_100070094 70
315 3300025925 Ga0207650_10021094 Ga0207650_100210942 70
316 3300025925 Ga0207650_10044004 Ga0207650_100440045 70
317 3300025925 Ga0207650_10076214 Ga0207650_100762142 70
318 3300025925 Ga0207650_10174316 Ga0207650_101743163 70
319 3300025926 Ga0207659_10028105 Ga0207659_100281053 70
320 3300025926 Ga0207659_10907981 Ga0207659_109079812 70
321 3300025926 Ga0207659_11408748 Ga0207659_114087482 70
322 3300025927 Ga0207687_10003666 Ga0207687_100036664 70
323 3300025927 Ga0207687_10356146 Ga0207687_103561462 70
324 3300025931 Ga0207644_10114557 Ga0207644_101145572 70
325 3300025931 Ga0207644_10146332 Ga0207644_101463323 70
326 3300025931 Ga0207644_10185868 Ga0207644_101858682 70
327 3300025932 Ga0207690_10007026 Ga0207690_100070265 70
328 3300025932 Ga0207690_10149315 Ga0207690_101493153 70
329 3300025933 Ga0207706_10000278 Ga0207706_1000027825 70
330 3300025933 Ga0207706_10010239 Ga0207706_100102397 70
331 3300025933 Ga0207706_10628496 Ga0207706_106284963 70
332 3300025934 Ga0207686_11371647 Ga0207686_113716472 70
333 3300025935 Ga0207709_11156602 Ga0207709_111566022 70
334 3300025936 Ga0207670_10049248 Ga0207670_100492483 70
335 3300025936 Ga0207670_10333602 Ga0207670_103336022 70
336 3300025937 Ga0207669_10013438 Ga0207669_100134383 70
337 3300025937 Ga0207669_10253215 Ga0207669_102532152 70
338 3300025937 Ga0207669_10584039 Ga0207669_105840392 70
339 3300025937 Ga0207669_11291413 Ga0207669_112914132 70
340 3300025938 Ga0207704_10005707 Ga0207704_100057077 70
341 3300025938 Ga0207704_10783983 Ga0207704_107839832 70
342 3300025940 Ga0207691_10000045 Ga0207691_1000004525 70
343 3300025940 Ga0207691_10011068 Ga0207691_100110682 70
344 3300025940 Ga0207691_10029849 Ga0207691_100298494 70
345 3300025941 Ga0207711_10003154 Ga0207711_100031546 70
346 3300025941 Ga0207711_10060382 Ga0207711_100603824 70
347 3300025941 Ga0207711_10335816 Ga0207711_103358161 70
348 3300025941 Ga0207711_10404093 Ga0207711_104040932 70
349 3300025942 Ga0207689_10000182 Ga0207689_1000018232 70
350 3300025942 Ga0207689_10065887 Ga0207689_100658874 70
351 3300025942 Ga0207689_11050887 Ga0207689_110508872 70
352 3300025944 Ga0207661_10497883 Ga0207661_104978832 70
353 3300025945 Ga0207679_10044041 Ga0207679_100440413 70
354 3300025945 Ga0207679_10067699 Ga0207679_100676992 70
355 3300025949 Ga0207667_10007486 Ga0207667_1000748612 70
356 3300025949 Ga0207667_10013523 Ga0207667_100135232 70
357 3300025949 Ga0207667_10735269 Ga0207667_107352693 70
358 3300025949 Ga0207667_11379433 Ga0207667_113794332 70
359 3300025949 Ga0207667_11383547 Ga0207667_113835472 70
360 3300025960 Ga0207651_10004393 Ga0207651_100043939 70
361 3300025960 Ga0207651_10039220 Ga0207651_100392204 70
362 3300025960 Ga0207651_10257550 Ga0207651_102575502 70
363 3300025960 Ga0207651_10259317 Ga0207651_102593173 70
364 3300025960 Ga0207651_10451071 Ga0207651_104510712 70
365 3300025961 Ga0207712_10086969 Ga0207712_100869692 70
366 3300025961 Ga0207712_10169636 Ga0207712_101696363 70
367 3300025961 Ga0207712_10610657 Ga0207712_106106573 70
368 3300025961 Ga0207712_11047616 Ga0207712_110476162 70
369 3300025972 Ga0207668_10000050 Ga0207668_10000050111 70
370 3300025972 Ga0207668_10006477 Ga0207668_100064773 70
371 3300025972 Ga0207668_10067122 Ga0207668_100671222 70
372 3300025972 Ga0207668_10146889 Ga0207668_101468892 70
373 3300025972 Ga0207668_11032761 Ga0207668_110327612 70
374 3300025981 Ga0207640_10000849 Ga0207640_1000084912 70
375 3300025981 Ga0207640_10727931 Ga0207640_107279312 70
376 3300025986 Ga0207658_10002786 Ga0207658_100027863 70
377 3300025986 Ga0207658_10018210 Ga0207658_100182107 70
378 3300025986 Ga0207658_10037004 Ga0207658_100370042 70
379 3300025986 Ga0207658_10086859 Ga0207658_100868592 70
380 3300025986 Ga0207658_10112529 Ga0207658_101125293 70
381 3300025986 Ga0207658_10465319 Ga0207658_104653192 70
382 3300025986 Ga0207658_10564545 Ga0207658_105645452 70
383 3300025986 Ga0207658_10759345 Ga0207658_107593452 70
384 3300026023 Ga0207677_10003889 Ga0207677_100038896 70
385 3300026023 Ga0207677_10124677 Ga0207677_101246773 70
386 3300026023 Ga0207677_10486508 Ga0207677_104865082 70
387 3300026035 Ga0207703_10012911 Ga0207703_1001291110 70
388 3300026035 Ga0207703_10075760 Ga0207703_100757602 70
389 3300026035 Ga0207703_10330125 Ga0207703_103301251 70
390 3300026041 Ga0207639_10002353 Ga0207639_100023535 70
391 3300026041 Ga0207639_10091249 Ga0207639_100912494 70
392 3300026041 Ga0207639_10092070 Ga0207639_100920702 70
393 3300026041 Ga0207639_11581128 Ga0207639_115811282 70
394 3300026067 Ga0207678_10000680 Ga0207678_1000068026 70
395 3300026067 Ga0207678_10425495 Ga0207678_104254952 70
396 3300026078 Ga0207702_10339198 Ga0207702_103391981 70
397 3300026088 Ga0207641_10004210 Ga0207641_100042109 70
398 3300026088 Ga0207641_10020495 Ga0207641_100204956 70
399 3300026088 Ga0207641_10213268 Ga0207641_102132682 70
400 3300026088 Ga0207641_10528199 Ga0207641_105281992 70
401 3300026088 Ga0207641_11640595 Ga0207641_116405952 70
402 3300026089 Ga0207648_10000222 Ga0207648_1000022238 70
403 3300026089 Ga0207648_10000477 Ga0207648_1000047749 70
404 3300026089 Ga0207648_10003597 Ga0207648_100035973 70
405 3300026089 Ga0207648_10217515 Ga0207648_102175153 70
406 3300026095 Ga0207676_10000878 Ga0207676_1000087821 70
407 3300026095 Ga0207676_10895937 Ga0207676_108959372 70
408 3300026095 Ga0207676_11455844 Ga0207676_114558442 70
409 3300026095 Ga0207676_11898551 Ga0207676_118985511 70
410 3300026116 Ga0207674_10006997 Ga0207674_1000699712 70
411 3300026116 Ga0207674_10016334 Ga0207674_100163346 70
412 3300026116 Ga0207674_10075903 Ga0207674_100759033 70
413 3300026116 Ga0207674_11651563 Ga0207674_116515632 70
414 3300026118 Ga0207675_100017759 Ga0207675_1000177593 70
415 3300026118 Ga0207675_101720161 Ga0207675_1017201612 70
416 3300026121 Ga0207683_10002113 Ga0207683_100021133 70
417 3300026121 Ga0207683_10060194 Ga0207683_100601943 70
418 3300026121 Ga0207683_10479182 Ga0207683_104791821 70
419 3300026142 Ga0207698_10004080 Ga0207698_1000408011 70
420 3300026142 Ga0207698_10010501 Ga0207698_100105011 70
421 3300026142 Ga0207698_10200038 Ga0207698_102000382 70
422 3300026142 Ga0207698_10761921 Ga0207698_107619212 70
423 3300027252 Ga0209973_1038867 Ga0209973_10388672 70
424 3300027360 Ga0209969_1016551 Ga0209969_10165512 70
425 3300027462 Ga0210000_1013298 Ga0210000_10132982 70
426 3300027471 Ga0209995_1060033 Ga0209995_10600332 70
427 3300027512 Ga0209179_1000014 Ga0209179_100001418 70
428 3300027552 Ga0209982_1026794 Ga0209982_10267942 70
429 3300027614 Ga0209970_1010294 Ga0209970_10102942 70
430 3300027665 Ga0209983_1033212 Ga0209983_10332122 70
431 3300027682 Ga0209971_1003425 Ga0209971_10034252 70
432 3300027876 Ga0209974_10006175 Ga0209974_100061755 70
433 3300028379 Ga0268266_10002448 Ga0268266_1000244812 70
434 3300028379 Ga0268266_10035224 Ga0268266_100352244 70
435 3300028379 Ga0268266_10088810 Ga0268266_100888103 70
436 3300028379 Ga0268266_10490393 Ga0268266_104903933 70
437 3300028379 Ga0268266_10763707 Ga0268266_107637072 70
438 3300028380 Ga0268265_10093811 Ga0268265_100938112 70
439 3300028380 Ga0268265_10094838 Ga0268265_100948385 70
440 3300028380 Ga0268265_10192299 Ga0268265_101922991 70
441 3300028380 Ga0268265_10218757 Ga0268265_102187572 70
442 3300028380 Ga0268265_10872528 Ga0268265_108725282 70
443 3300028380 Ga0268265_12370466 Ga0268265_123704662 70
444 3300028381 Ga0268264_10000645 Ga0268264_1000064514 70
445 3300028381 Ga0268264_10073507 Ga0268264_100735074 70
446 3300028381 Ga0268264_10387047 Ga0268264_103870472 70
447 3300028381 Ga0268264_11221639 Ga0268264_112216392 70
448 3300030521 Ga0307511_10204396 Ga0307511_102043962 70
449 3300031548 Ga0307408_100661092 Ga0307408_1006610922 70
450 3300031691 Ga0316579_10399559 Ga0316579_103995591 70
451 3300031730 Ga0307516_10025610 Ga0307516_100256106 70
452 3300031731 Ga0307405_11438230 Ga0307405_114382301 70
453 3300031733 Ga0316577_10382028 Ga0316577_103820282 70
454 3300031824 Ga0307413_11639359 Ga0307413_116393592 70
455 3300031852 Ga0307410_11529302 Ga0307410_115293021 70
456 3300031901 Ga0307406_10126762 Ga0307406_101267622 70
457 3300031911 Ga0307412_10634786 Ga0307412_106347862 70
458 3300031995 Ga0307409_100465863 Ga0307409_1004658632 70
459 3300031995 Ga0307409_101057544 Ga0307409_1010575442 70
460 3300031995 Ga0307409_102476498 Ga0307409_1024764982 70
461 3300032002 Ga0307416_103283820 Ga0307416_1032838202 70
462 3300032004 Ga0307414_10573990 Ga0307414_105739902 70
463 3300032004 Ga0307414_11620255 Ga0307414_116202552 70
464 3300032004 Ga0307414_11660943 Ga0307414_116609431 70
465 3300032005 Ga0307411_10438491 Ga0307411_104384913 70
466 3300032126 Ga0307415_100772668 Ga0307415_1007726682 70
467 3300036712 Ga0316584_0140423 Ga0316584_0140423_842_1081 70
468 3300037418 Ga0395900_0253253 Ga0395900_0253253_1493_1729 70
469 3300037418 Ga0395900_1058379 Ga0395900_1058379_298_510 70
470 3300037471 Ga0395905_0006451 Ga0395905_0006451_232_468 70
471 3300037471 Ga0395905_0039424 Ga0395905_0039424_2307_2519 70
472 3300037471 Ga0395905_0227237 Ga0395905_0227237_658_912 70
473 3300038443 Ga0395901_0023925 Ga0395901_0023925_5674_5886 70
474 3300038443 Ga0395901_0442995 Ga0395901_0442995_454_690 70
475 3300041404 Ga0439436_0020648 Ga0439436_0020648_420_635 70
476 3300041404 Ga0439436_0032372 Ga0439436_0032372_137_358 70
477 3300041413 Ga0439465_0024130 Ga0439465_0024130_461_676 70
478 3300041459 Ga0451800_0467010 Ga0451800_0467010_60_281 70
479 3300041486 Ga0451807_1240268 Ga0451807_1240268_451_690 70
480 3300041491 Ga0451833_0733127 Ga0451833_0733127_359_598 70
481 3300041512 Ga0451853_0362294 Ga0451853_0362294_516_755 70
482 3300041512 Ga0451853_1185443 Ga0451853_1185443_77_325 70
483 3300041999 Ga0439433_0033126 Ga0439433_0033126_476_697 70
484 3300042006 Ga0439432_007949 Ga0439432_007949_3255_3476 70
485 3300042006 Ga0439432_093964 Ga0439432_093964_410_631 70
486 3300042007 Ga0439449_0022599 Ga0439449_0022599_728_943 70
487 3300042007 Ga0439449_0053628 Ga0439449_0053628_1069_1290 70
488 3300042007 Ga0439449_0298026 Ga0439449_0298026_120_377 70
489 3300042010 Ga0439452_057420 Ga0439452_057420_365_586 70
490 3300042012 Ga0439455_0122717 Ga0439455_0122717_48_272 70
491 3300042014 Ga0439457_159056 Ga0439457_159056_177_398 70
492 3300042015 Ga0439462_0006982 Ga0439462_0006982_1828_2049 70
493 3300042130 Ga0450892_017013 Ga0450892_017013_327_545 70
494 3300042156 Ga0439446_0061907 Ga0439446_0061907_432_671 70
495 3300042157 Ga0439458_0132410 Ga0439458_0132410_32_256 70
496 3300046460 Ga0495638_0445815 Ga0495638_0445815_363_581 70
497 3300046525 Ga0495663_0012698 Ga0495663_0012698_605_823 70
498 3300046525 Ga0495663_0042795 Ga0495663_0042795_360_578 70
499 3300046525 Ga0495663_0239231 Ga0495663_0239231_180_416 70
500 3300046537 Ga0495598_0016997 Ga0495598_0016997_323_541 70
501 3300046539 Ga0495621_0002303 Ga0495621_0002303_3636_3854 70
502 3300046539 Ga0495621_0017566 Ga0495621_0017566_817_1035 70
503 3300046539 Ga0495621_0107625 Ga0495621_0107625_536_754 70
504 3300046539 Ga0495621_0241441 Ga0495621_0241441_122_340 70
505 3300046558 Ga0495633_0031366 Ga0495633_0031366_442_660 70
506 3300046558 Ga0495633_0219991 Ga0495633_0219991_201_419 70
507 3300046660 Ga0495625_0601671 Ga0495625_0601671_10_228 70
508 3300046684 Ga0495669_0013113 Ga0495669_0013113_1939_2157 70
509 3300046684 Ga0495669_0086314 Ga0495669_0086314_1050_1286 70
510 3300046691 Ga0495670_0016612 Ga0495670_0016612_3077_3295 70
511 3300046691 Ga0495670_0039391 Ga0495670_0039391_2091_2309 70
512 3300047317 Ga0495604_0804532 Ga0495604_0804532_103_345 70
513 3300047445 Ga0495677_0098825 Ga0495677_0098825_711_929 70
514 3300048907 Ga0496104_1154589 Ga0496104_1154589_89_346 70
515 3300048909 Ga0496106_0241385 Ga0496106_0241385_363_620 70
516 3300048912 Ga0496109_0951085 Ga0496109_0951085_75_332 70
517 3300048913 Ga0496110_0362933 Ga0496110_0362933_582_839 70
518 3300048914 Ga0496111_0485344 Ga0496111_0485344_41_262 70
519 3300048917 Ga0496114_0033955 Ga0496114_0033955_3352_3573 70
520 3300048924 Ga0496121_0323272 Ga0496121_0323272_569_826 70
521 3300048927 Ga0496124_0502407 Ga0496124_0502407_437_652 70
522 3300048928 Ga0496125_0384236 Ga0496125_0384236_407_622 70
523 3300049649 Ga0501198_094406 Ga0501198_094406_245_466 70
524 3300049661 Ga0501217_197217 Ga0501217_197217_266_487 70
525 3300049663 Ga0501223_036730 Ga0501223_036730_211_432 70
526 3300049663 Ga0501223_084624 Ga0501223_084624_304_525 70
527 3300049680 Ga0501250_077319 Ga0501250_077319_260_481 70
528 3300049824 Ga0501045_0582660 Ga0501045_0582660_55_267 70
529 3300050511 nmdc:mga08y16_1269840_c1 nmdc:mga08y16_1269840_c1_264_482 70
530 3300050515 nmdc:mga0a205_770596_c1 nmdc:mga0a205_770596_c1_121_339 70
531 3300053078 Ga0495612_0577198 Ga0495612_0577198_212_451 70
532 3300053093 Ga0500651_0002997 Ga0500651_0002997_828_1073 70
533 3300053129 Ga0500628_063816 Ga0500628_063816_74_328 70
534 3300053139 Ga0500568_0156005 Ga0500568_0156005_481_693 70

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

6

68

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b0n-assembly1.cif.gz_A sinr protein/sini protein complex 0.9377 9 57
3pxp-assembly1.cif.gz_A crystal structure of a pas and dna binding domain containing protein (caur_2278) from chloroflexus aurantiacus j-10-fl at 2.30 a resolution 0.9271 16 55
3zkc-assembly1.cif.gz_A crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9251 9 58
3zkc-assembly1.cif.gz_B crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9239 9 58
7o81-assembly1.cif.gz_AU rabbit 80s ribosome colliding in another ribosome stalled by the sars-cov-2 pseudoknot 0.9196 9 56
ID Description Score Start End Superfamily
3qq6B00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9393 9 58 1.10.260.40
1b0nA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9377 9 57 1.10.260.40
3zkcA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9251 9 58 1.10.260.40
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9239 9 58 1.10.260.40
2b5aB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9227 7 58 1.10.260.40
ID Description Score Start End GO Terms
AF-F9MVV8-F1-model_v4 deleted 0.977 3 68
AF-I9WD21-F1-model_v4 Putative transcriptional regulator 0.9744 2 67 GO:0003677
AF-C1FTK8-F1-model_v4 Transcription regulator, Cro/CI family-related protein 0.9734 3 64 GO:0003677
AF-A0A0E1TWW2-F1-model_v4 deleted 0.9701 2 68
AF-A0A074M4N3-F1-model_v4 Cro/Cl family transcriptional regulator 0.9693 2 65 GO:0003677

Feature Viewer

pLDDT pTM Quality
90.1 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map