F460503

General Info

Members Datasets Scaffolds Average Seq Length
534 221 1068 141

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100047154|Ga0070680_1000471544
Length 152
Sequence LSFSSRRNKSMAKQVKANLKMKIRGGQASAAPPVGSTLGQYGVNMMDFINPFNEATKEMQGQEVTAHITIYDDRTMDFRVVGTPTDDLIRNKLGIQKGSGRPNSEKIAKKLSDKDLTEIAEAKAKDMNAEDVEAIKKMVAGTARSMGVEVEG

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
132 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
133 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
159 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
201 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
202 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
203 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
204 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
205 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
206 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
207 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
208 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
209 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
210 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
213 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
214 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
215 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
216 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.36
Nodule 0
Rhizoplane 1.12
Rhizosphere 89.33
Stem 0
Stem Tuber 0
Unclassified 12.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100047154 3300005336 Bacteria 3508
2 JGI24736J21556_1013380 3300001904 Bacteria 1325
3 JGI24742J22300_10000008 3300002244 Bacteria 35034
4 Ga0065712_10532958 3300005290 Bacteria 628
5 Ga0070658_10000012 3300005327 Bacteria 277871
6 Ga0070658_10000118 3300005327 Bacteria 71171
7 Ga0070658_10000133 3300005327 Bacteria 65613
8 Ga0070658_10002966 3300005327 Bacteria 14062
9 Ga0070658_10004235 3300005327 Bacteria 11730
10 Ga0070658_10019878 3300005327 Bacteria 5380
11 Ga0070658_10096036 3300005327 Bacteria 2447
12 Ga0070658_10662774 3300005327 Bacteria 905
13 Ga0070658_10669758 3300005327 Bacteria 900
14 Ga0070676_10027327 3300005328 Unclassified 3235
15 Ga0070676_10045348 3300005328 Bacteria 2561
16 Ga0070683_100385392 3300005329 Bacteria 1336
17 Ga0070683_100539502 3300005329 Bacteria 1115
18 Ga0070683_102282814 3300005329 Bacteria 519
19 Ga0070690_100003465 3300005330 Bacteria 8629
20 Ga0070670_100016224 3300005331 Bacteria 6395
21 Ga0068869_100748667 3300005334 Bacteria 836
22 Ga0070680_100000260 3300005336 Bacteria 34804
23 Ga0070680_100010821 3300005336 Bacteria 7044
24 Ga0070680_100290612 3300005336 Bacteria 1385
25 Ga0070680_100334545 3300005336 Unclassified 1286
26 Ga0070680_101671259 3300005336 Bacteria 552
27 Ga0070682_100000552 3300005337 Bacteria 23228
28 Ga0070682_100239242 3300005337 Unclassified 1302
29 Ga0070682_100352814 3300005337 Bacteria 1097
30 Ga0070660_100000333 3300005339 Bacteria 31211
31 Ga0070660_100001027 3300005339 Bacteria 18741
32 Ga0070660_100005971 3300005339 Bacteria 8417
33 Ga0070660_100315053 3300005339 Bacteria 1284
34 Ga0070691_10003109 3300005341 Bacteria 7443
35 Ga0070661_100032335 3300005344 Bacteria 3788
36 Ga0070668_100757023 3300005347 Unclassified 860
37 Ga0070675_101475291 3300005354 Bacteria 627
38 Ga0070671_100000001 3300005355 Bacteria 1228151
39 Ga0070671_100099357 3300005355 Bacteria 2441
40 Ga0070671_100907510 3300005355 Bacteria 770
41 Ga0070671_101330525 3300005355 Bacteria 634
42 Ga0070674_100033506 3300005356 Bacteria 3420
43 Ga0070674_101413290 3300005356 Bacteria 623
44 Ga0070673_100001258 3300005364 Bacteria 14720
45 Ga0070688_100239375 3300005365 Bacteria 1287
46 Ga0070659_100002754 3300005366 Bacteria 12506
47 Ga0070659_100170136 3300005366 Bacteria 1784
48 Ga0070659_101553554 3300005366 Unclassified 590
49 Ga0070667_100000001 3300005367 Bacteria 1108638
50 Ga0070667_100008028 3300005367 Bacteria 8755
51 Ga0070667_100153122 3300005367 Bacteria 2027
52 Ga0070714_100000655 3300005435 Bacteria 24551
53 Ga0070678_100000962 3300005456 Bacteria 14844
54 Ga0070678_100048777 3300005456 Bacteria 3052
55 Ga0070681_10012754 3300005458 Bacteria 8339
56 Ga0070681_10016002 3300005458 Bacteria 7479
57 Ga0070681_10278078 3300005458 Bacteria 1585
58 Ga0070681_10401738 3300005458 Bacteria 1281
59 Ga0070681_10582976 3300005458 Bacteria 1032
60 Ga0068867_100084245 3300005459 Bacteria 2401
61 Ga0070685_10000179 3300005466 Bacteria 42215
62 Ga0070685_10014551 3300005466 Unclassified 4169
63 Ga0070679_100000670 3300005530 Bacteria 29193
64 Ga0070679_100007895 3300005530 Bacteria 9984
65 Ga0070679_100015098 3300005530 Bacteria 7422
66 Ga0070679_100024364 3300005530 Bacteria 5929
67 Ga0070679_100050426 3300005530 Bacteria 4147
68 Ga0070679_100061302 3300005530 Unclassified 3749
69 Ga0070679_100788703 3300005530 Unclassified 893
70 Ga0070679_100883065 3300005530 Bacteria 837
71 Ga0070679_101081640 3300005530 Bacteria 746
72 Ga0070679_101200498 3300005530 Bacteria 704
73 Ga0070684_100601669 3300005535 Bacteria 1022
74 Ga0070684_101052379 3300005535 Unclassified 764
75 Ga0068853_100028949 3300005539 Bacteria 4663
76 Ga0068853_100178249 3300005539 Unclassified 1926
77 Ga0070686_100009484 3300005544 Bacteria 5472
78 Ga0070686_100162625 3300005544 Unclassified 1573
79 Ga0070693_100261359 3300005547 Bacteria 1151
80 Ga0070665_100088146 3300005548 Bacteria 3109
81 Ga0070665_100134298 3300005548 Bacteria 2476
82 Ga0070665_101729602 3300005548 Bacteria 632
83 Ga0068855_100000168 3300005563 Bacteria 83242
84 Ga0068855_100003212 3300005563 Bacteria 19996
85 Ga0068855_100010457 3300005563 Bacteria 11196
86 Ga0068855_100030483 3300005563 Bacteria 6451
87 Ga0068855_100041299 3300005563 Bacteria 5468
88 Ga0068855_100076544 3300005563 Bacteria 3883
89 Ga0068855_100153992 3300005563 Bacteria 2612
90 Ga0068855_100213926 3300005563 Unclassified 2165
91 Ga0068855_100360593 3300005563 Bacteria 1599
92 Ga0068855_100653438 3300005563 Bacteria 1129
93 Ga0068855_102352966 3300005563 Unclassified 532
94 Ga0068857_100000007 3300005577 Bacteria 152197
95 Ga0068857_100006944 3300005577 Bacteria 9741
96 Ga0068857_100046349 3300005577 Bacteria 3858
97 Ga0068857_100102239 3300005577 Bacteria 2572
98 Ga0068857_100164691 3300005577 Bacteria 2013
99 Ga0068857_100615431 3300005577 Bacteria 1027
100 Ga0068856_100000001 3300005614 Bacteria 565602
101 Ga0068856_100004478 3300005614 Bacteria 13899
102 Ga0068856_100015323 3300005614 Bacteria 7409
103 Ga0068856_100497226 3300005614 Unclassified 1240
104 Ga0068852_100250015 3300005616 Bacteria 1698
105 Ga0068864_101741751 3300005618 Bacteria 628
106 Ga0068861_100140091 3300005719 Bacteria 1973
107 Ga0068863_100015791 3300005841 Bacteria 7247
108 Ga0068863_100590701 3300005841 Bacteria 1098
109 Ga0068863_100880801 3300005841 Bacteria 895
110 Ga0068863_102652601 3300005841 Bacteria 510
111 Ga0068860_100160407 3300005843 Unclassified 2168
112 Ga0068860_101680038 3300005843 Unclassified 657
113 Ga0081455_10000003 3300005937 Bacteria 367763
114 Ga0075365_10001969 3300006038 Bacteria 9700
115 Ga0075365_10148163 3300006038 Bacteria 1632
116 Ga0075365_10437129 3300006038 Bacteria 924
117 Ga0075368_10005596 3300006042 Bacteria 4333
118 Ga0075363_100000559 3300006048 Bacteria 12150
119 Ga0075364_10037683 3300006051 Bacteria 3132
120 Ga0075364_10276742 3300006051 Bacteria 1142
121 Ga0075367_10013981 3300006178 Bacteria 4333
122 Ga0075367_10835692 3300006178 Bacteria 587
123 Ga0075369_10000003 3300006186 Bacteria 205269
124 Ga0075369_10312722 3300006186 Bacteria 734
125 Ga0075366_10000005 3300006195 Bacteria 107438
126 Ga0097621_100163420 3300006237 Bacteria 1915
127 Ga0075370_10007562 3300006353 Bacteria 5541
128 Ga0068871_101561252 3300006358 Bacteria 624
129 Ga0075428_100001047 3300006844 Bacteria 29378
130 Ga0075430_100016200 3300006846 Bacteria 6349
131 Ga0068865_100048913 3300006881 Bacteria 2912
132 Ga0097620_100181443 3300006931 Unclassified 2188
133 Ga0105250_10131050 3300009092 Bacteria 1035
134 Ga0105240_10000003 3300009093 Bacteria 1183681
135 Ga0105240_10154212 3300009093 Bacteria 2733
136 Ga0105240_10221294 3300009093 Bacteria 2205
137 Ga0105240_10398207 3300009093 Bacteria 1551
138 Ga0105240_10761085 3300009093 Bacteria 1052
139 Ga0105240_11684608 3300009093 Unclassified 662
140 Ga0111539_10006378 3300009094 Bacteria 15214
141 Ga0105245_10000001 3300009098 Bacteria 939270
142 Ga0105245_10000050 3300009098 Bacteria 128014
143 Ga0105245_10002473 3300009098 Bacteria 16702
144 Ga0105245_10004714 3300009098 Bacteria 12052
145 Ga0105245_10174653 3300009098 Bacteria 2048
146 Ga0105245_10438781 3300009098 Bacteria 1312
147 Ga0105245_11917236 3300009098 Unclassified 646
148 Ga0105243_10000001 3300009148 Bacteria 1156578
149 Ga0105241_10000003 3300009174 Bacteria 839043
150 Ga0105241_10147094 3300009174 Bacteria 1924
151 Ga0105242_10000011 3300009176 Bacteria 149791
152 Ga0105242_10006407 3300009176 Bacteria 9064
153 Ga0105242_10157211 3300009176 Bacteria 1987
154 Ga0105248_10154446 3300009177 Unclassified 2590
155 Ga0105248_10258185 3300009177 Bacteria 1962
156 Ga0105237_10076151 3300009545 Bacteria 3345
157 Ga0105237_10095290 3300009545 Bacteria 2965
158 Ga0105237_10224620 3300009545 Unclassified 1878
159 Ga0105237_11501102 3300009545 Unclassified 681
160 Ga0105238_10001974 3300009551 Bacteria 20667
161 Ga0105238_10050491 3300009551 Bacteria 4187
162 Ga0105238_10861674 3300009551 Bacteria 923
163 Ga0105249_10943570 3300009553 Bacteria 931
164 Ga0105249_12306434 3300009553 Bacteria 611
165 Ga0105028_100118 3300009993 Bacteria 8244
166 Ga0105239_10029375 3300010375 Bacteria 6044
167 Ga0105239_10061240 3300010375 Bacteria 4130
168 Ga0105239_10311588 3300010375 Bacteria 1774
169 Ga0105239_10486668 3300010375 Bacteria 1402
170 Ga0105239_12293229 3300010375 Bacteria 628
171 Ga0157373_10180133 3300013100 Bacteria 1488
172 Ga0157370_10204037 3300013104 Bacteria 1834
173 Ga0157370_10610158 3300013104 Bacteria 999
174 Ga0157369_10012644 3300013105 Bacteria 9572
175 Ga0157369_10201054 3300013105 Unclassified 2091
176 Ga0157369_10381310 3300013105 Bacteria 1463
177 Ga0157374_10000115 3300013296 Bacteria 73739
178 Ga0157374_10048418 3300013296 Bacteria 3944
179 Ga0157374_10161220 3300013296 Bacteria 2184
180 Ga0157374_10361121 3300013296 Unclassified 1444
181 Ga0157374_10509133 3300013296 Bacteria 1209
182 Ga0157378_10098808 3300013297 Bacteria 2662
183 Ga0157378_10753547 3300013297 Bacteria 997
184 Ga0163162_10103871 3300013306 Bacteria 2936
185 Ga0157372_10002139 3300013307 Bacteria 21472
186 Ga0157372_10489963 3300013307 Bacteria 1433
187 Ga0157372_10597685 3300013307 Bacteria 1286
188 Ga0157372_10599942 3300013307 Unclassified 1283
189 Ga0157375_12860054 3300013308 Bacteria 577
190 Ga0163163_10235977 3300014325 Bacteria 1878
191 Ga0163163_10920265 3300014325 Bacteria 938
192 Ga0157380_10313405 3300014326 Bacteria 1451
193 Ga0157379_10029808 3300014968 Unclassified 4852
194 Ga0157376_10000007 3300014969 Bacteria 368004
195 Ga0206356_11428383 3300020070 Bacteria 1452
196 Ga0206355_1300670 3300020076 Bacteria 723
197 Ga0207697_10100860 3300025315 Bacteria 1230
198 Ga0207647_10001958 3300025904 Bacteria 15730
199 Ga0207647_10078916 3300025904 Bacteria 1977
200 Ga0207645_10014493 3300025907 Bacteria 5273
201 Ga0207645_10382661 3300025907 Unclassified 945
202 Ga0207705_10000011 3300025909 Bacteria 517768
203 Ga0207705_10000038 3300025909 Bacteria 193812
204 Ga0207705_10000167 3300025909 Bacteria 71284
205 Ga0207705_10007802 3300025909 Bacteria 7857
206 Ga0207705_10009031 3300025909 Bacteria 7263
207 Ga0207705_10042645 3300025909 Bacteria 3258
208 Ga0207705_10044586 3300025909 Bacteria 3187
209 Ga0207705_10100931 3300025909 Bacteria 2122
210 Ga0207705_10808128 3300025909 Bacteria 728
211 Ga0207654_10000002 3300025911 Bacteria 1460142
212 Ga0207654_10077006 3300025911 Bacteria 1998
213 Ga0207707_10012376 3300025912 Bacteria 7415
214 Ga0207707_10044093 3300025912 Bacteria 3889
215 Ga0207707_10343772 3300025912 Bacteria 1286
216 Ga0207707_10552189 3300025912 Bacteria 978
217 Ga0207707_10747595 3300025912 Bacteria 818
218 Ga0207695_10000005 3300025913 Bacteria 1196715
219 Ga0207695_10086726 3300025913 Bacteria 3156
220 Ga0207695_10498369 3300025913 Bacteria 1100
221 Ga0207671_10072385 3300025914 Bacteria 2572
222 Ga0207671_10201190 3300025914 Bacteria 1556
223 Ga0207660_10007429 3300025917 Bacteria 7090
224 Ga0207660_10016532 3300025917 Bacteria 4884
225 Ga0207660_10091261 3300025917 Bacteria 2259
226 Ga0207660_10105786 3300025917 Bacteria 2109
227 Ga0207660_10410009 3300025917 Unclassified 1092
228 Ga0207660_11276138 3300025917 Bacteria 597
229 Ga0207657_10001264 3300025919 Bacteria 26993
230 Ga0207657_10001852 3300025919 Bacteria 22847
231 Ga0207657_10012344 3300025919 Bacteria 8437
232 Ga0207657_10191614 3300025919 Bacteria 1649
233 Ga0207649_10343922 3300025920 Bacteria 1102
234 Ga0207652_10005490 3300025921 Bacteria 10286
235 Ga0207652_10007222 3300025921 Bacteria 8958
236 Ga0207652_10042986 3300025921 Bacteria 3847
237 Ga0207652_10043364 3300025921 Bacteria 3830
238 Ga0207652_10045321 3300025921 Unclassified 3749
239 Ga0207652_10052064 3300025921 Unclassified 3512
240 Ga0207652_10056634 3300025921 Bacteria 3375
241 Ga0207652_10058343 3300025921 Bacteria 3326
242 Ga0207652_10122913 3300025921 Bacteria 2310
243 Ga0207652_10204828 3300025921 Bacteria 1776
244 Ga0207652_10209652 3300025921 Bacteria 1754
245 Ga0207652_10210206 3300025921 Bacteria 1752
246 Ga0207652_10914263 3300025921 Bacteria 775
247 Ga0207652_11137295 3300025921 Bacteria 682
248 Ga0207694_10033970 3300025924 Unclassified 3909
249 Ga0207694_10365237 3300025924 Bacteria 1196
250 Ga0207694_10984525 3300025924 Unclassified 713
251 Ga0207650_10084149 3300025925 Bacteria 2418
252 Ga0207687_10000030 3300025927 Bacteria 155548
253 Ga0207687_10000117 3300025927 Bacteria 56652
254 Ga0207687_10017391 3300025927 Bacteria 4734
255 Ga0207687_10219994 3300025927 Bacteria 1494
256 Ga0207687_10485182 3300025927 Unclassified 1030
257 Ga0207687_11486723 3300025927 Bacteria 582
258 Ga0207664_10000295 3300025929 Bacteria 37239
259 Ga0207644_10000001 3300025931 Bacteria 1243214
260 Ga0207644_10710995 3300025931 Bacteria 838
261 Ga0207644_10966798 3300025931 Bacteria 714
262 Ga0207690_10006184 3300025932 Bacteria 7090
263 Ga0207690_10263246 3300025932 Bacteria 1337
264 Ga0207686_10000001 3300025934 Bacteria 1169580
265 Ga0207686_10004323 3300025934 Bacteria 7613
266 Ga0207686_10558410 3300025934 Bacteria 896
267 Ga0207709_10000002 3300025935 Bacteria 1171536
268 Ga0207669_10030089 3300025937 Bacteria 3012
269 Ga0207669_10224013 3300025937 Bacteria 1382
270 Ga0207704_10217851 3300025938 Bacteria 1410
271 Ga0207704_10261118 3300025938 Bacteria 1306
272 Ga0207711_10199827 3300025941 Unclassified 1824
273 Ga0207711_10259450 3300025941 Bacteria 1597
274 Ga0207711_10565191 3300025941 Unclassified 1061
275 Ga0207689_10659637 3300025942 Bacteria 882
276 Ga0207661_10583706 3300025944 Bacteria 1025
277 Ga0207661_11934876 3300025944 Bacteria 535
278 Ga0207667_10000339 3300025949 Bacteria 64087
279 Ga0207667_10001896 3300025949 Bacteria 26256
280 Ga0207667_10006376 3300025949 Bacteria 14308
281 Ga0207667_10048777 3300025949 Bacteria 4476
282 Ga0207667_10059507 3300025949 Bacteria 4001
283 Ga0207667_10060856 3300025949 Bacteria 3952
284 Ga0207667_10087542 3300025949 Unclassified 3222
285 Ga0207667_10263588 3300025949 Bacteria 1762
286 Ga0207667_11032672 3300025949 Bacteria 808
287 Ga0207667_11075479 3300025949 Bacteria 789
288 Ga0207651_10019642 3300025960 Bacteria 4055
289 Ga0207712_11290267 3300025961 Bacteria 652
290 Ga0207668_10608865 3300025972 Unclassified 952
291 Ga0207658_10000003 3300025986 Bacteria 1151934
292 Ga0207658_10031028 3300025986 Bacteria 3791
293 Ga0207658_10161602 3300025986 Bacteria 1836
294 Ga0207703_10640007 3300026035 Bacteria 1008
295 Ga0207639_10051853 3300026041 Bacteria 3123
296 Ga0207639_11333120 3300026041 Bacteria 673
297 Ga0207702_10000001 3300026078 Bacteria 895738
298 Ga0207702_10011223 3300026078 Bacteria 7471
299 Ga0207702_10013958 3300026078 Bacteria 6673
300 Ga0207702_10435389 3300026078 Unclassified 1270
301 Ga0207641_10052199 3300026088 Bacteria 3462
302 Ga0207641_10075238 3300026088 Bacteria 2916
303 Ga0207648_10057394 3300026089 Bacteria 3397
304 Ga0207676_11353979 3300026095 Bacteria 707
305 Ga0207674_10000001 3300026116 Bacteria 616581
306 Ga0207674_10014249 3300026116 Bacteria 8786
307 Ga0207674_10059309 3300026116 Bacteria 3873
308 Ga0207674_10141133 3300026116 Bacteria 2368
309 Ga0207674_10283905 3300026116 Bacteria 1604
310 Ga0207674_10574923 3300026116 Unclassified 1088
311 Ga0207674_10644717 3300026116 Bacteria 1023
312 Ga0207674_10982211 3300026116 Bacteria 813
313 Ga0207683_10029174 3300026121 Bacteria 4775
314 Ga0207683_10386958 3300026121 Unclassified 1286
315 Ga0207698_10007011 3300026142 Bacteria 7059
316 Ga0209813_10000154 3300027866 Bacteria 23239
317 Ga0268266_10002329 3300028379 Bacteria 20572
318 Ga0268266_10088619 3300028379 Bacteria 2708
319 Ga0268266_10569046 3300028379 Unclassified 1087
320 Ga0268266_11376636 3300028379 Bacteria 681
321 Ga0268264_10058168 3300028381 Bacteria 3236
322 Ga0268264_10152409 3300028381 Unclassified 2074
323 Ga0268264_11727487 3300028381 Bacteria 636
324 Ga0265337_1000227 3300028556 Bacteria 30136
325 Ga0265337_1000244 3300028556 Bacteria 29586
326 Ga0265337_1002862 3300028556 Bacteria 7703
327 Ga0265337_1029554 3300028556 Bacteria 1638
328 Ga0265337_1057712 3300028556 Bacteria 1080
329 Ga0265326_10000755 3300028558 Bacteria 11977
330 Ga0265326_10003333 3300028558 Bacteria 5294
331 Ga0265326_10005376 3300028558 Unclassified 4036
332 Ga0265326_10011258 3300028558 Bacteria 2640
333 Ga0265326_10015700 3300028558 Bacteria 2193
334 Ga0265319_1016715 3300028563 Bacteria 2808
335 Ga0265319_1075636 3300028563 Unclassified 1074
336 Ga0265319_1078501 3300028563 Bacteria 1050
337 Ga0265319_1143501 3300028563 Unclassified 740
338 Ga0265319_1214409 3300028563 Bacteria 589
339 Ga0265334_10000057 3300028573 Bacteria 80027
340 Ga0265334_10000144 3300028573 Bacteria 44418
341 Ga0265334_10001811 3300028573 Bacteria 10186
342 Ga0265334_10006824 3300028573 Bacteria 4902
343 Ga0265334_10019884 3300028573 Bacteria 2756
344 Ga0265334_10035249 3300028573 Bacteria 1982
345 Ga0265334_10072370 3300028573 Bacteria 1282
346 Ga0265318_10004668 3300028577 Bacteria 6582
347 Ga0265318_10088691 3300028577 Bacteria 1139
348 Ga0265318_10096818 3300028577 Unclassified 1086
349 Ga0265323_10002827 3300028653 Bacteria 7810
350 Ga0265322_10000864 3300028654 Bacteria 10770
351 Ga0265322_10004713 3300028654 Bacteria 4050
352 Ga0265322_10007979 3300028654 Viruses 3088
353 Ga0265336_10001710 3300028666 Bacteria 9655
354 Ga0265336_10003300 3300028666 Bacteria 6359
355 Ga0265336_10007276 3300028666 Bacteria 3942
356 Ga0265336_10007661 3300028666 Bacteria 3831
357 Ga0265338_10000003 3300028800 Bacteria 733923
358 Ga0265338_10000054 3300028800 Bacteria 207383
359 Ga0265338_10000130 3300028800 Bacteria 137739
360 Ga0265338_10000366 3300028800 Bacteria 81024
361 Ga0265338_10000419 3300028800 Bacteria 76060
362 Ga0265338_10000771 3300028800 Bacteria 54581
363 Ga0265338_10000841 3300028800 Bacteria 51708
364 Ga0265338_10001885 3300028800 Bacteria 32838
365 Ga0265338_10002761 3300028800 Bacteria 25703
366 Ga0265338_10008051 3300028800 Bacteria 12892
367 Ga0265338_10008859 3300028800 Bacteria 12132
368 Ga0265338_10036590 3300028800 Bacteria 4694
369 Ga0265338_10049830 3300028800 Unclassified 3791
370 Ga0265338_10087056 3300028800 Bacteria 2597
371 Ga0265338_10157351 3300028800 Bacteria 1759
372 Ga0265338_10424482 3300028800 Bacteria 945
373 Ga0265338_10444798 3300028800 Bacteria 918
374 Ga0265338_10453931 3300028800 Bacteria 907
375 Ga0265324_10007997 3300029957 Bacteria 4237
376 Ga0265324_10010258 3300029957 Bacteria 3620
377 Ga0265324_10034109 3300029957 Bacteria 1773
378 Ga0316179_1001639 3300030734 Unclassified 958
379 Ga0265330_10004460 3300031235 Bacteria 7100
380 Ga0265330_10113046 3300031235 Unclassified 1159
381 Ga0265332_10007896 3300031238 Bacteria 4797
382 Ga0265332_10026194 3300031238 Bacteria 2557
383 Ga0265332_10247034 3300031238 Unclassified 738
384 Ga0265328_10001186 3300031239 Bacteria 12058
385 Ga0265320_10005897 3300031240 Bacteria 7798
386 Ga0265320_10018766 3300031240 Bacteria 3799
387 Ga0265320_10188324 3300031240 Bacteria 923
388 Ga0265325_10003439 3300031241 Bacteria 10329
389 Ga0265325_10085818 3300031241 Bacteria 1559
390 Ga0265329_10003025 3300031242 Bacteria 7465
391 Ga0265340_10002179 3300031247 Bacteria 11205
392 Ga0265340_10014553 3300031247 Bacteria 4105
393 Ga0265339_10007998 3300031249 Bacteria 6779
394 Ga0265339_10171612 3300031249 Bacteria 1085
395 Ga0265339_10208363 3300031249 Unclassified 961
396 Ga0265339_10245439 3300031249 Bacteria 868
397 Ga0265331_10007364 3300031250 Bacteria 6374
398 Ga0265327_10000017 3300031251 Bacteria 445264
399 Ga0265327_10002752 3300031251 Bacteria 17876
400 Ga0265327_10003189 3300031251 Bacteria 16013
401 Ga0265327_10021544 3300031251 Unclassified 3886
402 Ga0265327_10029322 3300031251 Bacteria 3131
403 Ga0265327_10033845 3300031251 Bacteria 2842
404 Ga0265327_10349580 3300031251 Bacteria 646
405 Ga0265316_10013001 3300031344 Bacteria 7427
406 Ga0265316_10029923 3300031344 Bacteria 4471
407 Ga0265316_10046243 3300031344 Bacteria 3450
408 Ga0265316_10385003 3300031344 Bacteria 1011
409 Ga0265316_10402868 3300031344 Bacteria 985
410 Ga0265316_10635197 3300031344 Bacteria 755
411 Ga0265313_10005371 3300031595 Bacteria 9458
412 Ga0265313_10009485 3300031595 Bacteria 6314
413 Ga0265313_10011005 3300031595 Bacteria 5656
414 Ga0265314_10006571 3300031711 Bacteria 10250
415 Ga0265314_10264297 3300031711 Bacteria 981
416 Ga0265314_10609177 3300031711 Unclassified 561
417 Ga0265342_10006215 3300031712 Bacteria 8927
418 Ga0373934_0466448 3300035086 Bacteria 530
419 Ga0373944_0140597 3300035089 Bacteria 845
420 Ga0395899_0009307 3300037312 Bacteria 7544
421 Ga0395899_0200771 3300037312 Unclassified 1391
422 Ga0395899_0418799 3300037312 Bacteria 883
423 Ga0395900_0001880 3300037418 Bacteria 23875
424 Ga0395900_0002167 3300037418 Bacteria 21936
425 Ga0395900_0023300 3300037418 Bacteria 6337
426 Ga0395900_0043498 3300037418 Unclassified 4629
427 Ga0395900_0080917 3300037418 Bacteria 3338
428 Ga0395900_0200518 3300037418 Bacteria 2019
429 Ga0395900_0500788 3300037418 Bacteria 1165
430 Ga0395900_1336473 3300037418 Bacteria 630
431 Ga0395898_0001404 3300037466 Bacteria 34348
432 Ga0395898_0004142 3300037466 Bacteria 15900
433 Ga0395898_0043454 3300037466 Unclassified 4428
434 Ga0395898_0333281 3300037466 Bacteria 1447
435 Ga0395905_0002235 3300037471 Bacteria 21825
436 Ga0395905_0087579 3300037471 Bacteria 2919
437 Ga0395905_0546811 3300037471 Bacteria 1059
438 Ga0395905_1360630 3300037471 Bacteria 614
439 Ga0395901_0001834 3300038443 Bacteria 21960
440 Ga0395901_0009097 3300038443 Bacteria 10057
441 Ga0395901_0019837 3300038443 Bacteria 6877
442 Ga0395901_0035007 3300038443 Bacteria 5189
443 Ga0395901_0200221 3300038443 Bacteria 2093
444 Ga0395901_1029960 3300038443 Unclassified 797
445 Ga0451800_1051778 3300041459 Bacteria 1155
446 Ga0451807_0582546 3300041486 Bacteria 720
447 Ga0451807_1043250 3300041486 Unclassified 913
448 Ga0466963_0193095 3300044694 Bacteria 1423
449 Ga0466967_0255661 3300045976 Unclassified 1675
450 Ga0466967_0994819 3300045976 Bacteria 835
451 Ga0495583_0016469 3300046506 Bacteria 3971
452 Ga0495583_0447445 3300046506 Bacteria 506
453 Ga0495658_0038913 3300046683 Bacteria 2636
454 Ga0495670_0744853 3300046691 Unclassified 534
455 Ga0495649_0000379 3300046694 Bacteria 38623
456 Ga0495672_0000016 3300047320 Bacteria 500601
457 Ga0496100_0487582 3300048903 Bacteria 948
458 Ga0496112_0304724 3300048915 Bacteria 1538
459 Ga0496113_0435169 3300048916 Bacteria 1054
460 Ga0496126_0057535 3300048929 Bacteria 3509
461 Ga0501031_0002235 3300049568 Bacteria 12244
462 Ga0501032_0000394 3300049569 Bacteria 36017
463 Ga0501034_0032705 3300049571 Bacteria 5283
464 Ga0501034_0076194 3300049571 Bacteria 3361
465 Ga0501034_0134594 3300049571 Bacteria 2453
466 Ga0501036_0025601 3300049572 Bacteria 4979
467 Ga0501036_0332363 3300049572 Bacteria 1269
468 Ga0501037_0000133 3300049573 Bacteria 69741
469 Ga0501038_0023026 3300049574 Bacteria 5576
470 Ga0501038_0807084 3300049574 Unclassified 697
471 Ga0501042_0014645 3300049578 Bacteria 5356
472 Ga0501043_0004814 3300049579 Bacteria 10927
473 Ga0501046_0000038 3300049580 Bacteria 159193
474 Ga0501046_0101318 3300049580 Bacteria 2209
475 Ga0501047_0000355 3300049581 Bacteria 51922
476 Ga0501047_0009034 3300049581 Bacteria 9411
477 Ga0501048_0000379 3300049582 Bacteria 30846
478 Ga0501068_1046487 3300049584 Unclassified 539
479 Ga0501069_0262536 3300049585 Unclassified 1008
480 Ga0501070_0046000 3300049586 Bacteria 3629
481 Ga0501070_0209825 3300049586 Bacteria 1599
482 Ga0501073_0072903 3300049589 Bacteria 2391
483 Ga0501073_0484983 3300049589 Bacteria 855
484 Ga0501073_0530035 3300049589 Unclassified 814
485 Ga0501074_0220874 3300049590 Bacteria 1349
486 Ga0501080_0001480 3300049742 Bacteria 19793
487 Ga0501083_0269133 3300049744 Bacteria 1108
488 Ga0501083_0549713 3300049744 Bacteria 751
489 Ga0501035_0001229 3300049822 Bacteria 26660
490 Ga0501035_0002682 3300049822 Bacteria 17322
491 Ga0501044_0110414 3300049823 Bacteria 2759
492 nmdc:mga03683_126162_c1 3300050489 Bacteria 1142
493 nmdc:mga03n38_357_c1 3300050490 Bacteria 11162
494 nmdc:mga0yw44_173902_c1 3300050492 Bacteria 946
495 nmdc:mga0yw44_615_c1 3300050492 Bacteria 12909
496 nmdc:mga0k408_206643_c1 3300050493 Bacteria 673
497 nmdc:mga0k408_36_c1 3300050493 Bacteria 72881
498 nmdc:mga06z11_1_c2 3300050494 Bacteria 4916
499 nmdc:mga04h51_6_c2 3300050495 Bacteria 9547
500 nmdc:mga07m45_60737_c1 3300050496 Unclassified 2140
501 nmdc:mga0qj67_5316_c1 3300050509 Bacteria 9397
502 nmdc:mga0qj67_547461_c1 3300050509 Bacteria 928
503 nmdc:mga0sz30_1656_c1 3300050516 Bacteria 719
504 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
505 nmdc:mga0sz30_205895_c1 3300050516 Bacteria 874
506 Ga0500643_000010 3300053087 Bacteria 408084
507 Ga0500643_000980 3300053087 Bacteria 17591
508 Ga0500644_0001354 3300053088 Bacteria 6562
509 Ga0500646_0000654 3300053090 Bacteria 9905
510 Ga0500583_0001506 3300053092 Bacteria 6705
511 Ga0500583_0046948 3300053092 Bacteria 1988
512 Ga0500651_0000050 3300053093 Bacteria 78674
513 Ga0500651_0016217 3300053093 Bacteria 4580
514 Ga0500651_0179061 3300053093 Bacteria 1260
515 Ga0500650_0000001 3300053098 Bacteria 818797
516 Ga0500555_015286 3300053103 Bacteria 2214
517 Ga0500555_118002 3300053103 Unclassified 664
518 Ga0500562_002352 3300053108 Bacteria 4748
519 Ga0500593_000001 3300053117 Bacteria 784404
520 Ga0500594_0000001 3300053118 Bacteria 1178472
521 Ga0500614_000543 3300053123 Bacteria 9709
522 Ga0500568_0027264 3300053139 Unclassified 2391
523 Ga0500577_0000452 3300053142 Bacteria 10585
524 Ga0500577_0001529 3300053142 Bacteria 5891
525 Ga0500577_0074123 3300053142 Unclassified 1342
526 Ga0500579_019001 3300053143 Bacteria 4452
527 Ga0500604_0029052 3300053151 Bacteria 1609
528 Ga0500570_000007 3300053724 Bacteria 117035
529 Ga0500611_000200 3300053727 Bacteria 7486
530 Ga0501084_0211102 3300054114 Bacteria 1638
531 Ga0587094_006367 3300059513 Bacteria 1413
532 Ga0587067_193745 3300059640 Bacteria 536
533 Ga0587072_154462 3300059643 Bacteria 556
534 Ga0501082_0038970 3300060353 Bacteria 4099
535 Ga0070680_100047154
536 JGI24736J21556_1013380
537 JGI24742J22300_10000008
538 Ga0065712_10532958
539 Ga0070658_10000012
540 Ga0070658_10000118
541 Ga0070658_10000133
542 Ga0070658_10002966
543 Ga0070658_10004235
544 Ga0070658_10019878
545 Ga0070658_10096036
546 Ga0070658_10662774
547 Ga0070658_10669758
548 Ga0070676_10027327
549 Ga0070676_10045348
550 Ga0070683_100385392
551 Ga0070683_100539502
552 Ga0070683_102282814
553 Ga0070690_100003465
554 Ga0070670_100016224
555 Ga0068869_100748667
556 Ga0070680_100000260
557 Ga0070680_100010821
558 Ga0070680_100290612
559 Ga0070680_100334545
560 Ga0070680_101671259
561 Ga0070682_100000552
562 Ga0070682_100239242
563 Ga0070682_100352814
564 Ga0070660_100000333
565 Ga0070660_100001027
566 Ga0070660_100005971
567 Ga0070660_100315053
568 Ga0070691_10003109
569 Ga0070661_100032335
570 Ga0070668_100757023
571 Ga0070675_101475291
572 Ga0070671_100000001
573 Ga0070671_100099357
574 Ga0070671_100907510
575 Ga0070671_101330525
576 Ga0070674_100033506
577 Ga0070674_101413290
578 Ga0070673_100001258
579 Ga0070688_100239375
580 Ga0070659_100002754
581 Ga0070659_100170136
582 Ga0070659_101553554
583 Ga0070667_100000001
584 Ga0070667_100008028
585 Ga0070667_100153122
586 Ga0070714_100000655
587 Ga0070678_100000962
588 Ga0070678_100048777
589 Ga0070681_10012754
590 Ga0070681_10016002
591 Ga0070681_10278078
592 Ga0070681_10401738
593 Ga0070681_10582976
594 Ga0068867_100084245
595 Ga0070685_10000179
596 Ga0070685_10014551
597 Ga0070679_100000670
598 Ga0070679_100007895
599 Ga0070679_100015098
600 Ga0070679_100024364
601 Ga0070679_100050426
602 Ga0070679_100061302
603 Ga0070679_100788703
604 Ga0070679_100883065
605 Ga0070679_101081640
606 Ga0070679_101200498
607 Ga0070684_100601669
608 Ga0070684_101052379
609 Ga0068853_100028949
610 Ga0068853_100178249
611 Ga0070686_100009484
612 Ga0070686_100162625
613 Ga0070693_100261359
614 Ga0070665_100088146
615 Ga0070665_100134298
616 Ga0070665_101729602
617 Ga0068855_100000168
618 Ga0068855_100003212
619 Ga0068855_100010457
620 Ga0068855_100030483
621 Ga0068855_100041299
622 Ga0068855_100076544
623 Ga0068855_100153992
624 Ga0068855_100213926
625 Ga0068855_100360593
626 Ga0068855_100653438
627 Ga0068855_102352966
628 Ga0068857_100000007
629 Ga0068857_100006944
630 Ga0068857_100046349
631 Ga0068857_100102239
632 Ga0068857_100164691
633 Ga0068857_100615431
634 Ga0068856_100000001
635 Ga0068856_100004478
636 Ga0068856_100015323
637 Ga0068856_100497226
638 Ga0068852_100250015
639 Ga0068864_101741751
640 Ga0068861_100140091
641 Ga0068863_100015791
642 Ga0068863_100590701
643 Ga0068863_100880801
644 Ga0068863_102652601
645 Ga0068860_100160407
646 Ga0068860_101680038
647 Ga0081455_10000003
648 Ga0075365_10001969
649 Ga0075365_10148163
650 Ga0075365_10437129
651 Ga0075368_10005596
652 Ga0075363_100000559
653 Ga0075364_10037683
654 Ga0075364_10276742
655 Ga0075367_10013981
656 Ga0075367_10835692
657 Ga0075369_10000003
658 Ga0075369_10312722
659 Ga0075366_10000005
660 Ga0097621_100163420
661 Ga0075370_10007562
662 Ga0068871_101561252
663 Ga0075428_100001047
664 Ga0075430_100016200
665 Ga0068865_100048913
666 Ga0097620_100181443
667 Ga0105250_10131050
668 Ga0105240_10000003
669 Ga0105240_10154212
670 Ga0105240_10221294
671 Ga0105240_10398207
672 Ga0105240_10761085
673 Ga0105240_11684608
674 Ga0111539_10006378
675 Ga0105245_10000001
676 Ga0105245_10000050
677 Ga0105245_10002473
678 Ga0105245_10004714
679 Ga0105245_10174653
680 Ga0105245_10438781
681 Ga0105245_11917236
682 Ga0105243_10000001
683 Ga0105241_10000003
684 Ga0105241_10147094
685 Ga0105242_10000011
686 Ga0105242_10006407
687 Ga0105242_10157211
688 Ga0105248_10154446
689 Ga0105248_10258185
690 Ga0105237_10076151
691 Ga0105237_10095290
692 Ga0105237_10224620
693 Ga0105237_11501102
694 Ga0105238_10001974
695 Ga0105238_10050491
696 Ga0105238_10861674
697 Ga0105249_10943570
698 Ga0105249_12306434
699 Ga0105028_100118
700 Ga0105239_10029375
701 Ga0105239_10061240
702 Ga0105239_10311588
703 Ga0105239_10486668
704 Ga0105239_12293229
705 Ga0157373_10180133
706 Ga0157370_10204037
707 Ga0157370_10610158
708 Ga0157369_10012644
709 Ga0157369_10201054
710 Ga0157369_10381310
711 Ga0157374_10000115
712 Ga0157374_10048418
713 Ga0157374_10161220
714 Ga0157374_10361121
715 Ga0157374_10509133
716 Ga0157378_10098808
717 Ga0157378_10753547
718 Ga0163162_10103871
719 Ga0157372_10002139
720 Ga0157372_10489963
721 Ga0157372_10597685
722 Ga0157372_10599942
723 Ga0157375_12860054
724 Ga0163163_10235977
725 Ga0163163_10920265
726 Ga0157380_10313405
727 Ga0157379_10029808
728 Ga0157376_10000007
729 Ga0206356_11428383
730 Ga0206355_1300670
731 Ga0207697_10100860
732 Ga0207647_10001958
733 Ga0207647_10078916
734 Ga0207645_10014493
735 Ga0207645_10382661
736 Ga0207705_10000011
737 Ga0207705_10000038
738 Ga0207705_10000167
739 Ga0207705_10007802
740 Ga0207705_10009031
741 Ga0207705_10042645
742 Ga0207705_10044586
743 Ga0207705_10100931
744 Ga0207705_10808128
745 Ga0207654_10000002
746 Ga0207654_10077006
747 Ga0207707_10012376
748 Ga0207707_10044093
749 Ga0207707_10343772
750 Ga0207707_10552189
751 Ga0207707_10747595
752 Ga0207695_10000005
753 Ga0207695_10086726
754 Ga0207695_10498369
755 Ga0207671_10072385
756 Ga0207671_10201190
757 Ga0207660_10007429
758 Ga0207660_10016532
759 Ga0207660_10091261
760 Ga0207660_10105786
761 Ga0207660_10410009
762 Ga0207660_11276138
763 Ga0207657_10001264
764 Ga0207657_10001852
765 Ga0207657_10012344
766 Ga0207657_10191614
767 Ga0207649_10343922
768 Ga0207652_10005490
769 Ga0207652_10007222
770 Ga0207652_10042986
771 Ga0207652_10043364
772 Ga0207652_10045321
773 Ga0207652_10052064
774 Ga0207652_10056634
775 Ga0207652_10058343
776 Ga0207652_10122913
777 Ga0207652_10204828
778 Ga0207652_10209652
779 Ga0207652_10210206
780 Ga0207652_10914263
781 Ga0207652_11137295
782 Ga0207694_10033970
783 Ga0207694_10365237
784 Ga0207694_10984525
785 Ga0207650_10084149
786 Ga0207687_10000030
787 Ga0207687_10000117
788 Ga0207687_10017391
789 Ga0207687_10219994
790 Ga0207687_10485182
791 Ga0207687_11486723
792 Ga0207664_10000295
793 Ga0207644_10000001
794 Ga0207644_10710995
795 Ga0207644_10966798
796 Ga0207690_10006184
797 Ga0207690_10263246
798 Ga0207686_10000001
799 Ga0207686_10004323
800 Ga0207686_10558410
801 Ga0207709_10000002
802 Ga0207669_10030089
803 Ga0207669_10224013
804 Ga0207704_10217851
805 Ga0207704_10261118
806 Ga0207711_10199827
807 Ga0207711_10259450
808 Ga0207711_10565191
809 Ga0207689_10659637
810 Ga0207661_10583706
811 Ga0207661_11934876
812 Ga0207667_10000339
813 Ga0207667_10001896
814 Ga0207667_10006376
815 Ga0207667_10048777
816 Ga0207667_10059507
817 Ga0207667_10060856
818 Ga0207667_10087542
819 Ga0207667_10263588
820 Ga0207667_11032672
821 Ga0207667_11075479
822 Ga0207651_10019642
823 Ga0207712_11290267
824 Ga0207668_10608865
825 Ga0207658_10000003
826 Ga0207658_10031028
827 Ga0207658_10161602
828 Ga0207703_10640007
829 Ga0207639_10051853
830 Ga0207639_11333120
831 Ga0207702_10000001
832 Ga0207702_10011223
833 Ga0207702_10013958
834 Ga0207702_10435389
835 Ga0207641_10052199
836 Ga0207641_10075238
837 Ga0207648_10057394
838 Ga0207676_11353979
839 Ga0207674_10000001
840 Ga0207674_10014249
841 Ga0207674_10059309
842 Ga0207674_10141133
843 Ga0207674_10283905
844 Ga0207674_10574923
845 Ga0207674_10644717
846 Ga0207674_10982211
847 Ga0207683_10029174
848 Ga0207683_10386958
849 Ga0207698_10007011
850 Ga0209813_10000154
851 Ga0268266_10002329
852 Ga0268266_10088619
853 Ga0268266_10569046
854 Ga0268266_11376636
855 Ga0268264_10058168
856 Ga0268264_10152409
857 Ga0268264_11727487
858 Ga0265337_1000227
859 Ga0265337_1000244
860 Ga0265337_1002862
861 Ga0265337_1029554
862 Ga0265337_1057712
863 Ga0265326_10000755
864 Ga0265326_10003333
865 Ga0265326_10005376
866 Ga0265326_10011258
867 Ga0265326_10015700
868 Ga0265319_1016715
869 Ga0265319_1075636
870 Ga0265319_1078501
871 Ga0265319_1143501
872 Ga0265319_1214409
873 Ga0265334_10000057
874 Ga0265334_10000144
875 Ga0265334_10001811
876 Ga0265334_10006824
877 Ga0265334_10019884
878 Ga0265334_10035249
879 Ga0265334_10072370
880 Ga0265318_10004668
881 Ga0265318_10088691
882 Ga0265318_10096818
883 Ga0265323_10002827
884 Ga0265322_10000864
885 Ga0265322_10004713
886 Ga0265322_10007979
887 Ga0265336_10001710
888 Ga0265336_10003300
889 Ga0265336_10007276
890 Ga0265336_10007661
891 Ga0265338_10000003
892 Ga0265338_10000054
893 Ga0265338_10000130
894 Ga0265338_10000366
895 Ga0265338_10000419
896 Ga0265338_10000771
897 Ga0265338_10000841
898 Ga0265338_10001885
899 Ga0265338_10002761
900 Ga0265338_10008051
901 Ga0265338_10008859
902 Ga0265338_10036590
903 Ga0265338_10049830
904 Ga0265338_10087056
905 Ga0265338_10157351
906 Ga0265338_10424482
907 Ga0265338_10444798
908 Ga0265338_10453931
909 Ga0265324_10007997
910 Ga0265324_10010258
911 Ga0265324_10034109
912 Ga0316179_1001639
913 Ga0265330_10004460
914 Ga0265330_10113046
915 Ga0265332_10007896
916 Ga0265332_10026194
917 Ga0265332_10247034
918 Ga0265328_10001186
919 Ga0265320_10005897
920 Ga0265320_10018766
921 Ga0265320_10188324
922 Ga0265325_10003439
923 Ga0265325_10085818
924 Ga0265329_10003025
925 Ga0265340_10002179
926 Ga0265340_10014553
927 Ga0265339_10007998
928 Ga0265339_10171612
929 Ga0265339_10208363
930 Ga0265339_10245439
931 Ga0265331_10007364
932 Ga0265327_10000017
933 Ga0265327_10002752
934 Ga0265327_10003189
935 Ga0265327_10021544
936 Ga0265327_10029322
937 Ga0265327_10033845
938 Ga0265327_10349580
939 Ga0265316_10013001
940 Ga0265316_10029923
941 Ga0265316_10046243
942 Ga0265316_10385003
943 Ga0265316_10402868
944 Ga0265316_10635197
945 Ga0265313_10005371
946 Ga0265313_10009485
947 Ga0265313_10011005
948 Ga0265314_10006571
949 Ga0265314_10264297
950 Ga0265314_10609177
951 Ga0265342_10006215
952 Ga0373934_0466448
953 Ga0373944_0140597
954 Ga0395899_0009307
955 Ga0395899_0200771
956 Ga0395899_0418799
957 Ga0395900_0001880
958 Ga0395900_0002167
959 Ga0395900_0023300
960 Ga0395900_0043498
961 Ga0395900_0080917
962 Ga0395900_0200518
963 Ga0395900_0500788
964 Ga0395900_1336473
965 Ga0395898_0001404
966 Ga0395898_0004142
967 Ga0395898_0043454
968 Ga0395898_0333281
969 Ga0395905_0002235
970 Ga0395905_0087579
971 Ga0395905_0546811
972 Ga0395905_1360630
973 Ga0395901_0001834
974 Ga0395901_0009097
975 Ga0395901_0019837
976 Ga0395901_0035007
977 Ga0395901_0200221
978 Ga0395901_1029960
979 Ga0451800_1051778
980 Ga0451807_0582546
981 Ga0451807_1043250
982 Ga0466963_0193095
983 Ga0466967_0255661
984 Ga0466967_0994819
985 Ga0495583_0016469
986 Ga0495583_0447445
987 Ga0495658_0038913
988 Ga0495670_0744853
989 Ga0495649_0000379
990 Ga0495672_0000016
991 Ga0496100_0487582
992 Ga0496112_0304724
993 Ga0496113_0435169
994 Ga0496126_0057535
995 Ga0501031_0002235
996 Ga0501032_0000394
997 Ga0501034_0032705
998 Ga0501034_0076194
999 Ga0501034_0134594
1000 Ga0501036_0025601
1001 Ga0501036_0332363
1002 Ga0501037_0000133
1003 Ga0501038_0023026
1004 Ga0501038_0807084
1005 Ga0501042_0014645
1006 Ga0501043_0004814
1007 Ga0501046_0000038
1008 Ga0501046_0101318
1009 Ga0501047_0000355
1010 Ga0501047_0009034
1011 Ga0501048_0000379
1012 Ga0501068_1046487
1013 Ga0501069_0262536
1014 Ga0501070_0046000
1015 Ga0501070_0209825
1016 Ga0501073_0072903
1017 Ga0501073_0484983
1018 Ga0501073_0530035
1019 Ga0501074_0220874
1020 Ga0501080_0001480
1021 Ga0501083_0269133
1022 Ga0501083_0549713
1023 Ga0501035_0001229
1024 Ga0501035_0002682
1025 Ga0501044_0110414
1026 nmdc:mga03683_126162_c1
1027 nmdc:mga03n38_357_c1
1028 nmdc:mga0yw44_173902_c1
1029 nmdc:mga0yw44_615_c1
1030 nmdc:mga0k408_206643_c1
1031 nmdc:mga0k408_36_c1
1032 nmdc:mga06z11_1_c2
1033 nmdc:mga04h51_6_c2
1034 nmdc:mga07m45_60737_c1
1035 nmdc:mga0qj67_5316_c1
1036 nmdc:mga0qj67_547461_c1
1037 nmdc:mga0sz30_1656_c1
1038 nmdc:mga0sz30_1_c1
1039 nmdc:mga0sz30_205895_c1
1040 Ga0500643_000010
1041 Ga0500643_000980
1042 Ga0500644_0001354
1043 Ga0500646_0000654
1044 Ga0500583_0001506
1045 Ga0500583_0046948
1046 Ga0500651_0000050
1047 Ga0500651_0016217
1048 Ga0500651_0179061
1049 Ga0500650_0000001
1050 Ga0500555_015286
1051 Ga0500555_118002
1052 Ga0500562_002352
1053 Ga0500593_000001
1054 Ga0500594_0000001
1055 Ga0500614_000543
1056 Ga0500568_0027264
1057 Ga0500577_0000452
1058 Ga0500577_0001529
1059 Ga0500577_0074123
1060 Ga0500579_019001
1061 Ga0500604_0029052
1062 Ga0500570_000007
1063 Ga0500611_000200
1064 Ga0501084_0211102
1065 Ga0587094_006367
1066 Ga0587067_193745
1067 Ga0587072_154462
1068 Ga0501082_0038970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

19

76

0.97

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

82

150

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.977 3 72
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9595 3 78
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.9505 3 72
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9357 3 78
2bcw-assembly1.cif.gz_A coordinates of the n-terminal domain of ribosomal protein l11,c-terminal domain of ribosomal protein l7/l12 and a portion of the g' domain of elongation factor g, as fitted into cryo-em map of an escherichia coli 70s*ef-g*gdp*fusidic acid complex 0.9149 9 72
ID Description Score Start End Superfamily
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9693 3 68 3.30.1550.10
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9595 3 78 3.30.1550.10
4v19K01 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9543 6 70 3.30.1550.10
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9357 3 78 3.30.1550.10
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9283 3 68 3.30.1550.10
ID Description Score Start End GO Terms
AF-A0A5C8AR95-F1-model_v4 deleted 0.989 1 72
AF-A0A7J4E0X6-F1-model_v4 deleted 0.9857 1 69
AF-A0A2N2LDD6-F1-model_v4 50S ribosomal protein L11 0.9852 1 72 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A2D7JF69-F1-model_v4 50S ribosomal protein L11 0.9809 1 70 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A5C8AR95-F1-model_v4 deleted 0.9756 1 72

Map