F460555
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 534 | 262 | 534 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300035207|Ga0373942_0006896|Ga0373942_0006896_556_1293 |
| Length | 245 |
| Sequence | MKTAFRPAFFCMLLGLLCFPGALFAQSEDEAMLLVANPAFRDLEYRQTVLIAAPAPNGGHVGVIINRPTRRSLGSLFPEHEPSKKVVDPVYYGGPFSRGALVALVRADQAPGEGVVPLMKSLYLAFRANTIDHVIETTPNDARYFVGYVGWRPGELRSEIDRGVWSVLNADLDMVFRKDTEGMWEELLQQTKRIRADAAPRRVPLAASPADDAPLGAGEATARTAELSRSRAILFAWTPNRAVAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 48 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 123 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 131 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 132 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 133 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 134 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 135 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 136 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 137 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 139 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 140 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 142 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 143 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 144 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 146 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 150 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 151 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 154 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 155 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 156 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 159 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 160 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 161 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 162 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 163 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 164 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 165 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 166 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 167 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 168 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 169 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 170 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 171 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 172 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 173 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 174 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 175 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 261 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 99.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI26141J51220_1004571 | 3300003503 | Unclassified | 857 |
| 2 | Ga0070690_100000148 | 3300005330 | Bacteria | 35769 |
| 3 | Ga0070690_100102933 | 3300005330 | Bacteria | 1895 |
| 4 | Ga0070690_100330720 | 3300005330 | Bacteria | 1101 |
| 5 | Ga0068869_100000103 | 3300005334 | Bacteria | 39927 |
| 6 | Ga0070680_100252946 | 3300005336 | Bacteria | 1490 |
| 7 | Ga0068868_100724191 | 3300005338 | Bacteria | 892 |
| 8 | Ga0070689_100001211 | 3300005340 | Bacteria | 16347 |
| 9 | Ga0070689_100466408 | 3300005340 | Bacteria | 1077 |
| 10 | Ga0070687_100000105 | 3300005343 | Bacteria | 28128 |
| 11 | Ga0070687_100257175 | 3300005343 | Bacteria | 1088 |
| 12 | Ga0070687_100744990 | 3300005343 | Bacteria | 689 |
| 13 | Ga0070692_10002047 | 3300005345 | Bacteria | 7669 |
| 14 | Ga0070675_100031722 | 3300005354 | Bacteria | 4273 |
| 15 | Ga0070675_100578795 | 3300005354 | Bacteria | 1017 |
| 16 | Ga0070673_100210043 | 3300005364 | Bacteria | 1681 |
| 17 | Ga0070701_10004680 | 3300005438 | Bacteria | 5575 |
| 18 | Ga0070711_100191545 | 3300005439 | Bacteria | 1572 |
| 19 | Ga0070705_100050267 | 3300005440 | Bacteria | 2424 |
| 20 | Ga0070705_100220098 | 3300005440 | Bacteria | 1314 |
| 21 | Ga0070705_100492267 | 3300005440 | Bacteria | 929 |
| 22 | Ga0070700_100006464 | 3300005441 | Bacteria | 6274 |
| 23 | Ga0070700_100401626 | 3300005441 | Bacteria | 1030 |
| 24 | Ga0070700_100512562 | 3300005441 | Bacteria | 925 |
| 25 | Ga0070694_100023655 | 3300005444 | Bacteria | 3954 |
| 26 | Ga0070694_100039734 | 3300005444 | Bacteria | 3134 |
| 27 | Ga0070694_100208925 | 3300005444 | Bacteria | 1459 |
| 28 | Ga0070662_100398048 | 3300005457 | Bacteria | 1136 |
| 29 | Ga0070681_10000790 | 3300005458 | Bacteria | 26387 |
| 30 | Ga0068867_100000441 | 3300005459 | Bacteria | 27580 |
| 31 | Ga0070706_100181005 | 3300005467 | Bacteria | 1968 |
| 32 | Ga0070707_101189057 | 3300005468 | Bacteria | 729 |
| 33 | Ga0070698_100007519 | 3300005471 | Bacteria | 11786 |
| 34 | Ga0070699_100084515 | 3300005518 | Bacteria | 2769 |
| 35 | Ga0070699_100389461 | 3300005518 | Bacteria | 1259 |
| 36 | Ga0070699_100574523 | 3300005518 | Bacteria | 1027 |
| 37 | Ga0070679_100176348 | 3300005530 | Bacteria | 2110 |
| 38 | Ga0070684_100307192 | 3300005535 | Bacteria | 1456 |
| 39 | Ga0070684_100921956 | 3300005535 | Bacteria | 819 |
| 40 | Ga0070697_100059500 | 3300005536 | Bacteria | 3111 |
| 41 | Ga0070697_100072789 | 3300005536 | Bacteria | 2820 |
| 42 | Ga0070672_100203609 | 3300005543 | Bacteria | 1655 |
| 43 | Ga0070686_100635517 | 3300005544 | Bacteria | 845 |
| 44 | Ga0070695_100000259 | 3300005545 | Bacteria | 26538 |
| 45 | Ga0070695_100011635 | 3300005545 | Bacteria | 5265 |
| 46 | Ga0070695_100050132 | 3300005545 | Unclassified | 2675 |
| 47 | Ga0070695_100054298 | 3300005545 | Bacteria | 2578 |
| 48 | Ga0070695_100090283 | 3300005545 | Unclassified | 2044 |
| 49 | Ga0070695_100107288 | 3300005545 | Bacteria | 1889 |
| 50 | Ga0070695_100175240 | 3300005545 | Bacteria | 1516 |
| 51 | Ga0070696_100020737 | 3300005546 | Unclassified | 4453 |
| 52 | Ga0070696_100024432 | 3300005546 | Bacteria | 4107 |
| 53 | Ga0070696_100105391 | 3300005546 | Unclassified | 2025 |
| 54 | Ga0070693_100000101 | 3300005547 | Bacteria | 37995 |
| 55 | Ga0070693_100126323 | 3300005547 | Bacteria | 1593 |
| 56 | Ga0070704_100024044 | 3300005549 | Bacteria | 3992 |
| 57 | Ga0070704_100174028 | 3300005549 | Bacteria | 1715 |
| 58 | Ga0070704_100246963 | 3300005549 | Bacteria | 1463 |
| 59 | Ga0070704_100667767 | 3300005549 | Bacteria | 919 |
| 60 | Ga0068855_100001986 | 3300005563 | Bacteria | 25406 |
| 61 | Ga0068854_100020898 | 3300005578 | Bacteria | 4436 |
| 62 | Ga0068856_100034678 | 3300005614 | Bacteria | 4943 |
| 63 | Ga0068856_100372430 | 3300005614 | Bacteria | 1447 |
| 64 | Ga0070702_100094609 | 3300005615 | Bacteria | 1819 |
| 65 | Ga0070702_100174272 | 3300005615 | Bacteria | 1402 |
| 66 | Ga0068859_100004200 | 3300005617 | Bacteria | 14703 |
| 67 | Ga0068859_100014168 | 3300005617 | Bacteria | 7996 |
| 68 | Ga0068859_100455188 | 3300005617 | Bacteria | 1376 |
| 69 | Ga0068866_10089639 | 3300005718 | Bacteria | 1672 |
| 70 | Ga0068861_100000826 | 3300005719 | Bacteria | 18701 |
| 71 | Ga0068861_100006057 | 3300005719 | Bacteria | 8224 |
| 72 | Ga0068861_100052305 | 3300005719 | Unclassified | 3104 |
| 73 | Ga0068861_100504100 | 3300005719 | Bacteria | 1095 |
| 74 | Ga0068870_10123249 | 3300005840 | Bacteria | 1496 |
| 75 | Ga0068870_10178142 | 3300005840 | Bacteria | 1274 |
| 76 | Ga0068863_100223527 | 3300005841 | Bacteria | 1814 |
| 77 | Ga0068863_100843831 | 3300005841 | Bacteria | 915 |
| 78 | Ga0068858_100002013 | 3300005842 | Bacteria | 20783 |
| 79 | Ga0068860_100001309 | 3300005843 | Bacteria | 27054 |
| 80 | Ga0068860_100088352 | 3300005843 | Bacteria | 2950 |
| 81 | Ga0068862_100007502 | 3300005844 | Bacteria | 9037 |
| 82 | Ga0068862_100033569 | 3300005844 | Bacteria | 4339 |
| 83 | Ga0068862_100170415 | 3300005844 | Bacteria | 1949 |
| 84 | Ga0068862_100315047 | 3300005844 | Bacteria | 1443 |
| 85 | Ga0097621_100000106 | 3300006237 | Bacteria | 47435 |
| 86 | Ga0097621_100029641 | 3300006237 | Bacteria | 4324 |
| 87 | Ga0068871_100016457 | 3300006358 | Bacteria | 5569 |
| 88 | Ga0068871_100018352 | 3300006358 | Bacteria | 5315 |
| 89 | Ga0075428_100000134 | 3300006844 | Bacteria | 65107 |
| 90 | Ga0075428_100101766 | 3300006844 | Bacteria | 3132 |
| 91 | Ga0075428_100169561 | 3300006844 | Bacteria | 2367 |
| 92 | Ga0075428_100209012 | 3300006844 | Bacteria | 2109 |
| 93 | Ga0075428_100332189 | 3300006844 | Bacteria | 1633 |
| 94 | Ga0075430_100015801 | 3300006846 | Bacteria | 6428 |
| 95 | Ga0075430_100136869 | 3300006846 | Unclassified | 2040 |
| 96 | Ga0075430_100473318 | 3300006846 | Bacteria | 1034 |
| 97 | Ga0075431_100082409 | 3300006847 | Bacteria | 3320 |
| 98 | Ga0075431_100088136 | 3300006847 | Bacteria | 3202 |
| 99 | Ga0075431_100179112 | 3300006847 | Bacteria | 2176 |
| 100 | Ga0075431_100260871 | 3300006847 | Bacteria | 1758 |
| 101 | Ga0075431_100392373 | 3300006847 | Bacteria | 1390 |
| 102 | Ga0075431_100393998 | 3300006847 | Bacteria | 1387 |
| 103 | Ga0075433_10009655 | 3300006852 | Bacteria | 7723 |
| 104 | Ga0075433_10189694 | 3300006852 | Bacteria | 1829 |
| 105 | Ga0075433_10263397 | 3300006852 | Bacteria | 1528 |
| 106 | Ga0075433_10272233 | 3300006852 | Bacteria | 1501 |
| 107 | Ga0075433_10464557 | 3300006852 | Bacteria | 1115 |
| 108 | Ga0075433_10478654 | 3300006852 | Bacteria | 1097 |
| 109 | Ga0075433_10648746 | 3300006852 | Bacteria | 925 |
| 110 | Ga0075434_100000593 | 3300006871 | Bacteria | 27994 |
| 111 | Ga0075434_100000699 | 3300006871 | Bacteria | 26231 |
| 112 | Ga0075434_100009949 | 3300006871 | Bacteria | 8898 |
| 113 | Ga0075434_101206552 | 3300006871 | Bacteria | 769 |
| 114 | Ga0075429_100000271 | 3300006880 | Bacteria | 36263 |
| 115 | Ga0075429_100000955 | 3300006880 | Bacteria | 22912 |
| 116 | Ga0075429_100016200 | 3300006880 | Bacteria | 6458 |
| 117 | Ga0068865_100000231 | 3300006881 | Bacteria | 31031 |
| 118 | Ga0068865_100015043 | 3300006881 | Bacteria | 4928 |
| 119 | Ga0075436_100003269 | 3300006914 | Bacteria | 11101 |
| 120 | Ga0075436_100007082 | 3300006914 | Bacteria | 7676 |
| 121 | Ga0075436_100007710 | 3300006914 | Bacteria | 7355 |
| 122 | Ga0075436_100024973 | 3300006914 | Bacteria | 4109 |
| 123 | Ga0097620_100004200 | 3300006931 | Bacteria | 14703 |
| 124 | Ga0097620_100014167 | 3300006931 | Bacteria | 7996 |
| 125 | Ga0097620_100149062 | 3300006931 | Bacteria | 2415 |
| 126 | Ga0097620_100455185 | 3300006931 | Bacteria | 1376 |
| 127 | Ga0075435_100002111 | 3300007076 | Bacteria | 13077 |
| 128 | Ga0075435_100010825 | 3300007076 | Bacteria | 6679 |
| 129 | Ga0075435_100077188 | 3300007076 | Bacteria | 2731 |
| 130 | Ga0075435_100115056 | 3300007076 | Bacteria | 2239 |
| 131 | Ga0075435_100135489 | 3300007076 | Bacteria | 2063 |
| 132 | Ga0105250_10032592 | 3300009092 | Bacteria | 2092 |
| 133 | Ga0111539_10032731 | 3300009094 | Bacteria | 6314 |
| 134 | Ga0111539_10063590 | 3300009094 | Bacteria | 4366 |
| 135 | Ga0111539_10080149 | 3300009094 | Bacteria | 3840 |
| 136 | Ga0111539_10186410 | 3300009094 | Bacteria | 2423 |
| 137 | Ga0111539_10263245 | 3300009094 | Bacteria | 2007 |
| 138 | Ga0111539_10349193 | 3300009094 | Bacteria | 1722 |
| 139 | Ga0105245_10000347 | 3300009098 | Bacteria | 43236 |
| 140 | Ga0105245_10168628 | 3300009098 | Bacteria | 2083 |
| 141 | Ga0105247_10467247 | 3300009101 | Bacteria | 913 |
| 142 | Ga0114129_10006193 | 3300009147 | Bacteria | 16974 |
| 143 | Ga0114129_10023204 | 3300009147 | Bacteria | 8800 |
| 144 | Ga0114129_10107512 | 3300009147 | Bacteria | 3852 |
| 145 | Ga0114129_10307235 | 3300009147 | Bacteria | 2112 |
| 146 | Ga0105243_10000535 | 3300009148 | Bacteria | 38636 |
| 147 | Ga0105243_10009085 | 3300009148 | Bacteria | 7594 |
| 148 | Ga0105243_10235245 | 3300009148 | Bacteria | 1627 |
| 149 | Ga0105243_10302391 | 3300009148 | Bacteria | 1450 |
| 150 | Ga0105241_10241263 | 3300009174 | Bacteria | 1528 |
| 151 | Ga0105242_10000905 | 3300009176 | Bacteria | 23036 |
| 152 | Ga0105242_10001418 | 3300009176 | Bacteria | 18885 |
| 153 | Ga0105248_10221641 | 3300009177 | Bacteria | 2129 |
| 154 | Ga0105249_10001515 | 3300009553 | Bacteria | 20389 |
| 155 | Ga0105249_10065151 | 3300009553 | Bacteria | 3351 |
| 156 | Ga0105249_10602609 | 3300009553 | Bacteria | 1153 |
| 157 | Ga0105239_10647571 | 3300010375 | Bacteria | 1207 |
| 158 | Ga0105246_10129300 | 3300011119 | Bacteria | 1884 |
| 159 | Ga0157369_10935753 | 3300013105 | Bacteria | 888 |
| 160 | Ga0157378_10000447 | 3300013297 | Bacteria | 39662 |
| 161 | Ga0157378_10583665 | 3300013297 | Bacteria | 1127 |
| 162 | Ga0157380_10036817 | 3300014326 | Bacteria | 3788 |
| 163 | Ga0157380_10320089 | 3300014326 | Bacteria | 1438 |
| 164 | Ga0157377_10072821 | 3300014745 | Bacteria | 1989 |
| 165 | Ga0157377_10385433 | 3300014745 | Bacteria | 950 |
| 166 | Ga0157379_10728039 | 3300014968 | Bacteria | 933 |
| 167 | Ga0157376_10033483 | 3300014969 | Bacteria | 4138 |
| 168 | Ga0207653_10018261 | 3300025885 | Bacteria | 2209 |
| 169 | Ga0207642_10007904 | 3300025899 | Bacteria | 3616 |
| 170 | Ga0207642_10065474 | 3300025899 | Bacteria | 1708 |
| 171 | Ga0207685_10032306 | 3300025905 | Bacteria | 1882 |
| 172 | Ga0207645_10246457 | 3300025907 | Bacteria | 1181 |
| 173 | Ga0207643_10042106 | 3300025908 | Bacteria | 2574 |
| 174 | Ga0207643_10162223 | 3300025908 | Bacteria | 1345 |
| 175 | Ga0207684_10110876 | 3300025910 | Bacteria | 2349 |
| 176 | Ga0207707_10042871 | 3300025912 | Bacteria | 3948 |
| 177 | Ga0207707_10068136 | 3300025912 | Bacteria | 3100 |
| 178 | Ga0207663_10098707 | 3300025916 | Unclassified | 1956 |
| 179 | Ga0207660_10003601 | 3300025917 | Bacteria | 10091 |
| 180 | Ga0207660_10032377 | 3300025917 | Bacteria | 3609 |
| 181 | Ga0207662_10000109 | 3300025918 | Bacteria | 39758 |
| 182 | Ga0207662_10100672 | 3300025918 | Bacteria | 1790 |
| 183 | Ga0207662_10146942 | 3300025918 | Bacteria | 1497 |
| 184 | Ga0207652_10107500 | 3300025921 | Bacteria | 2471 |
| 185 | Ga0207652_10257707 | 3300025921 | Bacteria | 1573 |
| 186 | Ga0207681_10009140 | 3300025923 | Bacteria | 6052 |
| 187 | Ga0207650_10384890 | 3300025925 | Bacteria | 1159 |
| 188 | Ga0207659_10097882 | 3300025926 | Bacteria | 2205 |
| 189 | Ga0207659_10453369 | 3300025926 | Bacteria | 1080 |
| 190 | Ga0207687_10001220 | 3300025927 | Bacteria | 17591 |
| 191 | Ga0207644_10389081 | 3300025931 | Unclassified | 1138 |
| 192 | Ga0207690_11123967 | 3300025932 | Bacteria | 655 |
| 193 | Ga0207706_10287129 | 3300025933 | Bacteria | 1434 |
| 194 | Ga0207686_10003414 | 3300025934 | Bacteria | 8525 |
| 195 | Ga0207709_10001794 | 3300025935 | Bacteria | 14388 |
| 196 | Ga0207709_10017865 | 3300025935 | Bacteria | 3965 |
| 197 | Ga0207670_10026770 | 3300025936 | Bacteria | 3638 |
| 198 | Ga0207670_10120864 | 3300025936 | Bacteria | 1904 |
| 199 | Ga0207670_10176230 | 3300025936 | Bacteria | 1607 |
| 200 | Ga0207670_10290899 | 3300025936 | Bacteria | 1276 |
| 201 | Ga0207670_10684354 | 3300025936 | Bacteria | 848 |
| 202 | Ga0207669_10012921 | 3300025937 | Bacteria | 4126 |
| 203 | Ga0207704_10001838 | 3300025938 | Bacteria | 9511 |
| 204 | Ga0207704_10012020 | 3300025938 | Bacteria | 4284 |
| 205 | Ga0207691_10092168 | 3300025940 | Bacteria | 2713 |
| 206 | Ga0207711_10124004 | 3300025941 | Bacteria | 2309 |
| 207 | Ga0207689_10000532 | 3300025942 | Bacteria | 36122 |
| 208 | Ga0207661_10085851 | 3300025944 | Bacteria | 2610 |
| 209 | Ga0207667_10053712 | 3300025949 | Bacteria | 4238 |
| 210 | Ga0207712_10002829 | 3300025961 | Bacteria | 11120 |
| 211 | Ga0207712_10009606 | 3300025961 | Bacteria | 6125 |
| 212 | Ga0207712_10335397 | 3300025961 | Bacteria | 1252 |
| 213 | Ga0207668_10011102 | 3300025972 | Bacteria | 5464 |
| 214 | Ga0207640_10048593 | 3300025981 | Bacteria | 2743 |
| 215 | Ga0207677_10002506 | 3300026023 | Bacteria | 9627 |
| 216 | Ga0207703_10011836 | 3300026035 | Bacteria | 6793 |
| 217 | Ga0207708_10000712 | 3300026075 | Bacteria | 25051 |
| 218 | Ga0207708_10019272 | 3300026075 | Bacteria | 5140 |
| 219 | Ga0207708_10589878 | 3300026075 | Bacteria | 940 |
| 220 | Ga0207702_10006394 | 3300026078 | Bacteria | 10164 |
| 221 | Ga0207641_10302303 | 3300026088 | Bacteria | 1512 |
| 222 | Ga0207641_10342461 | 3300026088 | Bacteria | 1423 |
| 223 | Ga0207648_10000505 | 3300026089 | Bacteria | 43495 |
| 224 | Ga0207648_10002083 | 3300026089 | Bacteria | 21780 |
| 225 | Ga0207676_10125498 | 3300026095 | Bacteria | 2173 |
| 226 | Ga0207674_10544912 | 3300026116 | Bacteria | 1121 |
| 227 | Ga0207675_100000625 | 3300026118 | Bacteria | 34684 |
| 228 | Ga0207675_100000760 | 3300026118 | Bacteria | 32073 |
| 229 | Ga0207675_100115594 | 3300026118 | Bacteria | 2535 |
| 230 | Ga0207675_100661068 | 3300026118 | Bacteria | 1052 |
| 231 | Ga0207675_101095812 | 3300026118 | Bacteria | 816 |
| 232 | Ga0207698_10576904 | 3300026142 | Bacteria | 1106 |
| 233 | Ga0209969_1003311 | 3300027360 | Bacteria | 2225 |
| 234 | Ga0209967_1002463 | 3300027364 | Bacteria | 2397 |
| 235 | Ga0210000_1000637 | 3300027462 | Bacteria | 4825 |
| 236 | Ga0210000_1003102 | 3300027462 | Bacteria | 2383 |
| 237 | Ga0209995_1006752 | 3300027471 | Bacteria | 1848 |
| 238 | Ga0209995_1010945 | 3300027471 | Bacteria | 1473 |
| 239 | Ga0209971_1007160 | 3300027682 | Bacteria | 2645 |
| 240 | Ga0209966_1008965 | 3300027695 | Unclassified | 1782 |
| 241 | Ga0209974_10046999 | 3300027876 | Unclassified | 1445 |
| 242 | Ga0207428_10006818 | 3300027907 | Bacteria | 10471 |
| 243 | Ga0207428_10044980 | 3300027907 | Bacteria | 3559 |
| 244 | Ga0207428_10136244 | 3300027907 | Bacteria | 1877 |
| 245 | Ga0207428_10407639 | 3300027907 | Bacteria | 995 |
| 246 | Ga0268265_10003684 | 3300028380 | Bacteria | 10934 |
| 247 | Ga0268265_10006319 | 3300028380 | Bacteria | 8028 |
| 248 | Ga0268264_10004078 | 3300028381 | Bacteria | 12508 |
| 249 | Ga0268264_10314235 | 3300028381 | Bacteria | 1479 |
| 250 | Ga0307408_100544112 | 3300031548 | Unclassified | 1023 |
| 251 | Ga0307405_10427294 | 3300031731 | Unclassified | 1044 |
| 252 | Ga0307412_10224288 | 3300031911 | Unclassified | 1443 |
| 253 | Ga0307409_100395095 | 3300031995 | Bacteria | 1319 |
| 254 | Ga0307416_100334676 | 3300032002 | Bacteria | 1523 |
| 255 | Ga0307416_100455048 | 3300032002 | Unclassified | 1333 |
| 256 | Ga0307411_10055576 | 3300032005 | Bacteria | 2605 |
| 257 | Ga0307411_10203651 | 3300032005 | Unclassified | 1522 |
| 258 | Ga0307411_10288948 | 3300032005 | Bacteria | 1309 |
| 259 | Ga0373930_0007408 | 3300034816 | Unclassified | 1889 |
| 260 | Ga0373948_0000598 | 3300034817 | Bacteria | 4630 |
| 261 | Ga0373948_0027773 | 3300034817 | Bacteria | 1123 |
| 262 | Ga0373928_0004346 | 3300035084 | Bacteria | 2702 |
| 263 | Ga0373940_0009465 | 3300035088 | Bacteria | 2267 |
| 264 | Ga0373949_0005757 | 3300035090 | Bacteria | 2757 |
| 265 | Ga0373951_0028316 | 3300035091 | Bacteria | 1312 |
| 266 | Ga0373932_0006499 | 3300035112 | Bacteria | 2764 |
| 267 | Ga0373932_0039800 | 3300035112 | Bacteria | 1350 |
| 268 | Ga0373936_0013970 | 3300035113 | Bacteria | 3067 |
| 269 | Ga0373939_0001027 | 3300035114 | Bacteria | 6877 |
| 270 | Ga0373941_0003835 | 3300035115 | Bacteria | 3445 |
| 271 | Ga0373945_0003206 | 3300035116 | Bacteria | 5130 |
| 272 | Ga0373954_0054081 | 3300035118 | Bacteria | 1888 |
| 273 | Ga0373956_0086693 | 3300035119 | Bacteria | 1441 |
| 274 | Ga0373960_0029353 | 3300035121 | Bacteria | 1524 |
| 275 | Ga0373960_0041752 | 3300035121 | Bacteria | 1329 |
| 276 | Ga0373943_0005804 | 3300035170 | Bacteria | 5545 |
| 277 | Ga0373946_0003055 | 3300035171 | Bacteria | 5924 |
| 278 | Ga0373955_0365428 | 3300035172 | Bacteria | 875 |
| 279 | Ga0373942_0006896 | 3300035207 | Bacteria | 2625 |
| 280 | Ga0373962_0007763 | 3300035242 | Bacteria | 2633 |
| 281 | Ga0373924_0002459 | 3300035410 | Bacteria | 6234 |
| 282 | Ga0373931_0000483 | 3300035691 | Bacteria | 16244 |
| 283 | Ga0373931_0023496 | 3300035691 | Bacteria | 3113 |
| 284 | Ga0373931_0046606 | 3300035691 | Bacteria | 2292 |
| 285 | Ga0373931_0602623 | 3300035691 | Bacteria | 718 |
| 286 | Ga0373935_0010422 | 3300035692 | Bacteria | 5573 |
| 287 | Ga0373927_0053308 | 3300035695 | Bacteria | 2616 |
| 288 | Ga0373933_0046950 | 3300035724 | Bacteria | 2567 |
| 289 | Ga0373947_0359373 | 3300035725 | Bacteria | 978 |
| 290 | Ga0373937_0001291 | 3300036401 | Bacteria | 20976 |
| 291 | Ga0373937_0001839 | 3300036401 | Bacteria | 17831 |
| 292 | Ga0373937_0083131 | 3300036401 | Bacteria | 2962 |
| 293 | Ga0373925_0115925 | 3300037068 | Bacteria | 2074 |
| 294 | Ga0395905_0660260 | 3300037471 | Bacteria | 948 |
| 295 | Ga0242420_037789 | 3300038996 | Bacteria | 915 |
| 296 | Ga0439436_0104444 | 3300041404 | Bacteria | 790 |
| 297 | Ga0439439_0037543 | 3300041406 | Bacteria | 1249 |
| 298 | Ga0439461_0056042 | 3300041410 | Unclassified | 885 |
| 299 | Ga0451853_0943965 | 3300041512 | Bacteria | 808 |
| 300 | Ga0439431_0073621 | 3300041997 | Bacteria | 913 |
| 301 | Ga0439441_000107 | 3300042001 | Bacteria | 6772 |
| 302 | Ga0439441_004278 | 3300042001 | Bacteria | 2154 |
| 303 | Ga0439443_002781 | 3300042003 | Unclassified | 2132 |
| 304 | Ga0439456_071711 | 3300042013 | Bacteria | 768 |
| 305 | Ga0439462_0101862 | 3300042015 | Unclassified | 792 |
| 306 | Ga0439446_0015276 | 3300042156 | Bacteria | 2128 |
| 307 | Ga0439434_0011042 | 3300042435 | Bacteria | 2668 |
| 308 | Ga0439434_0159997 | 3300042435 | Unclassified | 748 |
| 309 | Ga0439435_0000155 | 3300042436 | Bacteria | 9350 |
| 310 | Ga0439435_0021342 | 3300042436 | Unclassified | 1680 |
| 311 | Ga0451577_0149623 | 3300042876 | Bacteria | 2100 |
| 312 | Ga0451577_0163381 | 3300042876 | Bacteria | 2006 |
| 313 | Ga0451576_0004079 | 3300045051 | Bacteria | 19295 |
| 314 | Ga0451576_0035246 | 3300045051 | Bacteria | 5310 |
| 315 | Ga0451576_0100294 | 3300045051 | Bacteria | 3011 |
| 316 | Ga0451576_0240475 | 3300045051 | Bacteria | 1891 |
| 317 | Ga0451576_0286150 | 3300045051 | Bacteria | 1723 |
| 318 | Ga0451576_0351779 | 3300045051 | Bacteria | 1542 |
| 319 | Ga0451576_0515641 | 3300045051 | Bacteria | 1256 |
| 320 | Ga0466967_0010778 | 3300045976 | Bacteria | 6875 |
| 321 | Ga0495592_0043494 | 3300046454 | Bacteria | 3360 |
| 322 | Ga0495592_0686251 | 3300046454 | Bacteria | 617 |
| 323 | Ga0495603_0013227 | 3300046455 | Bacteria | 4989 |
| 324 | Ga0495629_0204425 | 3300046459 | Unclassified | 1365 |
| 325 | Ga0495641_0067585 | 3300046461 | Bacteria | 1607 |
| 326 | Ga0495651_0237030 | 3300046462 | Unclassified | 1253 |
| 327 | Ga0495651_0320212 | 3300046462 | Bacteria | 1034 |
| 328 | Ga0495653_0140416 | 3300046463 | Bacteria | 1700 |
| 329 | Ga0495580_0112413 | 3300046472 | Bacteria | 1891 |
| 330 | Ga0495639_0009054 | 3300046475 | Bacteria | 4270 |
| 331 | Ga0495662_0020837 | 3300046476 | Bacteria | 3171 |
| 332 | Ga0495662_0022123 | 3300046476 | Bacteria | 3072 |
| 333 | Ga0495608_0000364 | 3300046511 | Bacteria | 31660 |
| 334 | Ga0495618_0139754 | 3300046514 | Bacteria | 1549 |
| 335 | Ga0495628_0176370 | 3300046516 | Bacteria | 1618 |
| 336 | Ga0495630_0016353 | 3300046517 | Bacteria | 5420 |
| 337 | Ga0495630_0079077 | 3300046517 | Bacteria | 2480 |
| 338 | Ga0495630_0336884 | 3300046517 | Bacteria | 1154 |
| 339 | Ga0495663_0054832 | 3300046525 | Bacteria | 1242 |
| 340 | Ga0495666_0021756 | 3300046526 | Bacteria | 3174 |
| 341 | Ga0495666_0096783 | 3300046526 | Bacteria | 1391 |
| 342 | Ga0495642_0262036 | 3300046528 | Bacteria | 756 |
| 343 | Ga0495652_0056357 | 3300046529 | Bacteria | 3338 |
| 344 | Ga0495652_0188574 | 3300046529 | Unclassified | 1576 |
| 345 | Ga0495652_0341266 | 3300046529 | Unclassified | 1076 |
| 346 | Ga0495640_0019833 | 3300046533 | Bacteria | 4958 |
| 347 | Ga0495586_0003547 | 3300046535 | Bacteria | 8361 |
| 348 | Ga0495586_0011068 | 3300046535 | Bacteria | 4793 |
| 349 | Ga0495587_0128981 | 3300046536 | Bacteria | 1446 |
| 350 | Ga0495587_0424474 | 3300046536 | Bacteria | 738 |
| 351 | Ga0495598_0023632 | 3300046537 | Bacteria | 1658 |
| 352 | Ga0495621_0064635 | 3300046539 | Unclassified | 1335 |
| 353 | Ga0495645_0086923 | 3300046543 | Bacteria | 2237 |
| 354 | Ga0495667_0038999 | 3300046559 | Bacteria | 3162 |
| 355 | Ga0495667_0052819 | 3300046559 | Bacteria | 2676 |
| 356 | Ga0495656_0023166 | 3300046615 | Bacteria | 2441 |
| 357 | Ga0495634_0001971 | 3300046642 | Bacteria | 17500 |
| 358 | Ga0495635_0031920 | 3300046663 | Bacteria | 3655 |
| 359 | Ga0495599_0051359 | 3300046678 | Bacteria | 2583 |
| 360 | Ga0495646_0208278 | 3300046680 | Bacteria | 1062 |
| 361 | Ga0495647_0013125 | 3300046681 | Bacteria | 2865 |
| 362 | Ga0495658_0014162 | 3300046683 | Bacteria | 4068 |
| 363 | Ga0495669_0002704 | 3300046684 | Bacteria | 7267 |
| 364 | Ga0495669_0210245 | 3300046684 | Bacteria | 931 |
| 365 | Ga0495613_0067732 | 3300046689 | Bacteria | 2605 |
| 366 | Ga0495624_0040123 | 3300046690 | Bacteria | 2999 |
| 367 | Ga0495600_0039238 | 3300046809 | Bacteria | 3083 |
| 368 | Ga0495581_0106471 | 3300047315 | Bacteria | 1629 |
| 369 | Ga0495604_0013831 | 3300047317 | Bacteria | 6437 |
| 370 | Ga0495604_0099264 | 3300047317 | Bacteria | 2143 |
| 371 | Ga0495676_0039942 | 3300047321 | Bacteria | 3879 |
| 372 | Ga0495680_0001489 | 3300047322 | Bacteria | 25192 |
| 373 | Ga0495680_0507006 | 3300047322 | Bacteria | 818 |
| 374 | Ga0495675_0113864 | 3300047444 | Bacteria | 1687 |
| 375 | Ga0495684_0263694 | 3300047471 | Bacteria | 1249 |
| 376 | Ga0495593_0217692 | 3300047673 | Bacteria | 958 |
| 377 | Ga0495602_0598902 | 3300048088 | Bacteria | 758 |
| 378 | Ga0501031_0045363 | 3300049568 | Bacteria | 2868 |
| 379 | Ga0501033_0006772 | 3300049570 | Bacteria | 8951 |
| 380 | Ga0501033_0105917 | 3300049570 | Bacteria | 2049 |
| 381 | Ga0501034_0327001 | 3300049571 | Bacteria | 1465 |
| 382 | Ga0501036_0001519 | 3300049572 | Bacteria | 17901 |
| 383 | Ga0501036_0035515 | 3300049572 | Bacteria | 4218 |
| 384 | Ga0501036_0090031 | 3300049572 | Bacteria | 2592 |
| 385 | Ga0501037_0035564 | 3300049573 | Bacteria | 3673 |
| 386 | Ga0501037_0271377 | 3300049573 | Bacteria | 1184 |
| 387 | Ga0501037_0431657 | 3300049573 | Bacteria | 901 |
| 388 | Ga0501038_0001082 | 3300049574 | Bacteria | 24639 |
| 389 | Ga0501038_0149327 | 3300049574 | Bacteria | 1906 |
| 390 | Ga0501039_0000168 | 3300049575 | Bacteria | 45750 |
| 391 | Ga0501039_0025260 | 3300049575 | Bacteria | 4564 |
| 392 | Ga0501039_0061710 | 3300049575 | Bacteria | 2903 |
| 393 | Ga0501039_0068050 | 3300049575 | Unclassified | 2765 |
| 394 | Ga0501039_0074536 | 3300049575 | Bacteria | 2638 |
| 395 | Ga0501040_0005928 | 3300049576 | Bacteria | 7912 |
| 396 | Ga0501040_0103527 | 3300049576 | Bacteria | 1987 |
| 397 | Ga0501040_0157887 | 3300049576 | Unclassified | 1602 |
| 398 | Ga0501040_0188243 | 3300049576 | Bacteria | 1464 |
| 399 | Ga0501040_0436371 | 3300049576 | Bacteria | 942 |
| 400 | Ga0501041_0003011 | 3300049577 | Bacteria | 9659 |
| 401 | Ga0501041_0020525 | 3300049577 | Bacteria | 3951 |
| 402 | Ga0501041_0038361 | 3300049577 | Bacteria | 2905 |
| 403 | Ga0501041_0052131 | 3300049577 | Bacteria | 2494 |
| 404 | Ga0501042_0013075 | 3300049578 | Bacteria | 5644 |
| 405 | Ga0501042_0062155 | 3300049578 | Bacteria | 2668 |
| 406 | Ga0501042_0202132 | 3300049578 | Bacteria | 1432 |
| 407 | Ga0501043_0101630 | 3300049579 | Bacteria | 2260 |
| 408 | Ga0501043_0135365 | 3300049579 | Bacteria | 1930 |
| 409 | Ga0501046_0000501 | 3300049580 | Bacteria | 39127 |
| 410 | Ga0501046_0070470 | 3300049580 | Bacteria | 2718 |
| 411 | Ga0501047_0158316 | 3300049581 | Bacteria | 2137 |
| 412 | Ga0501048_0071002 | 3300049582 | Bacteria | 2458 |
| 413 | Ga0501048_0096591 | 3300049582 | Bacteria | 2084 |
| 414 | Ga0501048_0117901 | 3300049582 | Bacteria | 1875 |
| 415 | Ga0501048_0179546 | 3300049582 | Bacteria | 1500 |
| 416 | Ga0501048_0464819 | 3300049582 | Bacteria | 906 |
| 417 | Ga0501067_0017198 | 3300049583 | Bacteria | 3997 |
| 418 | Ga0501068_0010587 | 3300049584 | Bacteria | 5185 |
| 419 | Ga0501068_0074864 | 3300049584 | Bacteria | 2070 |
| 420 | Ga0501071_0000800 | 3300049587 | Bacteria | 16804 |
| 421 | Ga0501071_0016723 | 3300049587 | Bacteria | 5045 |
| 422 | Ga0501071_0034607 | 3300049587 | Bacteria | 3597 |
| 423 | Ga0501071_0038597 | 3300049587 | Bacteria | 3413 |
| 424 | Ga0501071_0076987 | 3300049587 | Bacteria | 2436 |
| 425 | Ga0501071_0219580 | 3300049587 | Bacteria | 1430 |
| 426 | Ga0501072_0000728 | 3300049588 | Bacteria | 23983 |
| 427 | Ga0501072_0002835 | 3300049588 | Bacteria | 13010 |
| 428 | Ga0501072_0016776 | 3300049588 | Bacteria | 5623 |
| 429 | Ga0501072_0052224 | 3300049588 | Bacteria | 3218 |
| 430 | Ga0501072_0064490 | 3300049588 | Bacteria | 2889 |
| 431 | Ga0501072_0164930 | 3300049588 | Bacteria | 1767 |
| 432 | Ga0501073_0137248 | 3300049589 | Bacteria | 1695 |
| 433 | Ga0501074_0035203 | 3300049590 | Bacteria | 3627 |
| 434 | Ga0501074_0087050 | 3300049590 | Bacteria | 2238 |
| 435 | Ga0501074_0107598 | 3300049590 | Bacteria | 1996 |
| 436 | Ga0501075_0000046 | 3300049591 | Bacteria | 50813 |
| 437 | Ga0501075_0012948 | 3300049591 | Bacteria | 5942 |
| 438 | Ga0501075_0017641 | 3300049591 | Bacteria | 5154 |
| 439 | Ga0501075_0019775 | 3300049591 | Bacteria | 4888 |
| 440 | Ga0501075_0046477 | 3300049591 | Bacteria | 3261 |
| 441 | Ga0501075_0489320 | 3300049591 | Bacteria | 938 |
| 442 | Ga0501076_0001789 | 3300049592 | Bacteria | 14574 |
| 443 | Ga0501076_0004704 | 3300049592 | Bacteria | 9737 |
| 444 | Ga0501076_0015921 | 3300049592 | Bacteria | 5690 |
| 445 | Ga0501076_0028921 | 3300049592 | Bacteria | 4307 |
| 446 | Ga0501076_0158177 | 3300049592 | Bacteria | 1845 |
| 447 | Ga0501076_0239379 | 3300049592 | Unclassified | 1485 |
| 448 | Ga0501076_0630981 | 3300049592 | Unclassified | 884 |
| 449 | Ga0501077_0006891 | 3300049593 | Bacteria | 6996 |
| 450 | Ga0501077_0051590 | 3300049593 | Bacteria | 2614 |
| 451 | Ga0501077_0102979 | 3300049593 | Bacteria | 1809 |
| 452 | Ga0501077_0163351 | 3300049593 | Bacteria | 1414 |
| 453 | Ga0501079_0006512 | 3300049741 | Bacteria | 8772 |
| 454 | Ga0501079_0042566 | 3300049741 | Bacteria | 3506 |
| 455 | Ga0501079_0183646 | 3300049741 | Bacteria | 1632 |
| 456 | Ga0501079_0529441 | 3300049741 | Bacteria | 926 |
| 457 | Ga0501080_0005893 | 3300049742 | Bacteria | 10976 |
| 458 | Ga0501080_0038280 | 3300049742 | Bacteria | 4478 |
| 459 | Ga0501081_0004168 | 3300049743 | Bacteria | 9273 |
| 460 | Ga0501081_0004833 | 3300049743 | Bacteria | 8659 |
| 461 | Ga0501081_0076684 | 3300049743 | Bacteria | 2334 |
| 462 | Ga0501081_0406326 | 3300049743 | Unclassified | 1008 |
| 463 | Ga0501083_0045645 | 3300049744 | Bacteria | 2964 |
| 464 | Ga0501083_0072854 | 3300049744 | Bacteria | 2283 |
| 465 | Ga0501083_0348217 | 3300049744 | Bacteria | 963 |
| 466 | Ga0501035_0115673 | 3300049822 | Bacteria | 2347 |
| 467 | Ga0501044_0200328 | 3300049823 | Bacteria | 1955 |
| 468 | Ga0501045_0000436 | 3300049824 | Bacteria | 25558 |
| 469 | Ga0501045_0012202 | 3300049824 | Bacteria | 6051 |
| 470 | Ga0501045_0075826 | 3300049824 | Bacteria | 2477 |
| 471 | Ga0501045_0084253 | 3300049824 | Bacteria | 2345 |
| 472 | nmdc:mga05p37_1059_c1 | 3300050507 | Bacteria | 31441 |
| 473 | nmdc:mga05p37_13652_c1 | 3300050507 | Bacteria | 9733 |
| 474 | nmdc:mga05p37_497013_c1 | 3300050507 | Bacteria | 1401 |
| 475 | nmdc:mga09592_40811_c1 | 3300050508 | Bacteria | 3900 |
| 476 | nmdc:mga09592_438_c1 | 3300050508 | Bacteria | 30676 |
| 477 | nmdc:mga09592_58099_c1 | 3300050508 | Bacteria | 3271 |
| 478 | nmdc:mga09592_61_c1 | 3300050508 | Bacteria | 60866 |
| 479 | nmdc:mga0qj67_12994_c1 | 3300050509 | Bacteria | 6284 |
| 480 | nmdc:mga0qj67_211797_c1 | 3300050509 | Bacteria | 1574 |
| 481 | nmdc:mga0qj67_278368_c1 | 3300050509 | Unclassified | 1356 |
| 482 | nmdc:mga0qj67_32877_c1 | 3300050509 | Bacteria | 4046 |
| 483 | nmdc:mga0qj67_87999_c1 | 3300050509 | Bacteria | 2494 |
| 484 | nmdc:mga06r32_1023920_c1 | 3300050510 | Bacteria | 778 |
| 485 | nmdc:mga06r32_146177_c1 | 3300050510 | Bacteria | 2341 |
| 486 | nmdc:mga06r32_540188_c1 | 3300050510 | Bacteria | 1140 |
| 487 | nmdc:mga06r32_542710_c1 | 3300050510 | Unclassified | 1137 |
| 488 | nmdc:mga06r32_5626_c1 | 3300050510 | Bacteria | 11272 |
| 489 | nmdc:mga06r32_633175_c1 | 3300050510 | Unclassified | 1039 |
| 490 | nmdc:mga06r32_83882_c1 | 3300050510 | Bacteria | 3105 |
| 491 | nmdc:mga08y16_149524_c1 | 3300050511 | Bacteria | 2428 |
| 492 | nmdc:mga08y16_2424_c1 | 3300050511 | Bacteria | 19158 |
| 493 | nmdc:mga08y16_29545_c1 | 3300050511 | Bacteria | 5774 |
| 494 | nmdc:mga08y16_298348_c1 | 3300050511 | Bacteria | 1661 |
| 495 | nmdc:mga08y16_49560_c1 | 3300050511 | Bacteria | 4396 |
| 496 | nmdc:mga08y16_588693_c1 | 3300050511 | Bacteria | 1122 |
| 497 | nmdc:mga08y16_77372_c1 | 3300050511 | Bacteria | 3469 |
| 498 | nmdc:mga0n895_116147_c1 | 3300050512 | Bacteria | 2695 |
| 499 | nmdc:mga0n895_16714_c1 | 3300050512 | Bacteria | 6741 |
| 500 | nmdc:mga0n895_231047_c1 | 3300050512 | Bacteria | 1877 |
| 501 | nmdc:mga0n895_24918_c1 | 3300050512 | Bacteria | 5645 |
| 502 | nmdc:mga0rr50_1080295_c1 | 3300050513 | Bacteria | 683 |
| 503 | nmdc:mga0rr50_115981_c1 | 3300050513 | Bacteria | 2126 |
| 504 | nmdc:mga0rr50_14657_c1 | 3300050513 | Bacteria | 5149 |
| 505 | nmdc:mga0rr50_323477_c1 | 3300050513 | Bacteria | 1293 |
| 506 | nmdc:mga0rr50_52459_c1 | 3300050513 | Bacteria | 3031 |
| 507 | nmdc:mga08x19_12881_c2 | 3300050514 | Bacteria | 4154 |
| 508 | nmdc:mga08x19_158475_c1 | 3300050514 | Bacteria | 1536 |
| 509 | nmdc:mga08x19_239057_c1 | 3300050514 | Bacteria | 1251 |
| 510 | nmdc:mga08x19_34762_c1 | 3300050514 | Bacteria | 3187 |
| 511 | nmdc:mga08x19_7002_c1 | 3300050514 | Bacteria | 6695 |
| 512 | nmdc:mga0a205_11673_c1 | 3300050515 | Bacteria | 8100 |
| 513 | nmdc:mga0a205_234755_c1 | 3300050515 | Bacteria | 1716 |
| 514 | nmdc:mga0a205_249616_c1 | 3300050515 | Bacteria | 1654 |
| 515 | nmdc:mga0a205_30448_c1 | 3300050515 | Bacteria | 5167 |
| 516 | nmdc:mga0a205_458679_c1 | 3300050515 | Bacteria | 1134 |
| 517 | Ga0495601_0049839 | 3300053077 | Bacteria | 2641 |
| 518 | Ga0495601_0172627 | 3300053077 | Bacteria | 1413 |
| 519 | Ga0495595_0174718 | 3300053084 | Bacteria | 1064 |
| 520 | Ga0501084_0006816 | 3300054114 | Bacteria | 9397 |
| 521 | Ga0501084_0012160 | 3300054114 | Bacteria | 7126 |
| 522 | Ga0501084_0108881 | 3300054114 | Bacteria | 2328 |
| 523 | Ga0501084_0125754 | 3300054114 | Bacteria | 2157 |
| 524 | Ga0501084_0197076 | 3300054114 | Bacteria | 1699 |
| 525 | Ga0590077_023352 | 3300059426 | Bacteria | 1323 |
| 526 | Ga0501082_0001259 | 3300060353 | Bacteria | 22237 |
| 527 | Ga0501082_0044906 | 3300060353 | Bacteria | 3811 |
| 528 | Ga0501082_0079044 | 3300060353 | Bacteria | 2837 |
| 529 | Ga0501082_0283137 | 3300060353 | Bacteria | 1443 |
| 530 | Ga0530510_0000342 | 3300061734 | Bacteria | 30062 |
| 531 | Ga0530510_0011848 | 3300061734 | Bacteria | 6119 |
| 532 | Ga0530510_0068286 | 3300061734 | Bacteria | 2578 |
| 533 | Ga0530510_0103922 | 3300061734 | Bacteria | 2078 |
| 534 | Ga0530510_0319153 | 3300061734 | Unclassified | 1164 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005545 | Ga0070695_100054298 | Ga0070695_1000542984 | 177 |
| 2 | 3300050513 | nmdc:mga0rr50_1080295_c1 | nmdc:mga0rr50_1080295_c1_64_669 | 177 |
| 3 | 3300005444 | Ga0070694_100039734 | Ga0070694_1000397341 | 178 |
| 4 | 3300050511 | nmdc:mga08y16_298348_c1 | nmdc:mga08y16_298348_c1_774_1445 | 187 |
| 5 | 3300045051 | Ga0451576_0286150 | Ga0451576_0286150_582_1253 | 188 |
| 6 | 3300009147 | Ga0114129_10107512 | Ga0114129_101075121 | 191 |
| 7 | 3300036401 | Ga0373937_0083131 | Ga0373937_0083131_1970_2569 | 191 |
| 8 | 3300046454 | Ga0495592_0043494 | Ga0495592_0043494_2373_2972 | 191 |
| 9 | 3300046461 | Ga0495641_0067585 | Ga0495641_0067585_46_645 | 191 |
| 10 | 3300046462 | Ga0495651_0320212 | Ga0495651_0320212_216_815 | 191 |
| 11 | 3300046463 | Ga0495653_0140416 | Ga0495653_0140416_133_732 | 191 |
| 12 | 3300046476 | Ga0495662_0020837 | Ga0495662_0020837_818_1417 | 191 |
| 13 | 3300046511 | Ga0495608_0000364 | Ga0495608_0000364_15258_15857 | 191 |
| 14 | 3300046514 | Ga0495618_0139754 | Ga0495618_0139754_383_982 | 191 |
| 15 | 3300046516 | Ga0495628_0176370 | Ga0495628_0176370_667_1266 | 191 |
| 16 | 3300046517 | Ga0495630_0079077 | Ga0495630_0079077_1305_1904 | 191 |
| 17 | 3300046526 | Ga0495666_0096783 | Ga0495666_0096783_597_1196 | 191 |
| 18 | 3300046529 | Ga0495652_0056357 | Ga0495652_0056357_2274_2873 | 191 |
| 19 | 3300046533 | Ga0495640_0019833 | Ga0495640_0019833_3487_4086 | 191 |
| 20 | 3300046535 | Ga0495586_0003547 | Ga0495586_0003547_4941_5540 | 191 |
| 21 | 3300046536 | Ga0495587_0128981 | Ga0495587_0128981_109_708 | 191 |
| 22 | 3300046543 | Ga0495645_0086923 | Ga0495645_0086923_23_622 | 191 |
| 23 | 3300046559 | Ga0495667_0052819 | Ga0495667_0052819_1305_1904 | 191 |
| 24 | 3300046642 | Ga0495634_0001971 | Ga0495634_0001971_15219_15818 | 191 |
| 25 | 3300046678 | Ga0495599_0051359 | Ga0495599_0051359_826_1425 | 191 |
| 26 | 3300046680 | Ga0495646_0208278 | Ga0495646_0208278_425_1024 | 191 |
| 27 | 3300046689 | Ga0495613_0067732 | Ga0495613_0067732_700_1299 | 191 |
| 28 | 3300046809 | Ga0495600_0039238 | Ga0495600_0039238_1903_2502 | 191 |
| 29 | 3300047317 | Ga0495604_0013831 | Ga0495604_0013831_849_1448 | 191 |
| 30 | 3300047322 | Ga0495680_0001489 | Ga0495680_0001489_4105_4704 | 191 |
| 31 | 3300047444 | Ga0495675_0113864 | Ga0495675_0113864_365_964 | 191 |
| 32 | 3300047471 | Ga0495684_0263694 | Ga0495684_0263694_464_1063 | 191 |
| 33 | 3300047673 | Ga0495593_0217692 | Ga0495593_0217692_136_735 | 191 |
| 34 | 3300050513 | nmdc:mga0rr50_115981_c1 | nmdc:mga0rr50_115981_c1_1268_1879 | 191 |
| 35 | 3300053077 | Ga0495601_0049839 | Ga0495601_0049839_1624_2223 | 191 |
| 36 | 3300053084 | Ga0495595_0174718 | Ga0495595_0174718_237_836 | 191 |
| 37 | 3300047315 | Ga0495581_0106471 | Ga0495581_0106471_920_1543 | 192 |
| 38 | 3300025932 | Ga0207690_11123967 | Ga0207690_111239671 | 193 |
| 39 | 3300006852 | Ga0075433_10189694 | Ga0075433_101896943 | 194 |
| 40 | 3300005518 | Ga0070699_100389461 | Ga0070699_1003894612 | 195 |
| 41 | 3300005536 | Ga0070697_100059500 | Ga0070697_1000595003 | 195 |
| 42 | 3300005840 | Ga0068870_10123249 | Ga0068870_101232492 | 195 |
| 43 | 3300013105 | Ga0157369_10935753 | Ga0157369_109357531 | 195 |
| 44 | 3300041997 | Ga0439431_0073621 | Ga0439431_0073621_287_886 | 195 |
| 45 | 3300042156 | Ga0439446_0015276 | Ga0439446_0015276_657_1256 | 195 |
| 46 | 3300042435 | Ga0439434_0011042 | Ga0439434_0011042_1705_2304 | 195 |
| 47 | 3300046454 | Ga0495592_0686251 | Ga0495592_0686251_11_601 | 195 |
| 48 | 3300049576 | Ga0501040_0188243 | Ga0501040_0188243_735_1349 | 195 |
| 49 | 3300049584 | Ga0501068_0074864 | Ga0501068_0074864_1105_1719 | 195 |
| 50 | 3300049587 | Ga0501071_0000800 | Ga0501071_0000800_8752_9366 | 195 |
| 51 | 3300049588 | Ga0501072_0052224 | Ga0501072_0052224_1243_1857 | 195 |
| 52 | 3300049591 | Ga0501075_0019775 | Ga0501075_0019775_3199_3813 | 195 |
| 53 | 3300049741 | Ga0501079_0529441 | Ga0501079_0529441_124_738 | 195 |
| 54 | 3300049742 | Ga0501080_0005893 | Ga0501080_0005893_1501_2115 | 195 |
| 55 | 3300049744 | Ga0501083_0348217 | Ga0501083_0348217_268_882 | 195 |
| 56 | 3300054114 | Ga0501084_0125754 | Ga0501084_0125754_1219_1833 | 195 |
| 57 | 3300061734 | Ga0530510_0103922 | Ga0530510_0103922_785_1399 | 195 |
| 58 | 3300006852 | Ga0075433_10478654 | Ga0075433_104786542 | 196 |
| 59 | 3300007076 | Ga0075435_100115056 | Ga0075435_1001150562 | 196 |
| 60 | 3300041512 | Ga0451853_0943965 | Ga0451853_0943965_58_708 | 196 |
| 61 | 3300045976 | Ga0466967_0010778 | Ga0466967_0010778_2942_3535 | 196 |
| 62 | 3300005546 | Ga0070696_100024432 | Ga0070696_1000244322 | 197 |
| 63 | 3300005549 | Ga0070704_100174028 | Ga0070704_1001740282 | 197 |
| 64 | 3300005549 | Ga0070704_100667767 | Ga0070704_1006677671 | 197 |
| 65 | 3300005614 | Ga0068856_100372430 | Ga0068856_1003724302 | 197 |
| 66 | 3300006844 | Ga0075428_100101766 | Ga0075428_1001017662 | 197 |
| 67 | 3300006846 | Ga0075430_100015801 | Ga0075430_1000158016 | 197 |
| 68 | 3300006847 | Ga0075431_100082409 | Ga0075431_1000824092 | 197 |
| 69 | 3300006852 | Ga0075433_10464557 | Ga0075433_104645571 | 197 |
| 70 | 3300006871 | Ga0075434_100000699 | Ga0075434_10000069918 | 197 |
| 71 | 3300006914 | Ga0075436_100024973 | Ga0075436_1000249735 | 197 |
| 72 | 3300007076 | Ga0075435_100010825 | Ga0075435_1000108257 | 197 |
| 73 | 3300009147 | Ga0114129_10307235 | Ga0114129_103072352 | 197 |
| 74 | 3300013297 | Ga0157378_10583665 | Ga0157378_105836651 | 197 |
| 75 | 3300042876 | Ga0451577_0163381 | Ga0451577_0163381_579_1217 | 197 |
| 76 | 3300049593 | Ga0501077_0102979 | Ga0501077_0102979_520_1128 | 197 |
| 77 | 3300050507 | nmdc:mga05p37_497013_c1 | nmdc:mga05p37_497013_c1_669_1271 | 197 |
| 78 | 3300050509 | nmdc:mga0qj67_32877_c1 | nmdc:mga0qj67_32877_c1_1875_2519 | 197 |
| 79 | 3300050510 | nmdc:mga06r32_1023920_c1 | nmdc:mga06r32_1023920_c1_154_756 | 197 |
| 80 | 3300050510 | nmdc:mga06r32_540188_c1 | nmdc:mga06r32_540188_c1_321_965 | 197 |
| 81 | 3300050512 | nmdc:mga0n895_16714_c1 | nmdc:mga0n895_16714_c1_4259_4879 | 197 |
| 82 | 3300050513 | nmdc:mga0rr50_14657_c1 | nmdc:mga0rr50_14657_c1_503_1123 | 197 |
| 83 | 3300050514 | nmdc:mga08x19_12881_c2 | nmdc:mga08x19_12881_c2_2230_2850 | 197 |
| 84 | 3300050515 | nmdc:mga0a205_249616_c1 | nmdc:mga0a205_249616_c1_513_1151 | 197 |
| 85 | 3300050515 | nmdc:mga0a205_458679_c1 | nmdc:mga0a205_458679_c1_371_991 | 197 |
| 86 | 3300005439 | Ga0070711_100191545 | Ga0070711_1001915453 | 198 |
| 87 | 3300005440 | Ga0070705_100492267 | Ga0070705_1004922672 | 198 |
| 88 | 3300005549 | Ga0070704_100246963 | Ga0070704_1002469633 | 198 |
| 89 | 3300006871 | Ga0075434_100009949 | Ga0075434_1000099499 | 198 |
| 90 | 3300025905 | Ga0207685_10032306 | Ga0207685_100323062 | 198 |
| 91 | 3300025936 | Ga0207670_10120864 | Ga0207670_101208643 | 198 |
| 92 | 3300027360 | Ga0209969_1003311 | Ga0209969_10033112 | 198 |
| 93 | 3300027364 | Ga0209967_1002463 | Ga0209967_10024632 | 198 |
| 94 | 3300027462 | Ga0210000_1000637 | Ga0210000_10006375 | 198 |
| 95 | 3300027471 | Ga0209995_1006752 | Ga0209995_10067522 | 198 |
| 96 | 3300031731 | Ga0307405_10427294 | Ga0307405_104272942 | 198 |
| 97 | 3300032002 | Ga0307416_100334676 | Ga0307416_1003346763 | 198 |
| 98 | 3300046536 | Ga0495587_0424474 | Ga0495587_0424474_83_697 | 198 |
| 99 | 3300047322 | Ga0495680_0507006 | Ga0495680_0507006_173_787 | 198 |
| 100 | 3300050512 | nmdc:mga0n895_116147_c1 | nmdc:mga0n895_116147_c1_1878_2519 | 198 |
| 101 | 3300050514 | nmdc:mga08x19_239057_c1 | nmdc:mga08x19_239057_c1_162_803 | 198 |
| 102 | 3300005444 | Ga0070694_100208925 | Ga0070694_1002089252 | 199 |
| 103 | 3300005471 | Ga0070698_100007519 | Ga0070698_1000075198 | 199 |
| 104 | 3300006844 | Ga0075428_100169561 | Ga0075428_1001695612 | 199 |
| 105 | 3300006847 | Ga0075431_100392373 | Ga0075431_1003923732 | 199 |
| 106 | 3300006852 | Ga0075433_10648746 | Ga0075433_106487462 | 199 |
| 107 | 3300006880 | Ga0075429_100000271 | Ga0075429_10000027124 | 199 |
| 108 | 3300009147 | Ga0114129_10006193 | Ga0114129_1000619321 | 199 |
| 109 | 3300009148 | Ga0105243_10235245 | Ga0105243_102352452 | 199 |
| 110 | 3300025916 | Ga0207663_10098707 | Ga0207663_100987072 | 199 |
| 111 | 3300050507 | nmdc:mga05p37_1059_c1 | nmdc:mga05p37_1059_c1_15422_16033 | 199 |
| 112 | 3300050508 | nmdc:mga09592_61_c1 | nmdc:mga09592_61_c1_16896_17507 | 199 |
| 113 | 3300050510 | nmdc:mga06r32_5626_c1 | nmdc:mga06r32_5626_c1_3654_4265 | 199 |
| 114 | 3300005354 | Ga0070675_100578795 | Ga0070675_1005787952 | 200 |
| 115 | 3300005440 | Ga0070705_100220098 | Ga0070705_1002200981 | 200 |
| 116 | 3300005441 | Ga0070700_100512562 | Ga0070700_1005125622 | 200 |
| 117 | 3300005458 | Ga0070681_10000790 | Ga0070681_100007907 | 200 |
| 118 | 3300005468 | Ga0070707_101189057 | Ga0070707_1011890571 | 200 |
| 119 | 3300005518 | Ga0070699_100574523 | Ga0070699_1005745232 | 200 |
| 120 | 3300005530 | Ga0070679_100176348 | Ga0070679_1001763482 | 200 |
| 121 | 3300005535 | Ga0070684_100921956 | Ga0070684_1009219561 | 200 |
| 122 | 3300005545 | Ga0070695_100090283 | Ga0070695_1000902834 | 200 |
| 123 | 3300005617 | Ga0068859_100014168 | Ga0068859_1000141684 | 200 |
| 124 | 3300005617 | Ga0068859_100455188 | Ga0068859_1004551881 | 200 |
| 125 | 3300005841 | Ga0068863_100843831 | Ga0068863_1008438312 | 200 |
| 126 | 3300006846 | Ga0075430_100473318 | Ga0075430_1004733182 | 200 |
| 127 | 3300006847 | Ga0075431_100179112 | Ga0075431_1001791122 | 200 |
| 128 | 3300006847 | Ga0075431_100393998 | Ga0075431_1003939982 | 200 |
| 129 | 3300006852 | Ga0075433_10272233 | Ga0075433_102722332 | 200 |
| 130 | 3300006871 | Ga0075434_101206552 | Ga0075434_1012065522 | 200 |
| 131 | 3300006931 | Ga0097620_100014167 | Ga0097620_1000141674 | 200 |
| 132 | 3300006931 | Ga0097620_100455185 | Ga0097620_1004551851 | 200 |
| 133 | 3300009094 | Ga0111539_10032731 | Ga0111539_100327313 | 200 |
| 134 | 3300009094 | Ga0111539_10080149 | Ga0111539_100801494 | 200 |
| 135 | 3300009148 | Ga0105243_10302391 | Ga0105243_103023912 | 200 |
| 136 | 3300009553 | Ga0105249_10602609 | Ga0105249_106026091 | 200 |
| 137 | 3300025912 | Ga0207707_10042871 | Ga0207707_100428713 | 200 |
| 138 | 3300025917 | Ga0207660_10032377 | Ga0207660_100323773 | 200 |
| 139 | 3300025921 | Ga0207652_10257707 | Ga0207652_102577072 | 200 |
| 140 | 3300025961 | Ga0207712_10335397 | Ga0207712_103353971 | 200 |
| 141 | 3300026075 | Ga0207708_10589878 | Ga0207708_105898782 | 200 |
| 142 | 3300026088 | Ga0207641_10302303 | Ga0207641_103023032 | 200 |
| 143 | 3300026095 | Ga0207676_10125498 | Ga0207676_101254982 | 200 |
| 144 | 3300026116 | Ga0207674_10544912 | Ga0207674_105449122 | 200 |
| 145 | 3300026118 | Ga0207675_100661068 | Ga0207675_1006610682 | 200 |
| 146 | 3300027907 | Ga0207428_10136244 | Ga0207428_101362441 | 200 |
| 147 | 3300035115 | Ga0373941_0003835 | Ga0373941_0003835_698_1306 | 200 |
| 148 | 3300035121 | Ga0373960_0029353 | Ga0373960_0029353_806_1414 | 200 |
| 149 | 3300035691 | Ga0373931_0046606 | Ga0373931_0046606_704_1312 | 200 |
| 150 | 3300035691 | Ga0373931_0602623 | Ga0373931_0602623_64_687 | 200 |
| 151 | 3300037471 | Ga0395905_0660260 | Ga0395905_0660260_281_889 | 200 |
| 152 | 3300045051 | Ga0451576_0100294 | Ga0451576_0100294_1763_2377 | 200 |
| 153 | 3300046459 | Ga0495629_0204425 | Ga0495629_0204425_335_985 | 200 |
| 154 | 3300046476 | Ga0495662_0022123 | Ga0495662_0022123_2021_2671 | 200 |
| 155 | 3300046517 | Ga0495630_0016353 | Ga0495630_0016353_1855_2505 | 200 |
| 156 | 3300046529 | Ga0495652_0341266 | Ga0495652_0341266_397_1047 | 200 |
| 157 | 3300046539 | Ga0495621_0064635 | Ga0495621_0064635_166_774 | 200 |
| 158 | 3300046663 | Ga0495635_0031920 | Ga0495635_0031920_1010_1660 | 200 |
| 159 | 3300046690 | Ga0495624_0040123 | Ga0495624_0040123_737_1387 | 200 |
| 160 | 3300047317 | Ga0495604_0099264 | Ga0495604_0099264_645_1295 | 200 |
| 161 | 3300049568 | Ga0501031_0045363 | Ga0501031_0045363_442_1056 | 200 |
| 162 | 3300049570 | Ga0501033_0006772 | Ga0501033_0006772_7387_8001 | 200 |
| 163 | 3300049571 | Ga0501034_0327001 | Ga0501034_0327001_453_1067 | 200 |
| 164 | 3300049572 | Ga0501036_0001519 | Ga0501036_0001519_15931_16545 | 200 |
| 165 | 3300049573 | Ga0501037_0035564 | Ga0501037_0035564_895_1509 | 200 |
| 166 | 3300049574 | Ga0501038_0001082 | Ga0501038_0001082_20086_20700 | 200 |
| 167 | 3300049575 | Ga0501039_0000168 | Ga0501039_0000168_21881_22495 | 200 |
| 168 | 3300049576 | Ga0501040_0005928 | Ga0501040_0005928_35_649 | 200 |
| 169 | 3300049577 | Ga0501041_0003011 | Ga0501041_0003011_7369_7983 | 200 |
| 170 | 3300049578 | Ga0501042_0013075 | Ga0501042_0013075_3984_4598 | 200 |
| 171 | 3300049579 | Ga0501043_0135365 | Ga0501043_0135365_926_1540 | 200 |
| 172 | 3300049580 | Ga0501046_0000501 | Ga0501046_0000501_38066_38680 | 200 |
| 173 | 3300049581 | Ga0501047_0158316 | Ga0501047_0158316_510_1124 | 200 |
| 174 | 3300049582 | Ga0501048_0071002 | Ga0501048_0071002_748_1362 | 200 |
| 175 | 3300049583 | Ga0501067_0017198 | Ga0501067_0017198_3287_3895 | 200 |
| 176 | 3300049584 | Ga0501068_0010587 | Ga0501068_0010587_2659_3273 | 200 |
| 177 | 3300049587 | Ga0501071_0016723 | Ga0501071_0016723_4237_4851 | 200 |
| 178 | 3300049588 | Ga0501072_0002835 | Ga0501072_0002835_7228_7842 | 200 |
| 179 | 3300049588 | Ga0501072_0064490 | Ga0501072_0064490_1460_2080 | 200 |
| 180 | 3300049590 | Ga0501074_0035203 | Ga0501074_0035203_2138_2752 | 200 |
| 181 | 3300049591 | Ga0501075_0000046 | Ga0501075_0000046_23441_24055 | 200 |
| 182 | 3300049592 | Ga0501076_0004704 | Ga0501076_0004704_1857_2471 | 200 |
| 183 | 3300049592 | Ga0501076_0239379 | Ga0501076_0239379_575_1195 | 200 |
| 184 | 3300049593 | Ga0501077_0006891 | Ga0501077_0006891_427_1041 | 200 |
| 185 | 3300049741 | Ga0501079_0006512 | Ga0501079_0006512_7259_7873 | 200 |
| 186 | 3300049742 | Ga0501080_0038280 | Ga0501080_0038280_902_1516 | 200 |
| 187 | 3300049743 | Ga0501081_0004833 | Ga0501081_0004833_8006_8620 | 200 |
| 188 | 3300049743 | Ga0501081_0406326 | Ga0501081_0406326_111_731 | 200 |
| 189 | 3300049744 | Ga0501083_0072854 | Ga0501083_0072854_889_1503 | 200 |
| 190 | 3300049822 | Ga0501035_0115673 | Ga0501035_0115673_616_1230 | 200 |
| 191 | 3300049823 | Ga0501044_0200328 | Ga0501044_0200328_1303_1917 | 200 |
| 192 | 3300049824 | Ga0501045_0000436 | Ga0501045_0000436_13165_13779 | 200 |
| 193 | 3300050508 | nmdc:mga09592_58099_c1 | nmdc:mga09592_58099_c1_370_1020 | 200 |
| 194 | 3300050509 | nmdc:mga0qj67_211797_c1 | nmdc:mga0qj67_211797_c1_19_624 | 200 |
| 195 | 3300050510 | nmdc:mga06r32_83882_c1 | nmdc:mga06r32_83882_c1_862_1476 | 200 |
| 196 | 3300050511 | nmdc:mga08y16_29545_c1 | nmdc:mga08y16_29545_c1_4190_4840 | 200 |
| 197 | 3300050513 | nmdc:mga0rr50_323477_c1 | nmdc:mga0rr50_323477_c1_623_1237 | 200 |
| 198 | 3300050515 | nmdc:mga0a205_234755_c1 | nmdc:mga0a205_234755_c1_748_1395 | 200 |
| 199 | 3300053077 | Ga0495601_0172627 | Ga0495601_0172627_167_817 | 200 |
| 200 | 3300054114 | Ga0501084_0006816 | Ga0501084_0006816_8115_8729 | 200 |
| 201 | 3300060353 | Ga0501082_0001259 | Ga0501082_0001259_852_1466 | 200 |
| 202 | 3300061734 | Ga0530510_0011848 | Ga0530510_0011848_3846_4460 | 200 |
| 203 | 3300005330 | Ga0070690_100000148 | Ga0070690_10000014813 | 201 |
| 204 | 3300005334 | Ga0068869_100000103 | Ga0068869_10000010322 | 201 |
| 205 | 3300005340 | Ga0070689_100001211 | Ga0070689_10000121114 | 201 |
| 206 | 3300005340 | Ga0070689_100466408 | Ga0070689_1004664082 | 201 |
| 207 | 3300005343 | Ga0070687_100000105 | Ga0070687_10000010516 | 201 |
| 208 | 3300005343 | Ga0070687_100257175 | Ga0070687_1002571752 | 201 |
| 209 | 3300005343 | Ga0070687_100744990 | Ga0070687_1007449901 | 201 |
| 210 | 3300005345 | Ga0070692_10002047 | Ga0070692_100020473 | 201 |
| 211 | 3300005438 | Ga0070701_10004680 | Ga0070701_100046805 | 201 |
| 212 | 3300005545 | Ga0070695_100000259 | Ga0070695_10000025910 | 201 |
| 213 | 3300005545 | Ga0070695_100107288 | Ga0070695_1001072882 | 201 |
| 214 | 3300005547 | Ga0070693_100000101 | Ga0070693_10000010114 | 201 |
| 215 | 3300005547 | Ga0070693_100126323 | Ga0070693_1001263232 | 201 |
| 216 | 3300005563 | Ga0068855_100001986 | Ga0068855_10000198618 | 201 |
| 217 | 3300005578 | Ga0068854_100020898 | Ga0068854_1000208984 | 201 |
| 218 | 3300005614 | Ga0068856_100034678 | Ga0068856_1000346782 | 201 |
| 219 | 3300005615 | Ga0070702_100174272 | Ga0070702_1001742722 | 201 |
| 220 | 3300005617 | Ga0068859_100004200 | Ga0068859_1000042002 | 201 |
| 221 | 3300005719 | Ga0068861_100000826 | Ga0068861_10000082618 | 201 |
| 222 | 3300005840 | Ga0068870_10178142 | Ga0068870_101781422 | 201 |
| 223 | 3300005841 | Ga0068863_100223527 | Ga0068863_1002235272 | 201 |
| 224 | 3300005842 | Ga0068858_100002013 | Ga0068858_1000020134 | 201 |
| 225 | 3300005843 | Ga0068860_100001309 | Ga0068860_10000130916 | 201 |
| 226 | 3300005843 | Ga0068860_100088352 | Ga0068860_1000883523 | 201 |
| 227 | 3300005844 | Ga0068862_100033569 | Ga0068862_1000335693 | 201 |
| 228 | 3300006237 | Ga0097621_100000106 | Ga0097621_10000010617 | 201 |
| 229 | 3300006358 | Ga0068871_100016457 | Ga0068871_1000164574 | 201 |
| 230 | 3300006844 | Ga0075428_100000134 | Ga0075428_10000013429 | 201 |
| 231 | 3300006852 | Ga0075433_10009655 | Ga0075433_100096553 | 201 |
| 232 | 3300006871 | Ga0075434_100000593 | Ga0075434_10000059329 | 201 |
| 233 | 3300006880 | Ga0075429_100000955 | Ga0075429_1000009554 | 201 |
| 234 | 3300006881 | Ga0068865_100000231 | Ga0068865_10000023111 | 201 |
| 235 | 3300006914 | Ga0075436_100007710 | Ga0075436_1000077103 | 201 |
| 236 | 3300006931 | Ga0097620_100004200 | Ga0097620_1000042002 | 201 |
| 237 | 3300006931 | Ga0097620_100149062 | Ga0097620_1001490623 | 201 |
| 238 | 3300007076 | Ga0075435_100077188 | Ga0075435_1000771883 | 201 |
| 239 | 3300009092 | Ga0105250_10032592 | Ga0105250_100325923 | 201 |
| 240 | 3300009094 | Ga0111539_10063590 | Ga0111539_100635903 | 201 |
| 241 | 3300009094 | Ga0111539_10186410 | Ga0111539_101864103 | 201 |
| 242 | 3300009094 | Ga0111539_10349193 | Ga0111539_103491931 | 201 |
| 243 | 3300009098 | Ga0105245_10000347 | Ga0105245_1000034720 | 201 |
| 244 | 3300009098 | Ga0105245_10168628 | Ga0105245_101686282 | 201 |
| 245 | 3300009101 | Ga0105247_10467247 | Ga0105247_104672471 | 201 |
| 246 | 3300009147 | Ga0114129_10023204 | Ga0114129_100232044 | 201 |
| 247 | 3300009148 | Ga0105243_10000535 | Ga0105243_1000053525 | 201 |
| 248 | 3300009174 | Ga0105241_10241263 | Ga0105241_102412632 | 201 |
| 249 | 3300009176 | Ga0105242_10000905 | Ga0105242_100009057 | 201 |
| 250 | 3300009176 | Ga0105242_10001418 | Ga0105242_1000141817 | 201 |
| 251 | 3300009177 | Ga0105248_10221641 | Ga0105248_102216413 | 201 |
| 252 | 3300009553 | Ga0105249_10001515 | Ga0105249_100015154 | 201 |
| 253 | 3300010375 | Ga0105239_10647571 | Ga0105239_106475712 | 201 |
| 254 | 3300011119 | Ga0105246_10129300 | Ga0105246_101293001 | 201 |
| 255 | 3300013297 | Ga0157378_10000447 | Ga0157378_1000044719 | 201 |
| 256 | 3300014326 | Ga0157380_10320089 | Ga0157380_103200892 | 201 |
| 257 | 3300014745 | Ga0157377_10072821 | Ga0157377_100728212 | 201 |
| 258 | 3300014745 | Ga0157377_10385433 | Ga0157377_103854331 | 201 |
| 259 | 3300014968 | Ga0157379_10728039 | Ga0157379_107280391 | 201 |
| 260 | 3300014969 | Ga0157376_10033483 | Ga0157376_100334832 | 201 |
| 261 | 3300025885 | Ga0207653_10018261 | Ga0207653_100182612 | 201 |
| 262 | 3300025899 | Ga0207642_10007904 | Ga0207642_100079043 | 201 |
| 263 | 3300025908 | Ga0207643_10162223 | Ga0207643_101622232 | 201 |
| 264 | 3300025912 | Ga0207707_10068136 | Ga0207707_100681363 | 201 |
| 265 | 3300025917 | Ga0207660_10003601 | Ga0207660_100036017 | 201 |
| 266 | 3300025918 | Ga0207662_10000109 | Ga0207662_1000010911 | 201 |
| 267 | 3300025921 | Ga0207652_10107500 | Ga0207652_101075002 | 201 |
| 268 | 3300025926 | Ga0207659_10097882 | Ga0207659_100978822 | 201 |
| 269 | 3300025927 | Ga0207687_10001220 | Ga0207687_1000122010 | 201 |
| 270 | 3300025931 | Ga0207644_10389081 | Ga0207644_103890812 | 201 |
| 271 | 3300025933 | Ga0207706_10287129 | Ga0207706_102871291 | 201 |
| 272 | 3300025934 | Ga0207686_10003414 | Ga0207686_100034147 | 201 |
| 273 | 3300025935 | Ga0207709_10001794 | Ga0207709_100017944 | 201 |
| 274 | 3300025936 | Ga0207670_10026770 | Ga0207670_100267704 | 201 |
| 275 | 3300025936 | Ga0207670_10684354 | Ga0207670_106843541 | 201 |
| 276 | 3300025938 | Ga0207704_10001838 | Ga0207704_100018383 | 201 |
| 277 | 3300025941 | Ga0207711_10124004 | Ga0207711_101240041 | 201 |
| 278 | 3300025942 | Ga0207689_10000532 | Ga0207689_1000053216 | 201 |
| 279 | 3300025949 | Ga0207667_10053712 | Ga0207667_100537124 | 201 |
| 280 | 3300025961 | Ga0207712_10002829 | Ga0207712_100028294 | 201 |
| 281 | 3300025981 | Ga0207640_10048593 | Ga0207640_100485933 | 201 |
| 282 | 3300026023 | Ga0207677_10002506 | Ga0207677_100025063 | 201 |
| 283 | 3300026035 | Ga0207703_10011836 | Ga0207703_100118363 | 201 |
| 284 | 3300026075 | Ga0207708_10000712 | Ga0207708_100007123 | 201 |
| 285 | 3300026078 | Ga0207702_10006394 | Ga0207702_100063944 | 201 |
| 286 | 3300026088 | Ga0207641_10342461 | Ga0207641_103424612 | 201 |
| 287 | 3300026089 | Ga0207648_10000505 | Ga0207648_1000050521 | 201 |
| 288 | 3300026118 | Ga0207675_100000625 | Ga0207675_10000062535 | 201 |
| 289 | 3300026118 | Ga0207675_101095812 | Ga0207675_1010958121 | 201 |
| 290 | 3300026142 | Ga0207698_10576904 | Ga0207698_105769042 | 201 |
| 291 | 3300027907 | Ga0207428_10006818 | Ga0207428_100068184 | 201 |
| 292 | 3300027907 | Ga0207428_10407639 | Ga0207428_104076391 | 201 |
| 293 | 3300028380 | Ga0268265_10003684 | Ga0268265_100036848 | 201 |
| 294 | 3300028381 | Ga0268264_10004078 | Ga0268264_100040786 | 201 |
| 295 | 3300028381 | Ga0268264_10314235 | Ga0268264_103142352 | 201 |
| 296 | 3300031995 | Ga0307409_100395095 | Ga0307409_1003950953 | 201 |
| 297 | 3300032005 | Ga0307411_10055576 | Ga0307411_100555762 | 201 |
| 298 | 3300034816 | Ga0373930_0007408 | Ga0373930_0007408_333_956 | 201 |
| 299 | 3300034817 | Ga0373948_0000598 | Ga0373948_0000598_836_1459 | 201 |
| 300 | 3300034817 | Ga0373948_0027773 | Ga0373948_0027773_299_922 | 201 |
| 301 | 3300035084 | Ga0373928_0004346 | Ga0373928_0004346_1047_1670 | 201 |
| 302 | 3300035088 | Ga0373940_0009465 | Ga0373940_0009465_303_926 | 201 |
| 303 | 3300035090 | Ga0373949_0005757 | Ga0373949_0005757_1346_1969 | 201 |
| 304 | 3300035091 | Ga0373951_0028316 | Ga0373951_0028316_33_656 | 201 |
| 305 | 3300035112 | Ga0373932_0006499 | Ga0373932_0006499_1020_1643 | 201 |
| 306 | 3300035113 | Ga0373936_0013970 | Ga0373936_0013970_281_931 | 201 |
| 307 | 3300035114 | Ga0373939_0001027 | Ga0373939_0001027_1064_1687 | 201 |
| 308 | 3300035116 | Ga0373945_0003206 | Ga0373945_0003206_1292_1942 | 201 |
| 309 | 3300035118 | Ga0373954_0054081 | Ga0373954_0054081_735_1355 | 201 |
| 310 | 3300035119 | Ga0373956_0086693 | Ga0373956_0086693_52_672 | 201 |
| 311 | 3300035121 | Ga0373960_0041752 | Ga0373960_0041752_163_786 | 201 |
| 312 | 3300035170 | Ga0373943_0005804 | Ga0373943_0005804_3933_4583 | 201 |
| 313 | 3300035171 | Ga0373946_0003055 | Ga0373946_0003055_4301_4951 | 201 |
| 314 | 3300035172 | Ga0373955_0365428 | Ga0373955_0365428_178_828 | 201 |
| 315 | 3300035242 | Ga0373962_0007763 | Ga0373962_0007763_160_783 | 201 |
| 316 | 3300035410 | Ga0373924_0002459 | Ga0373924_0002459_1529_2206 | 201 |
| 317 | 3300035691 | Ga0373931_0000483 | Ga0373931_0000483_9202_9825 | 201 |
| 318 | 3300035691 | Ga0373931_0023496 | Ga0373931_0023496_1865_2488 | 201 |
| 319 | 3300035692 | Ga0373935_0010422 | Ga0373935_0010422_2126_2776 | 201 |
| 320 | 3300035695 | Ga0373927_0053308 | Ga0373927_0053308_888_1538 | 201 |
| 321 | 3300035724 | Ga0373933_0046950 | Ga0373933_0046950_230_850 | 201 |
| 322 | 3300035725 | Ga0373947_0359373 | Ga0373947_0359373_320_943 | 201 |
| 323 | 3300036401 | Ga0373937_0001839 | Ga0373937_0001839_3556_4233 | 201 |
| 324 | 3300037068 | Ga0373925_0115925 | Ga0373925_0115925_335_985 | 201 |
| 325 | 3300042435 | Ga0439434_0159997 | Ga0439434_0159997_87_704 | 201 |
| 326 | 3300042876 | Ga0451577_0149623 | Ga0451577_0149623_1235_1858 | 201 |
| 327 | 3300045051 | Ga0451576_0004079 | Ga0451576_0004079_3655_4278 | 201 |
| 328 | 3300045051 | Ga0451576_0035246 | Ga0451576_0035246_939_1562 | 201 |
| 329 | 3300045051 | Ga0451576_0240475 | Ga0451576_0240475_40_666 | 201 |
| 330 | 3300045051 | Ga0451576_0351779 | Ga0451576_0351779_13_636 | 201 |
| 331 | 3300046455 | Ga0495603_0013227 | Ga0495603_0013227_3821_4471 | 201 |
| 332 | 3300046472 | Ga0495580_0112413 | Ga0495580_0112413_1087_1737 | 201 |
| 333 | 3300046475 | Ga0495639_0009054 | Ga0495639_0009054_2780_3430 | 201 |
| 334 | 3300046517 | Ga0495630_0336884 | Ga0495630_0336884_473_1123 | 201 |
| 335 | 3300046526 | Ga0495666_0021756 | Ga0495666_0021756_577_1227 | 201 |
| 336 | 3300046529 | Ga0495652_0188574 | Ga0495652_0188574_149_826 | 201 |
| 337 | 3300046535 | Ga0495586_0011068 | Ga0495586_0011068_3663_4313 | 201 |
| 338 | 3300046537 | Ga0495598_0023632 | Ga0495598_0023632_142_756 | 201 |
| 339 | 3300046559 | Ga0495667_0038999 | Ga0495667_0038999_123_743 | 201 |
| 340 | 3300046615 | Ga0495656_0023166 | Ga0495656_0023166_1498_2112 | 201 |
| 341 | 3300046681 | Ga0495647_0013125 | Ga0495647_0013125_1261_1911 | 201 |
| 342 | 3300046683 | Ga0495658_0014162 | Ga0495658_0014162_1491_2141 | 201 |
| 343 | 3300047321 | Ga0495676_0039942 | Ga0495676_0039942_510_1160 | 201 |
| 344 | 3300049576 | Ga0501040_0436371 | Ga0501040_0436371_13_654 | 201 |
| 345 | 3300050507 | nmdc:mga05p37_13652_c1 | nmdc:mga05p37_13652_c1_5315_5938 | 201 |
| 346 | 3300050508 | nmdc:mga09592_438_c1 | nmdc:mga09592_438_c1_24780_25403 | 201 |
| 347 | 3300050510 | nmdc:mga06r32_542710_c1 | nmdc:mga06r32_542710_c1_427_1041 | 201 |
| 348 | 3300050511 | nmdc:mga08y16_149524_c1 | nmdc:mga08y16_149524_c1_591_1226 | 201 |
| 349 | 3300050511 | nmdc:mga08y16_2424_c1 | nmdc:mga08y16_2424_c1_16484_17107 | 201 |
| 350 | 3300050511 | nmdc:mga08y16_588693_c1 | nmdc:mga08y16_588693_c1_484_1110 | 201 |
| 351 | 3300050512 | nmdc:mga0n895_231047_c1 | nmdc:mga0n895_231047_c1_460_1083 | 201 |
| 352 | 3300050512 | nmdc:mga0n895_24918_c1 | nmdc:mga0n895_24918_c1_1265_1900 | 201 |
| 353 | 3300050514 | nmdc:mga08x19_34762_c1 | nmdc:mga08x19_34762_c1_2528_3148 | 201 |
| 354 | 3300050515 | nmdc:mga0a205_11673_c1 | nmdc:mga0a205_11673_c1_1357_1992 | 201 |
| 355 | 3300005330 | Ga0070690_100102933 | Ga0070690_1001029332 | 202 |
| 356 | 3300005336 | Ga0070680_100252946 | Ga0070680_1002529461 | 202 |
| 357 | 3300005467 | Ga0070706_100181005 | Ga0070706_1001810053 | 202 |
| 358 | 3300005518 | Ga0070699_100084515 | Ga0070699_1000845152 | 202 |
| 359 | 3300005535 | Ga0070684_100307192 | Ga0070684_1003071922 | 202 |
| 360 | 3300005536 | Ga0070697_100072789 | Ga0070697_1000727895 | 202 |
| 361 | 3300005545 | Ga0070695_100011635 | Ga0070695_1000116354 | 202 |
| 362 | 3300005546 | Ga0070696_100020737 | Ga0070696_1000207378 | 202 |
| 363 | 3300006237 | Ga0097621_100029641 | Ga0097621_1000296413 | 202 |
| 364 | 3300006358 | Ga0068871_100018352 | Ga0068871_1000183526 | 202 |
| 365 | 3300006914 | Ga0075436_100003269 | Ga0075436_10000326910 | 202 |
| 366 | 3300006914 | Ga0075436_100007082 | Ga0075436_1000070826 | 202 |
| 367 | 3300007076 | Ga0075435_100135489 | Ga0075435_1001354894 | 202 |
| 368 | 3300025910 | Ga0207684_10110876 | Ga0207684_101108763 | 202 |
| 369 | 3300025918 | Ga0207662_10146942 | Ga0207662_101469423 | 202 |
| 370 | 3300025936 | Ga0207670_10290899 | Ga0207670_102908991 | 202 |
| 371 | 3300025944 | Ga0207661_10085851 | Ga0207661_100858514 | 202 |
| 372 | 3300045051 | Ga0451576_0515641 | Ga0451576_0515641_490_1110 | 202 |
| 373 | 3300046525 | Ga0495663_0054832 | Ga0495663_0054832_586_1197 | 202 |
| 374 | 3300046528 | Ga0495642_0262036 | Ga0495642_0262036_60_671 | 202 |
| 375 | 3300046684 | Ga0495669_0002704 | Ga0495669_0002704_3199_3810 | 202 |
| 376 | 3300046684 | Ga0495669_0210245 | Ga0495669_0210245_117_737 | 202 |
| 377 | 3300049572 | Ga0501036_0090031 | Ga0501036_0090031_1455_2084 | 202 |
| 378 | 3300049573 | Ga0501037_0431657 | Ga0501037_0431657_153_773 | 202 |
| 379 | 3300049575 | Ga0501039_0074536 | Ga0501039_0074536_624_1253 | 202 |
| 380 | 3300049577 | Ga0501041_0052131 | Ga0501041_0052131_595_1224 | 202 |
| 381 | 3300049578 | Ga0501042_0202132 | Ga0501042_0202132_95_724 | 202 |
| 382 | 3300049579 | Ga0501043_0101630 | Ga0501043_0101630_372_1001 | 202 |
| 383 | 3300049582 | Ga0501048_0117901 | Ga0501048_0117901_665_1294 | 202 |
| 384 | 3300049587 | Ga0501071_0076987 | Ga0501071_0076987_1017_1646 | 202 |
| 385 | 3300049587 | Ga0501071_0219580 | Ga0501071_0219580_41_661 | 202 |
| 386 | 3300049588 | Ga0501072_0016776 | Ga0501072_0016776_3775_4404 | 202 |
| 387 | 3300049589 | Ga0501073_0137248 | Ga0501073_0137248_34_663 | 202 |
| 388 | 3300049590 | Ga0501074_0087050 | Ga0501074_0087050_932_1561 | 202 |
| 389 | 3300049591 | Ga0501075_0012948 | Ga0501075_0012948_1167_1796 | 202 |
| 390 | 3300049591 | Ga0501075_0046477 | Ga0501075_0046477_954_1574 | 202 |
| 391 | 3300049592 | Ga0501076_0015921 | Ga0501076_0015921_2066_2695 | 202 |
| 392 | 3300049592 | Ga0501076_0028921 | Ga0501076_0028921_2890_3510 | 202 |
| 393 | 3300049593 | Ga0501077_0051590 | Ga0501077_0051590_1105_1734 | 202 |
| 394 | 3300049593 | Ga0501077_0163351 | Ga0501077_0163351_274_894 | 202 |
| 395 | 3300049741 | Ga0501079_0042566 | Ga0501079_0042566_1101_1730 | 202 |
| 396 | 3300049743 | Ga0501081_0004168 | Ga0501081_0004168_963_1583 | 202 |
| 397 | 3300049744 | Ga0501083_0045645 | Ga0501083_0045645_947_1576 | 202 |
| 398 | 3300049824 | Ga0501045_0012202 | Ga0501045_0012202_5077_5706 | 202 |
| 399 | 3300050514 | nmdc:mga08x19_7002_c1 | nmdc:mga08x19_7002_c1_2174_2788 | 202 |
| 400 | 3300050515 | nmdc:mga0a205_30448_c1 | nmdc:mga0a205_30448_c1_517_1125 | 202 |
| 401 | 3300054114 | Ga0501084_0197076 | Ga0501084_0197076_973_1602 | 202 |
| 402 | 3300060353 | Ga0501082_0044906 | Ga0501082_0044906_1080_1709 | 202 |
| 403 | 3300060353 | Ga0501082_0283137 | Ga0501082_0283137_42_662 | 202 |
| 404 | 3300061734 | Ga0530510_0068286 | Ga0530510_0068286_449_1078 | 202 |
| 405 | 3300005444 | Ga0070694_100023655 | Ga0070694_1000236553 | 203 |
| 406 | 3300005545 | Ga0070695_100050132 | Ga0070695_1000501323 | 203 |
| 407 | 3300005546 | Ga0070696_100105391 | Ga0070696_1001053913 | 203 |
| 408 | 3300005549 | Ga0070704_100024044 | Ga0070704_1000240444 | 203 |
| 409 | 3300005844 | Ga0068862_100315047 | Ga0068862_1003150472 | 203 |
| 410 | 3300006852 | Ga0075433_10263397 | Ga0075433_102633973 | 203 |
| 411 | 3300007076 | Ga0075435_100002111 | Ga0075435_1000021113 | 203 |
| 412 | 3300025907 | Ga0207645_10246457 | Ga0207645_102464572 | 203 |
| 413 | 3300025925 | Ga0207650_10384890 | Ga0207650_103848902 | 203 |
| 414 | 3300027462 | Ga0210000_1003102 | Ga0210000_10031024 | 203 |
| 415 | 3300032002 | Ga0307416_100455048 | Ga0307416_1004550481 | 203 |
| 416 | 3300032005 | Ga0307411_10203651 | Ga0307411_102036512 | 203 |
| 417 | 3300036401 | Ga0373937_0001291 | Ga0373937_0001291_12453_13121 | 203 |
| 418 | 3300038996 | Ga0242420_037789 | Ga0242420_037789_186_797 | 203 |
| 419 | 3300041404 | Ga0439436_0104444 | Ga0439436_0104444_53_667 | 203 |
| 420 | 3300041406 | Ga0439439_0037543 | Ga0439439_0037543_392_1006 | 203 |
| 421 | 3300046462 | Ga0495651_0237030 | Ga0495651_0237030_354_977 | 203 |
| 422 | 3300048088 | Ga0495602_0598902 | Ga0495602_0598902_12_635 | 203 |
| 423 | 3300050509 | nmdc:mga0qj67_278368_c1 | nmdc:mga0qj67_278368_c1_362_985 | 203 |
| 424 | 3300050513 | nmdc:mga0rr50_52459_c1 | nmdc:mga0rr50_52459_c1_856_1512 | 203 |
| 425 | 3300050514 | nmdc:mga08x19_158475_c1 | nmdc:mga08x19_158475_c1_724_1362 | 203 |
| 426 | 3300059426 | Ga0590077_023352 | Ga0590077_023352_221_898 | 203 |
| 427 | 3300005330 | Ga0070690_100330720 | Ga0070690_1003307202 | 204 |
| 428 | 3300005338 | Ga0068868_100724191 | Ga0068868_1007241911 | 204 |
| 429 | 3300005354 | Ga0070675_100031722 | Ga0070675_1000317223 | 204 |
| 430 | 3300005364 | Ga0070673_100210043 | Ga0070673_1002100432 | 204 |
| 431 | 3300005440 | Ga0070705_100050267 | Ga0070705_1000502672 | 204 |
| 432 | 3300005441 | Ga0070700_100006464 | Ga0070700_1000064644 | 204 |
| 433 | 3300005441 | Ga0070700_100401626 | Ga0070700_1004016262 | 204 |
| 434 | 3300005457 | Ga0070662_100398048 | Ga0070662_1003980482 | 204 |
| 435 | 3300005459 | Ga0068867_100000441 | Ga0068867_1000004414 | 204 |
| 436 | 3300005543 | Ga0070672_100203609 | Ga0070672_1002036092 | 204 |
| 437 | 3300005544 | Ga0070686_100635517 | Ga0070686_1006355171 | 204 |
| 438 | 3300005545 | Ga0070695_100175240 | Ga0070695_1001752402 | 204 |
| 439 | 3300005615 | Ga0070702_100094609 | Ga0070702_1000946093 | 204 |
| 440 | 3300005718 | Ga0068866_10089639 | Ga0068866_100896392 | 204 |
| 441 | 3300005719 | Ga0068861_100006057 | Ga0068861_1000060574 | 204 |
| 442 | 3300005719 | Ga0068861_100052305 | Ga0068861_1000523053 | 204 |
| 443 | 3300005719 | Ga0068861_100504100 | Ga0068861_1005041001 | 204 |
| 444 | 3300005844 | Ga0068862_100007502 | Ga0068862_1000075028 | 204 |
| 445 | 3300005844 | Ga0068862_100170415 | Ga0068862_1001704153 | 204 |
| 446 | 3300006844 | Ga0075428_100332189 | Ga0075428_1003321893 | 204 |
| 447 | 3300006847 | Ga0075431_100260871 | Ga0075431_1002608713 | 204 |
| 448 | 3300006881 | Ga0068865_100015043 | Ga0068865_1000150435 | 204 |
| 449 | 3300009094 | Ga0111539_10263245 | Ga0111539_102632453 | 204 |
| 450 | 3300009148 | Ga0105243_10009085 | Ga0105243_100090856 | 204 |
| 451 | 3300009553 | Ga0105249_10065151 | Ga0105249_100651513 | 204 |
| 452 | 3300014326 | Ga0157380_10036817 | Ga0157380_100368173 | 204 |
| 453 | 3300025899 | Ga0207642_10065474 | Ga0207642_100654742 | 204 |
| 454 | 3300025908 | Ga0207643_10042106 | Ga0207643_100421063 | 204 |
| 455 | 3300025918 | Ga0207662_10100672 | Ga0207662_101006721 | 204 |
| 456 | 3300025923 | Ga0207681_10009140 | Ga0207681_100091405 | 204 |
| 457 | 3300025926 | Ga0207659_10453369 | Ga0207659_104533692 | 204 |
| 458 | 3300025935 | Ga0207709_10017865 | Ga0207709_100178654 | 204 |
| 459 | 3300025936 | Ga0207670_10176230 | Ga0207670_101762302 | 204 |
| 460 | 3300025937 | Ga0207669_10012921 | Ga0207669_100129213 | 204 |
| 461 | 3300025938 | Ga0207704_10012020 | Ga0207704_100120203 | 204 |
| 462 | 3300025940 | Ga0207691_10092168 | Ga0207691_100921682 | 204 |
| 463 | 3300025961 | Ga0207712_10009606 | Ga0207712_100096064 | 204 |
| 464 | 3300025972 | Ga0207668_10011102 | Ga0207668_100111025 | 204 |
| 465 | 3300026075 | Ga0207708_10019272 | Ga0207708_100192725 | 204 |
| 466 | 3300026089 | Ga0207648_10002083 | Ga0207648_100020839 | 204 |
| 467 | 3300026118 | Ga0207675_100000760 | Ga0207675_1000007607 | 204 |
| 468 | 3300026118 | Ga0207675_100115594 | Ga0207675_1001155944 | 204 |
| 469 | 3300027907 | Ga0207428_10044980 | Ga0207428_100449803 | 204 |
| 470 | 3300028380 | Ga0268265_10006319 | Ga0268265_100063196 | 204 |
| 471 | 3300031548 | Ga0307408_100544112 | Ga0307408_1005441122 | 204 |
| 472 | 3300031911 | Ga0307412_10224288 | Ga0307412_102242882 | 204 |
| 473 | 3300032005 | Ga0307411_10288948 | Ga0307411_102889483 | 204 |
| 474 | 3300035112 | Ga0373932_0039800 | Ga0373932_0039800_702_1328 | 204 |
| 475 | 3300050511 | nmdc:mga08y16_49560_c1 | nmdc:mga08y16_49560_c1_2129_2755 | 204 |
| 476 | 3300050511 | nmdc:mga08y16_77372_c1 | nmdc:mga08y16_77372_c1_2004_2642 | 204 |
| 477 | 3300003503 | JGI26141J51220_1004571 | JGI26141J51220_10045712 | 205 |
| 478 | 3300006844 | Ga0075428_100209012 | Ga0075428_1002090122 | 205 |
| 479 | 3300006846 | Ga0075430_100136869 | Ga0075430_1001368691 | 205 |
| 480 | 3300006847 | Ga0075431_100088136 | Ga0075431_1000881363 | 205 |
| 481 | 3300006880 | Ga0075429_100016200 | Ga0075429_1000162004 | 205 |
| 482 | 3300027471 | Ga0209995_1010945 | Ga0209995_10109453 | 205 |
| 483 | 3300027682 | Ga0209971_1007160 | Ga0209971_10071603 | 205 |
| 484 | 3300027695 | Ga0209966_1008965 | Ga0209966_10089652 | 205 |
| 485 | 3300027876 | Ga0209974_10046999 | Ga0209974_100469992 | 205 |
| 486 | 3300035207 | Ga0373942_0006896 | Ga0373942_0006896_556_1293 | 205 |
| 487 | 3300041410 | Ga0439461_0056042 | Ga0439461_0056042_148_765 | 205 |
| 488 | 3300042001 | Ga0439441_000107 | Ga0439441_000107_1104_1724 | 205 |
| 489 | 3300042001 | Ga0439441_004278 | Ga0439441_004278_1128_1745 | 205 |
| 490 | 3300042003 | Ga0439443_002781 | Ga0439443_002781_815_1435 | 205 |
| 491 | 3300042013 | Ga0439456_071711 | Ga0439456_071711_68_685 | 205 |
| 492 | 3300042015 | Ga0439462_0101862 | Ga0439462_0101862_118_735 | 205 |
| 493 | 3300042436 | Ga0439435_0000155 | Ga0439435_0000155_3328_3948 | 205 |
| 494 | 3300042436 | Ga0439435_0021342 | Ga0439435_0021342_445_1062 | 205 |
| 495 | 3300049570 | Ga0501033_0105917 | Ga0501033_0105917_922_1542 | 205 |
| 496 | 3300049572 | Ga0501036_0035515 | Ga0501036_0035515_1460_2080 | 205 |
| 497 | 3300049573 | Ga0501037_0271377 | Ga0501037_0271377_475_1092 | 205 |
| 498 | 3300049574 | Ga0501038_0149327 | Ga0501038_0149327_823_1443 | 205 |
| 499 | 3300049575 | Ga0501039_0025260 | Ga0501039_0025260_1439_2059 | 205 |
| 500 | 3300049575 | Ga0501039_0061710 | Ga0501039_0061710_1542_2162 | 205 |
| 501 | 3300049575 | Ga0501039_0068050 | Ga0501039_0068050_1115_1732 | 205 |
| 502 | 3300049576 | Ga0501040_0103527 | Ga0501040_0103527_825_1445 | 205 |
| 503 | 3300049576 | Ga0501040_0157887 | Ga0501040_0157887_647_1267 | 205 |
| 504 | 3300049577 | Ga0501041_0020525 | Ga0501041_0020525_3210_3827 | 205 |
| 505 | 3300049577 | Ga0501041_0038361 | Ga0501041_0038361_677_1297 | 205 |
| 506 | 3300049578 | Ga0501042_0062155 | Ga0501042_0062155_952_1569 | 205 |
| 507 | 3300049580 | Ga0501046_0070470 | Ga0501046_0070470_1752_2372 | 205 |
| 508 | 3300049582 | Ga0501048_0096591 | Ga0501048_0096591_105_788 | 205 |
| 509 | 3300049582 | Ga0501048_0179546 | Ga0501048_0179546_641_1258 | 205 |
| 510 | 3300049582 | Ga0501048_0464819 | Ga0501048_0464819_184_804 | 205 |
| 511 | 3300049587 | Ga0501071_0034607 | Ga0501071_0034607_1831_2451 | 205 |
| 512 | 3300049587 | Ga0501071_0038597 | Ga0501071_0038597_277_960 | 205 |
| 513 | 3300049588 | Ga0501072_0000728 | Ga0501072_0000728_2112_2732 | 205 |
| 514 | 3300049588 | Ga0501072_0164930 | Ga0501072_0164930_228_911 | 205 |
| 515 | 3300049590 | Ga0501074_0107598 | Ga0501074_0107598_1010_1693 | 205 |
| 516 | 3300049591 | Ga0501075_0017641 | Ga0501075_0017641_1917_2537 | 205 |
| 517 | 3300049591 | Ga0501075_0489320 | Ga0501075_0489320_242_862 | 205 |
| 518 | 3300049592 | Ga0501076_0001789 | Ga0501076_0001789_2656_3276 | 205 |
| 519 | 3300049592 | Ga0501076_0158177 | Ga0501076_0158177_1067_1750 | 205 |
| 520 | 3300049592 | Ga0501076_0630981 | Ga0501076_0630981_223_843 | 205 |
| 521 | 3300049741 | Ga0501079_0183646 | Ga0501079_0183646_248_868 | 205 |
| 522 | 3300049743 | Ga0501081_0076684 | Ga0501081_0076684_1304_1924 | 205 |
| 523 | 3300049824 | Ga0501045_0075826 | Ga0501045_0075826_131_814 | 205 |
| 524 | 3300049824 | Ga0501045_0084253 | Ga0501045_0084253_970_1590 | 205 |
| 525 | 3300050508 | nmdc:mga09592_40811_c1 | nmdc:mga09592_40811_c1_1623_2240 | 205 |
| 526 | 3300050509 | nmdc:mga0qj67_12994_c1 | nmdc:mga0qj67_12994_c1_2592_3209 | 205 |
| 527 | 3300050509 | nmdc:mga0qj67_87999_c1 | nmdc:mga0qj67_87999_c1_1048_1665 | 205 |
| 528 | 3300050510 | nmdc:mga06r32_146177_c1 | nmdc:mga06r32_146177_c1_1071_1688 | 205 |
| 529 | 3300050510 | nmdc:mga06r32_633175_c1 | nmdc:mga06r32_633175_c1_109_726 | 205 |
| 530 | 3300054114 | Ga0501084_0012160 | Ga0501084_0012160_2059_2679 | 205 |
| 531 | 3300054114 | Ga0501084_0108881 | Ga0501084_0108881_851_1534 | 205 |
| 532 | 3300060353 | Ga0501082_0079044 | Ga0501082_0079044_1994_2614 | 205 |
| 533 | 3300061734 | Ga0530510_0000342 | Ga0530510_0000342_3719_4339 | 205 |
| 534 | 3300061734 | Ga0530510_0319153 | Ga0530510_0319153_39_722 | 205 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ew0-assembly1.cif.gz_A | x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1. | 0.793 | 29 | 183 |
| 2haf-assembly1.cif.gz_A | crystal structure of a putative translation repressor from vibrio cholerae | 0.7538 | 24 | 187 |
| 2ew0-assembly1.cif.gz_A | x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1. | 0.71 | 29 | 183 |
| 2mui-assembly1.cif.gz_A | solution structure of the algh protein from pseudomonas aeruginosa, pa0405, upf0301 | 0.6762 | 21 | 204 |
| 2haf-assembly1.cif.gz_A | crystal structure of a putative translation repressor from vibrio cholerae | 0.6759 | 24 | 187 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7G645_112_287_3.40.1740.10 | Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like | 0.7889 | 27 | 184 | 3.40.1740.10 |
| 2ew0A00 | Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like | 0.7867 | 29 | 183 | 3.40.1740.10 |
| af_P0A8W5_4_171_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.7833 | 27 | 183 | 3.40.50.1000 |
| af_A0A1D6G7F1_154_345_3.40.1740.10 | Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like | 0.7788 | 29 | 187 | 3.40.1740.10 |
| af_P0A8W5_4_171_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.7343 | 27 | 183 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537E1G2-F1-model_v4 | YqgE/AlgH family protein | 0.8963 | 20 | 195 |
GO:0005829
|
| AF-A0A536XXI8-F1-model_v4 | YqgE/AlgH family protein | 0.893 | 21 | 193 |
GO:0005829
|
| AF-A0A521YMU9-F1-model_v4 | YqgE/AlgH family protein | 0.8817 | 21 | 198 |
GO:0005829
|
| AF-A0A536TQB7-F1-model_v4 | YqgE/AlgH family protein | 0.8758 | 20 | 196 |
GO:0005829
|
| AF-A0A536X7L8-F1-model_v4 | YqgE/AlgH family protein | 0.875 | 44 | 195 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar