F460555

General Info

Members Datasets Scaffolds Average Seq Length
534 262 534 207

Family's Representative Sequence

Representative Sequence 3300035207|Ga0373942_0006896|Ga0373942_0006896_556_1293
Length 245
Sequence MKTAFRPAFFCMLLGLLCFPGALFAQSEDEAMLLVANPAFRDLEYRQTVLIAAPAPNGGHVGVIINRPTRRSLGSLFPEHEPSKKVVDPVYYGGPFSRGALVALVRADQAPGEGVVPLMKSLYLAFRANTIDHVIETTPNDARYFVGYVGWRPGELRSEIDRGVWSVLNADLDMVFRKDTEGMWEELLQQTKRIRADAAPRRVPLAASPADDAPLGAGEATARTAELSRSRAILFAWTPNRAVAR

Samples

Sample ID Description Type Environment
1 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
132 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
133 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
134 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
135 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
160 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
161 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
162 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
165 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
166 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
167 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
168 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
169 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.81
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26141J51220_1004571 3300003503 Unclassified 857
2 Ga0070690_100000148 3300005330 Bacteria 35769
3 Ga0070690_100102933 3300005330 Bacteria 1895
4 Ga0070690_100330720 3300005330 Bacteria 1101
5 Ga0068869_100000103 3300005334 Bacteria 39927
6 Ga0070680_100252946 3300005336 Bacteria 1490
7 Ga0068868_100724191 3300005338 Bacteria 892
8 Ga0070689_100001211 3300005340 Bacteria 16347
9 Ga0070689_100466408 3300005340 Bacteria 1077
10 Ga0070687_100000105 3300005343 Bacteria 28128
11 Ga0070687_100257175 3300005343 Bacteria 1088
12 Ga0070687_100744990 3300005343 Bacteria 689
13 Ga0070692_10002047 3300005345 Bacteria 7669
14 Ga0070675_100031722 3300005354 Bacteria 4273
15 Ga0070675_100578795 3300005354 Bacteria 1017
16 Ga0070673_100210043 3300005364 Bacteria 1681
17 Ga0070701_10004680 3300005438 Bacteria 5575
18 Ga0070711_100191545 3300005439 Bacteria 1572
19 Ga0070705_100050267 3300005440 Bacteria 2424
20 Ga0070705_100220098 3300005440 Bacteria 1314
21 Ga0070705_100492267 3300005440 Bacteria 929
22 Ga0070700_100006464 3300005441 Bacteria 6274
23 Ga0070700_100401626 3300005441 Bacteria 1030
24 Ga0070700_100512562 3300005441 Bacteria 925
25 Ga0070694_100023655 3300005444 Bacteria 3954
26 Ga0070694_100039734 3300005444 Bacteria 3134
27 Ga0070694_100208925 3300005444 Bacteria 1459
28 Ga0070662_100398048 3300005457 Bacteria 1136
29 Ga0070681_10000790 3300005458 Bacteria 26387
30 Ga0068867_100000441 3300005459 Bacteria 27580
31 Ga0070706_100181005 3300005467 Bacteria 1968
32 Ga0070707_101189057 3300005468 Bacteria 729
33 Ga0070698_100007519 3300005471 Bacteria 11786
34 Ga0070699_100084515 3300005518 Bacteria 2769
35 Ga0070699_100389461 3300005518 Bacteria 1259
36 Ga0070699_100574523 3300005518 Bacteria 1027
37 Ga0070679_100176348 3300005530 Bacteria 2110
38 Ga0070684_100307192 3300005535 Bacteria 1456
39 Ga0070684_100921956 3300005535 Bacteria 819
40 Ga0070697_100059500 3300005536 Bacteria 3111
41 Ga0070697_100072789 3300005536 Bacteria 2820
42 Ga0070672_100203609 3300005543 Bacteria 1655
43 Ga0070686_100635517 3300005544 Bacteria 845
44 Ga0070695_100000259 3300005545 Bacteria 26538
45 Ga0070695_100011635 3300005545 Bacteria 5265
46 Ga0070695_100050132 3300005545 Unclassified 2675
47 Ga0070695_100054298 3300005545 Bacteria 2578
48 Ga0070695_100090283 3300005545 Unclassified 2044
49 Ga0070695_100107288 3300005545 Bacteria 1889
50 Ga0070695_100175240 3300005545 Bacteria 1516
51 Ga0070696_100020737 3300005546 Unclassified 4453
52 Ga0070696_100024432 3300005546 Bacteria 4107
53 Ga0070696_100105391 3300005546 Unclassified 2025
54 Ga0070693_100000101 3300005547 Bacteria 37995
55 Ga0070693_100126323 3300005547 Bacteria 1593
56 Ga0070704_100024044 3300005549 Bacteria 3992
57 Ga0070704_100174028 3300005549 Bacteria 1715
58 Ga0070704_100246963 3300005549 Bacteria 1463
59 Ga0070704_100667767 3300005549 Bacteria 919
60 Ga0068855_100001986 3300005563 Bacteria 25406
61 Ga0068854_100020898 3300005578 Bacteria 4436
62 Ga0068856_100034678 3300005614 Bacteria 4943
63 Ga0068856_100372430 3300005614 Bacteria 1447
64 Ga0070702_100094609 3300005615 Bacteria 1819
65 Ga0070702_100174272 3300005615 Bacteria 1402
66 Ga0068859_100004200 3300005617 Bacteria 14703
67 Ga0068859_100014168 3300005617 Bacteria 7996
68 Ga0068859_100455188 3300005617 Bacteria 1376
69 Ga0068866_10089639 3300005718 Bacteria 1672
70 Ga0068861_100000826 3300005719 Bacteria 18701
71 Ga0068861_100006057 3300005719 Bacteria 8224
72 Ga0068861_100052305 3300005719 Unclassified 3104
73 Ga0068861_100504100 3300005719 Bacteria 1095
74 Ga0068870_10123249 3300005840 Bacteria 1496
75 Ga0068870_10178142 3300005840 Bacteria 1274
76 Ga0068863_100223527 3300005841 Bacteria 1814
77 Ga0068863_100843831 3300005841 Bacteria 915
78 Ga0068858_100002013 3300005842 Bacteria 20783
79 Ga0068860_100001309 3300005843 Bacteria 27054
80 Ga0068860_100088352 3300005843 Bacteria 2950
81 Ga0068862_100007502 3300005844 Bacteria 9037
82 Ga0068862_100033569 3300005844 Bacteria 4339
83 Ga0068862_100170415 3300005844 Bacteria 1949
84 Ga0068862_100315047 3300005844 Bacteria 1443
85 Ga0097621_100000106 3300006237 Bacteria 47435
86 Ga0097621_100029641 3300006237 Bacteria 4324
87 Ga0068871_100016457 3300006358 Bacteria 5569
88 Ga0068871_100018352 3300006358 Bacteria 5315
89 Ga0075428_100000134 3300006844 Bacteria 65107
90 Ga0075428_100101766 3300006844 Bacteria 3132
91 Ga0075428_100169561 3300006844 Bacteria 2367
92 Ga0075428_100209012 3300006844 Bacteria 2109
93 Ga0075428_100332189 3300006844 Bacteria 1633
94 Ga0075430_100015801 3300006846 Bacteria 6428
95 Ga0075430_100136869 3300006846 Unclassified 2040
96 Ga0075430_100473318 3300006846 Bacteria 1034
97 Ga0075431_100082409 3300006847 Bacteria 3320
98 Ga0075431_100088136 3300006847 Bacteria 3202
99 Ga0075431_100179112 3300006847 Bacteria 2176
100 Ga0075431_100260871 3300006847 Bacteria 1758
101 Ga0075431_100392373 3300006847 Bacteria 1390
102 Ga0075431_100393998 3300006847 Bacteria 1387
103 Ga0075433_10009655 3300006852 Bacteria 7723
104 Ga0075433_10189694 3300006852 Bacteria 1829
105 Ga0075433_10263397 3300006852 Bacteria 1528
106 Ga0075433_10272233 3300006852 Bacteria 1501
107 Ga0075433_10464557 3300006852 Bacteria 1115
108 Ga0075433_10478654 3300006852 Bacteria 1097
109 Ga0075433_10648746 3300006852 Bacteria 925
110 Ga0075434_100000593 3300006871 Bacteria 27994
111 Ga0075434_100000699 3300006871 Bacteria 26231
112 Ga0075434_100009949 3300006871 Bacteria 8898
113 Ga0075434_101206552 3300006871 Bacteria 769
114 Ga0075429_100000271 3300006880 Bacteria 36263
115 Ga0075429_100000955 3300006880 Bacteria 22912
116 Ga0075429_100016200 3300006880 Bacteria 6458
117 Ga0068865_100000231 3300006881 Bacteria 31031
118 Ga0068865_100015043 3300006881 Bacteria 4928
119 Ga0075436_100003269 3300006914 Bacteria 11101
120 Ga0075436_100007082 3300006914 Bacteria 7676
121 Ga0075436_100007710 3300006914 Bacteria 7355
122 Ga0075436_100024973 3300006914 Bacteria 4109
123 Ga0097620_100004200 3300006931 Bacteria 14703
124 Ga0097620_100014167 3300006931 Bacteria 7996
125 Ga0097620_100149062 3300006931 Bacteria 2415
126 Ga0097620_100455185 3300006931 Bacteria 1376
127 Ga0075435_100002111 3300007076 Bacteria 13077
128 Ga0075435_100010825 3300007076 Bacteria 6679
129 Ga0075435_100077188 3300007076 Bacteria 2731
130 Ga0075435_100115056 3300007076 Bacteria 2239
131 Ga0075435_100135489 3300007076 Bacteria 2063
132 Ga0105250_10032592 3300009092 Bacteria 2092
133 Ga0111539_10032731 3300009094 Bacteria 6314
134 Ga0111539_10063590 3300009094 Bacteria 4366
135 Ga0111539_10080149 3300009094 Bacteria 3840
136 Ga0111539_10186410 3300009094 Bacteria 2423
137 Ga0111539_10263245 3300009094 Bacteria 2007
138 Ga0111539_10349193 3300009094 Bacteria 1722
139 Ga0105245_10000347 3300009098 Bacteria 43236
140 Ga0105245_10168628 3300009098 Bacteria 2083
141 Ga0105247_10467247 3300009101 Bacteria 913
142 Ga0114129_10006193 3300009147 Bacteria 16974
143 Ga0114129_10023204 3300009147 Bacteria 8800
144 Ga0114129_10107512 3300009147 Bacteria 3852
145 Ga0114129_10307235 3300009147 Bacteria 2112
146 Ga0105243_10000535 3300009148 Bacteria 38636
147 Ga0105243_10009085 3300009148 Bacteria 7594
148 Ga0105243_10235245 3300009148 Bacteria 1627
149 Ga0105243_10302391 3300009148 Bacteria 1450
150 Ga0105241_10241263 3300009174 Bacteria 1528
151 Ga0105242_10000905 3300009176 Bacteria 23036
152 Ga0105242_10001418 3300009176 Bacteria 18885
153 Ga0105248_10221641 3300009177 Bacteria 2129
154 Ga0105249_10001515 3300009553 Bacteria 20389
155 Ga0105249_10065151 3300009553 Bacteria 3351
156 Ga0105249_10602609 3300009553 Bacteria 1153
157 Ga0105239_10647571 3300010375 Bacteria 1207
158 Ga0105246_10129300 3300011119 Bacteria 1884
159 Ga0157369_10935753 3300013105 Bacteria 888
160 Ga0157378_10000447 3300013297 Bacteria 39662
161 Ga0157378_10583665 3300013297 Bacteria 1127
162 Ga0157380_10036817 3300014326 Bacteria 3788
163 Ga0157380_10320089 3300014326 Bacteria 1438
164 Ga0157377_10072821 3300014745 Bacteria 1989
165 Ga0157377_10385433 3300014745 Bacteria 950
166 Ga0157379_10728039 3300014968 Bacteria 933
167 Ga0157376_10033483 3300014969 Bacteria 4138
168 Ga0207653_10018261 3300025885 Bacteria 2209
169 Ga0207642_10007904 3300025899 Bacteria 3616
170 Ga0207642_10065474 3300025899 Bacteria 1708
171 Ga0207685_10032306 3300025905 Bacteria 1882
172 Ga0207645_10246457 3300025907 Bacteria 1181
173 Ga0207643_10042106 3300025908 Bacteria 2574
174 Ga0207643_10162223 3300025908 Bacteria 1345
175 Ga0207684_10110876 3300025910 Bacteria 2349
176 Ga0207707_10042871 3300025912 Bacteria 3948
177 Ga0207707_10068136 3300025912 Bacteria 3100
178 Ga0207663_10098707 3300025916 Unclassified 1956
179 Ga0207660_10003601 3300025917 Bacteria 10091
180 Ga0207660_10032377 3300025917 Bacteria 3609
181 Ga0207662_10000109 3300025918 Bacteria 39758
182 Ga0207662_10100672 3300025918 Bacteria 1790
183 Ga0207662_10146942 3300025918 Bacteria 1497
184 Ga0207652_10107500 3300025921 Bacteria 2471
185 Ga0207652_10257707 3300025921 Bacteria 1573
186 Ga0207681_10009140 3300025923 Bacteria 6052
187 Ga0207650_10384890 3300025925 Bacteria 1159
188 Ga0207659_10097882 3300025926 Bacteria 2205
189 Ga0207659_10453369 3300025926 Bacteria 1080
190 Ga0207687_10001220 3300025927 Bacteria 17591
191 Ga0207644_10389081 3300025931 Unclassified 1138
192 Ga0207690_11123967 3300025932 Bacteria 655
193 Ga0207706_10287129 3300025933 Bacteria 1434
194 Ga0207686_10003414 3300025934 Bacteria 8525
195 Ga0207709_10001794 3300025935 Bacteria 14388
196 Ga0207709_10017865 3300025935 Bacteria 3965
197 Ga0207670_10026770 3300025936 Bacteria 3638
198 Ga0207670_10120864 3300025936 Bacteria 1904
199 Ga0207670_10176230 3300025936 Bacteria 1607
200 Ga0207670_10290899 3300025936 Bacteria 1276
201 Ga0207670_10684354 3300025936 Bacteria 848
202 Ga0207669_10012921 3300025937 Bacteria 4126
203 Ga0207704_10001838 3300025938 Bacteria 9511
204 Ga0207704_10012020 3300025938 Bacteria 4284
205 Ga0207691_10092168 3300025940 Bacteria 2713
206 Ga0207711_10124004 3300025941 Bacteria 2309
207 Ga0207689_10000532 3300025942 Bacteria 36122
208 Ga0207661_10085851 3300025944 Bacteria 2610
209 Ga0207667_10053712 3300025949 Bacteria 4238
210 Ga0207712_10002829 3300025961 Bacteria 11120
211 Ga0207712_10009606 3300025961 Bacteria 6125
212 Ga0207712_10335397 3300025961 Bacteria 1252
213 Ga0207668_10011102 3300025972 Bacteria 5464
214 Ga0207640_10048593 3300025981 Bacteria 2743
215 Ga0207677_10002506 3300026023 Bacteria 9627
216 Ga0207703_10011836 3300026035 Bacteria 6793
217 Ga0207708_10000712 3300026075 Bacteria 25051
218 Ga0207708_10019272 3300026075 Bacteria 5140
219 Ga0207708_10589878 3300026075 Bacteria 940
220 Ga0207702_10006394 3300026078 Bacteria 10164
221 Ga0207641_10302303 3300026088 Bacteria 1512
222 Ga0207641_10342461 3300026088 Bacteria 1423
223 Ga0207648_10000505 3300026089 Bacteria 43495
224 Ga0207648_10002083 3300026089 Bacteria 21780
225 Ga0207676_10125498 3300026095 Bacteria 2173
226 Ga0207674_10544912 3300026116 Bacteria 1121
227 Ga0207675_100000625 3300026118 Bacteria 34684
228 Ga0207675_100000760 3300026118 Bacteria 32073
229 Ga0207675_100115594 3300026118 Bacteria 2535
230 Ga0207675_100661068 3300026118 Bacteria 1052
231 Ga0207675_101095812 3300026118 Bacteria 816
232 Ga0207698_10576904 3300026142 Bacteria 1106
233 Ga0209969_1003311 3300027360 Bacteria 2225
234 Ga0209967_1002463 3300027364 Bacteria 2397
235 Ga0210000_1000637 3300027462 Bacteria 4825
236 Ga0210000_1003102 3300027462 Bacteria 2383
237 Ga0209995_1006752 3300027471 Bacteria 1848
238 Ga0209995_1010945 3300027471 Bacteria 1473
239 Ga0209971_1007160 3300027682 Bacteria 2645
240 Ga0209966_1008965 3300027695 Unclassified 1782
241 Ga0209974_10046999 3300027876 Unclassified 1445
242 Ga0207428_10006818 3300027907 Bacteria 10471
243 Ga0207428_10044980 3300027907 Bacteria 3559
244 Ga0207428_10136244 3300027907 Bacteria 1877
245 Ga0207428_10407639 3300027907 Bacteria 995
246 Ga0268265_10003684 3300028380 Bacteria 10934
247 Ga0268265_10006319 3300028380 Bacteria 8028
248 Ga0268264_10004078 3300028381 Bacteria 12508
249 Ga0268264_10314235 3300028381 Bacteria 1479
250 Ga0307408_100544112 3300031548 Unclassified 1023
251 Ga0307405_10427294 3300031731 Unclassified 1044
252 Ga0307412_10224288 3300031911 Unclassified 1443
253 Ga0307409_100395095 3300031995 Bacteria 1319
254 Ga0307416_100334676 3300032002 Bacteria 1523
255 Ga0307416_100455048 3300032002 Unclassified 1333
256 Ga0307411_10055576 3300032005 Bacteria 2605
257 Ga0307411_10203651 3300032005 Unclassified 1522
258 Ga0307411_10288948 3300032005 Bacteria 1309
259 Ga0373930_0007408 3300034816 Unclassified 1889
260 Ga0373948_0000598 3300034817 Bacteria 4630
261 Ga0373948_0027773 3300034817 Bacteria 1123
262 Ga0373928_0004346 3300035084 Bacteria 2702
263 Ga0373940_0009465 3300035088 Bacteria 2267
264 Ga0373949_0005757 3300035090 Bacteria 2757
265 Ga0373951_0028316 3300035091 Bacteria 1312
266 Ga0373932_0006499 3300035112 Bacteria 2764
267 Ga0373932_0039800 3300035112 Bacteria 1350
268 Ga0373936_0013970 3300035113 Bacteria 3067
269 Ga0373939_0001027 3300035114 Bacteria 6877
270 Ga0373941_0003835 3300035115 Bacteria 3445
271 Ga0373945_0003206 3300035116 Bacteria 5130
272 Ga0373954_0054081 3300035118 Bacteria 1888
273 Ga0373956_0086693 3300035119 Bacteria 1441
274 Ga0373960_0029353 3300035121 Bacteria 1524
275 Ga0373960_0041752 3300035121 Bacteria 1329
276 Ga0373943_0005804 3300035170 Bacteria 5545
277 Ga0373946_0003055 3300035171 Bacteria 5924
278 Ga0373955_0365428 3300035172 Bacteria 875
279 Ga0373942_0006896 3300035207 Bacteria 2625
280 Ga0373962_0007763 3300035242 Bacteria 2633
281 Ga0373924_0002459 3300035410 Bacteria 6234
282 Ga0373931_0000483 3300035691 Bacteria 16244
283 Ga0373931_0023496 3300035691 Bacteria 3113
284 Ga0373931_0046606 3300035691 Bacteria 2292
285 Ga0373931_0602623 3300035691 Bacteria 718
286 Ga0373935_0010422 3300035692 Bacteria 5573
287 Ga0373927_0053308 3300035695 Bacteria 2616
288 Ga0373933_0046950 3300035724 Bacteria 2567
289 Ga0373947_0359373 3300035725 Bacteria 978
290 Ga0373937_0001291 3300036401 Bacteria 20976
291 Ga0373937_0001839 3300036401 Bacteria 17831
292 Ga0373937_0083131 3300036401 Bacteria 2962
293 Ga0373925_0115925 3300037068 Bacteria 2074
294 Ga0395905_0660260 3300037471 Bacteria 948
295 Ga0242420_037789 3300038996 Bacteria 915
296 Ga0439436_0104444 3300041404 Bacteria 790
297 Ga0439439_0037543 3300041406 Bacteria 1249
298 Ga0439461_0056042 3300041410 Unclassified 885
299 Ga0451853_0943965 3300041512 Bacteria 808
300 Ga0439431_0073621 3300041997 Bacteria 913
301 Ga0439441_000107 3300042001 Bacteria 6772
302 Ga0439441_004278 3300042001 Bacteria 2154
303 Ga0439443_002781 3300042003 Unclassified 2132
304 Ga0439456_071711 3300042013 Bacteria 768
305 Ga0439462_0101862 3300042015 Unclassified 792
306 Ga0439446_0015276 3300042156 Bacteria 2128
307 Ga0439434_0011042 3300042435 Bacteria 2668
308 Ga0439434_0159997 3300042435 Unclassified 748
309 Ga0439435_0000155 3300042436 Bacteria 9350
310 Ga0439435_0021342 3300042436 Unclassified 1680
311 Ga0451577_0149623 3300042876 Bacteria 2100
312 Ga0451577_0163381 3300042876 Bacteria 2006
313 Ga0451576_0004079 3300045051 Bacteria 19295
314 Ga0451576_0035246 3300045051 Bacteria 5310
315 Ga0451576_0100294 3300045051 Bacteria 3011
316 Ga0451576_0240475 3300045051 Bacteria 1891
317 Ga0451576_0286150 3300045051 Bacteria 1723
318 Ga0451576_0351779 3300045051 Bacteria 1542
319 Ga0451576_0515641 3300045051 Bacteria 1256
320 Ga0466967_0010778 3300045976 Bacteria 6875
321 Ga0495592_0043494 3300046454 Bacteria 3360
322 Ga0495592_0686251 3300046454 Bacteria 617
323 Ga0495603_0013227 3300046455 Bacteria 4989
324 Ga0495629_0204425 3300046459 Unclassified 1365
325 Ga0495641_0067585 3300046461 Bacteria 1607
326 Ga0495651_0237030 3300046462 Unclassified 1253
327 Ga0495651_0320212 3300046462 Bacteria 1034
328 Ga0495653_0140416 3300046463 Bacteria 1700
329 Ga0495580_0112413 3300046472 Bacteria 1891
330 Ga0495639_0009054 3300046475 Bacteria 4270
331 Ga0495662_0020837 3300046476 Bacteria 3171
332 Ga0495662_0022123 3300046476 Bacteria 3072
333 Ga0495608_0000364 3300046511 Bacteria 31660
334 Ga0495618_0139754 3300046514 Bacteria 1549
335 Ga0495628_0176370 3300046516 Bacteria 1618
336 Ga0495630_0016353 3300046517 Bacteria 5420
337 Ga0495630_0079077 3300046517 Bacteria 2480
338 Ga0495630_0336884 3300046517 Bacteria 1154
339 Ga0495663_0054832 3300046525 Bacteria 1242
340 Ga0495666_0021756 3300046526 Bacteria 3174
341 Ga0495666_0096783 3300046526 Bacteria 1391
342 Ga0495642_0262036 3300046528 Bacteria 756
343 Ga0495652_0056357 3300046529 Bacteria 3338
344 Ga0495652_0188574 3300046529 Unclassified 1576
345 Ga0495652_0341266 3300046529 Unclassified 1076
346 Ga0495640_0019833 3300046533 Bacteria 4958
347 Ga0495586_0003547 3300046535 Bacteria 8361
348 Ga0495586_0011068 3300046535 Bacteria 4793
349 Ga0495587_0128981 3300046536 Bacteria 1446
350 Ga0495587_0424474 3300046536 Bacteria 738
351 Ga0495598_0023632 3300046537 Bacteria 1658
352 Ga0495621_0064635 3300046539 Unclassified 1335
353 Ga0495645_0086923 3300046543 Bacteria 2237
354 Ga0495667_0038999 3300046559 Bacteria 3162
355 Ga0495667_0052819 3300046559 Bacteria 2676
356 Ga0495656_0023166 3300046615 Bacteria 2441
357 Ga0495634_0001971 3300046642 Bacteria 17500
358 Ga0495635_0031920 3300046663 Bacteria 3655
359 Ga0495599_0051359 3300046678 Bacteria 2583
360 Ga0495646_0208278 3300046680 Bacteria 1062
361 Ga0495647_0013125 3300046681 Bacteria 2865
362 Ga0495658_0014162 3300046683 Bacteria 4068
363 Ga0495669_0002704 3300046684 Bacteria 7267
364 Ga0495669_0210245 3300046684 Bacteria 931
365 Ga0495613_0067732 3300046689 Bacteria 2605
366 Ga0495624_0040123 3300046690 Bacteria 2999
367 Ga0495600_0039238 3300046809 Bacteria 3083
368 Ga0495581_0106471 3300047315 Bacteria 1629
369 Ga0495604_0013831 3300047317 Bacteria 6437
370 Ga0495604_0099264 3300047317 Bacteria 2143
371 Ga0495676_0039942 3300047321 Bacteria 3879
372 Ga0495680_0001489 3300047322 Bacteria 25192
373 Ga0495680_0507006 3300047322 Bacteria 818
374 Ga0495675_0113864 3300047444 Bacteria 1687
375 Ga0495684_0263694 3300047471 Bacteria 1249
376 Ga0495593_0217692 3300047673 Bacteria 958
377 Ga0495602_0598902 3300048088 Bacteria 758
378 Ga0501031_0045363 3300049568 Bacteria 2868
379 Ga0501033_0006772 3300049570 Bacteria 8951
380 Ga0501033_0105917 3300049570 Bacteria 2049
381 Ga0501034_0327001 3300049571 Bacteria 1465
382 Ga0501036_0001519 3300049572 Bacteria 17901
383 Ga0501036_0035515 3300049572 Bacteria 4218
384 Ga0501036_0090031 3300049572 Bacteria 2592
385 Ga0501037_0035564 3300049573 Bacteria 3673
386 Ga0501037_0271377 3300049573 Bacteria 1184
387 Ga0501037_0431657 3300049573 Bacteria 901
388 Ga0501038_0001082 3300049574 Bacteria 24639
389 Ga0501038_0149327 3300049574 Bacteria 1906
390 Ga0501039_0000168 3300049575 Bacteria 45750
391 Ga0501039_0025260 3300049575 Bacteria 4564
392 Ga0501039_0061710 3300049575 Bacteria 2903
393 Ga0501039_0068050 3300049575 Unclassified 2765
394 Ga0501039_0074536 3300049575 Bacteria 2638
395 Ga0501040_0005928 3300049576 Bacteria 7912
396 Ga0501040_0103527 3300049576 Bacteria 1987
397 Ga0501040_0157887 3300049576 Unclassified 1602
398 Ga0501040_0188243 3300049576 Bacteria 1464
399 Ga0501040_0436371 3300049576 Bacteria 942
400 Ga0501041_0003011 3300049577 Bacteria 9659
401 Ga0501041_0020525 3300049577 Bacteria 3951
402 Ga0501041_0038361 3300049577 Bacteria 2905
403 Ga0501041_0052131 3300049577 Bacteria 2494
404 Ga0501042_0013075 3300049578 Bacteria 5644
405 Ga0501042_0062155 3300049578 Bacteria 2668
406 Ga0501042_0202132 3300049578 Bacteria 1432
407 Ga0501043_0101630 3300049579 Bacteria 2260
408 Ga0501043_0135365 3300049579 Bacteria 1930
409 Ga0501046_0000501 3300049580 Bacteria 39127
410 Ga0501046_0070470 3300049580 Bacteria 2718
411 Ga0501047_0158316 3300049581 Bacteria 2137
412 Ga0501048_0071002 3300049582 Bacteria 2458
413 Ga0501048_0096591 3300049582 Bacteria 2084
414 Ga0501048_0117901 3300049582 Bacteria 1875
415 Ga0501048_0179546 3300049582 Bacteria 1500
416 Ga0501048_0464819 3300049582 Bacteria 906
417 Ga0501067_0017198 3300049583 Bacteria 3997
418 Ga0501068_0010587 3300049584 Bacteria 5185
419 Ga0501068_0074864 3300049584 Bacteria 2070
420 Ga0501071_0000800 3300049587 Bacteria 16804
421 Ga0501071_0016723 3300049587 Bacteria 5045
422 Ga0501071_0034607 3300049587 Bacteria 3597
423 Ga0501071_0038597 3300049587 Bacteria 3413
424 Ga0501071_0076987 3300049587 Bacteria 2436
425 Ga0501071_0219580 3300049587 Bacteria 1430
426 Ga0501072_0000728 3300049588 Bacteria 23983
427 Ga0501072_0002835 3300049588 Bacteria 13010
428 Ga0501072_0016776 3300049588 Bacteria 5623
429 Ga0501072_0052224 3300049588 Bacteria 3218
430 Ga0501072_0064490 3300049588 Bacteria 2889
431 Ga0501072_0164930 3300049588 Bacteria 1767
432 Ga0501073_0137248 3300049589 Bacteria 1695
433 Ga0501074_0035203 3300049590 Bacteria 3627
434 Ga0501074_0087050 3300049590 Bacteria 2238
435 Ga0501074_0107598 3300049590 Bacteria 1996
436 Ga0501075_0000046 3300049591 Bacteria 50813
437 Ga0501075_0012948 3300049591 Bacteria 5942
438 Ga0501075_0017641 3300049591 Bacteria 5154
439 Ga0501075_0019775 3300049591 Bacteria 4888
440 Ga0501075_0046477 3300049591 Bacteria 3261
441 Ga0501075_0489320 3300049591 Bacteria 938
442 Ga0501076_0001789 3300049592 Bacteria 14574
443 Ga0501076_0004704 3300049592 Bacteria 9737
444 Ga0501076_0015921 3300049592 Bacteria 5690
445 Ga0501076_0028921 3300049592 Bacteria 4307
446 Ga0501076_0158177 3300049592 Bacteria 1845
447 Ga0501076_0239379 3300049592 Unclassified 1485
448 Ga0501076_0630981 3300049592 Unclassified 884
449 Ga0501077_0006891 3300049593 Bacteria 6996
450 Ga0501077_0051590 3300049593 Bacteria 2614
451 Ga0501077_0102979 3300049593 Bacteria 1809
452 Ga0501077_0163351 3300049593 Bacteria 1414
453 Ga0501079_0006512 3300049741 Bacteria 8772
454 Ga0501079_0042566 3300049741 Bacteria 3506
455 Ga0501079_0183646 3300049741 Bacteria 1632
456 Ga0501079_0529441 3300049741 Bacteria 926
457 Ga0501080_0005893 3300049742 Bacteria 10976
458 Ga0501080_0038280 3300049742 Bacteria 4478
459 Ga0501081_0004168 3300049743 Bacteria 9273
460 Ga0501081_0004833 3300049743 Bacteria 8659
461 Ga0501081_0076684 3300049743 Bacteria 2334
462 Ga0501081_0406326 3300049743 Unclassified 1008
463 Ga0501083_0045645 3300049744 Bacteria 2964
464 Ga0501083_0072854 3300049744 Bacteria 2283
465 Ga0501083_0348217 3300049744 Bacteria 963
466 Ga0501035_0115673 3300049822 Bacteria 2347
467 Ga0501044_0200328 3300049823 Bacteria 1955
468 Ga0501045_0000436 3300049824 Bacteria 25558
469 Ga0501045_0012202 3300049824 Bacteria 6051
470 Ga0501045_0075826 3300049824 Bacteria 2477
471 Ga0501045_0084253 3300049824 Bacteria 2345
472 nmdc:mga05p37_1059_c1 3300050507 Bacteria 31441
473 nmdc:mga05p37_13652_c1 3300050507 Bacteria 9733
474 nmdc:mga05p37_497013_c1 3300050507 Bacteria 1401
475 nmdc:mga09592_40811_c1 3300050508 Bacteria 3900
476 nmdc:mga09592_438_c1 3300050508 Bacteria 30676
477 nmdc:mga09592_58099_c1 3300050508 Bacteria 3271
478 nmdc:mga09592_61_c1 3300050508 Bacteria 60866
479 nmdc:mga0qj67_12994_c1 3300050509 Bacteria 6284
480 nmdc:mga0qj67_211797_c1 3300050509 Bacteria 1574
481 nmdc:mga0qj67_278368_c1 3300050509 Unclassified 1356
482 nmdc:mga0qj67_32877_c1 3300050509 Bacteria 4046
483 nmdc:mga0qj67_87999_c1 3300050509 Bacteria 2494
484 nmdc:mga06r32_1023920_c1 3300050510 Bacteria 778
485 nmdc:mga06r32_146177_c1 3300050510 Bacteria 2341
486 nmdc:mga06r32_540188_c1 3300050510 Bacteria 1140
487 nmdc:mga06r32_542710_c1 3300050510 Unclassified 1137
488 nmdc:mga06r32_5626_c1 3300050510 Bacteria 11272
489 nmdc:mga06r32_633175_c1 3300050510 Unclassified 1039
490 nmdc:mga06r32_83882_c1 3300050510 Bacteria 3105
491 nmdc:mga08y16_149524_c1 3300050511 Bacteria 2428
492 nmdc:mga08y16_2424_c1 3300050511 Bacteria 19158
493 nmdc:mga08y16_29545_c1 3300050511 Bacteria 5774
494 nmdc:mga08y16_298348_c1 3300050511 Bacteria 1661
495 nmdc:mga08y16_49560_c1 3300050511 Bacteria 4396
496 nmdc:mga08y16_588693_c1 3300050511 Bacteria 1122
497 nmdc:mga08y16_77372_c1 3300050511 Bacteria 3469
498 nmdc:mga0n895_116147_c1 3300050512 Bacteria 2695
499 nmdc:mga0n895_16714_c1 3300050512 Bacteria 6741
500 nmdc:mga0n895_231047_c1 3300050512 Bacteria 1877
501 nmdc:mga0n895_24918_c1 3300050512 Bacteria 5645
502 nmdc:mga0rr50_1080295_c1 3300050513 Bacteria 683
503 nmdc:mga0rr50_115981_c1 3300050513 Bacteria 2126
504 nmdc:mga0rr50_14657_c1 3300050513 Bacteria 5149
505 nmdc:mga0rr50_323477_c1 3300050513 Bacteria 1293
506 nmdc:mga0rr50_52459_c1 3300050513 Bacteria 3031
507 nmdc:mga08x19_12881_c2 3300050514 Bacteria 4154
508 nmdc:mga08x19_158475_c1 3300050514 Bacteria 1536
509 nmdc:mga08x19_239057_c1 3300050514 Bacteria 1251
510 nmdc:mga08x19_34762_c1 3300050514 Bacteria 3187
511 nmdc:mga08x19_7002_c1 3300050514 Bacteria 6695
512 nmdc:mga0a205_11673_c1 3300050515 Bacteria 8100
513 nmdc:mga0a205_234755_c1 3300050515 Bacteria 1716
514 nmdc:mga0a205_249616_c1 3300050515 Bacteria 1654
515 nmdc:mga0a205_30448_c1 3300050515 Bacteria 5167
516 nmdc:mga0a205_458679_c1 3300050515 Bacteria 1134
517 Ga0495601_0049839 3300053077 Bacteria 2641
518 Ga0495601_0172627 3300053077 Bacteria 1413
519 Ga0495595_0174718 3300053084 Bacteria 1064
520 Ga0501084_0006816 3300054114 Bacteria 9397
521 Ga0501084_0012160 3300054114 Bacteria 7126
522 Ga0501084_0108881 3300054114 Bacteria 2328
523 Ga0501084_0125754 3300054114 Bacteria 2157
524 Ga0501084_0197076 3300054114 Bacteria 1699
525 Ga0590077_023352 3300059426 Bacteria 1323
526 Ga0501082_0001259 3300060353 Bacteria 22237
527 Ga0501082_0044906 3300060353 Bacteria 3811
528 Ga0501082_0079044 3300060353 Bacteria 2837
529 Ga0501082_0283137 3300060353 Bacteria 1443
530 Ga0530510_0000342 3300061734 Bacteria 30062
531 Ga0530510_0011848 3300061734 Bacteria 6119
532 Ga0530510_0068286 3300061734 Bacteria 2578
533 Ga0530510_0103922 3300061734 Bacteria 2078
534 Ga0530510_0319153 3300061734 Unclassified 1164

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005545 Ga0070695_100054298 Ga0070695_1000542984 177
2 3300050513 nmdc:mga0rr50_1080295_c1 nmdc:mga0rr50_1080295_c1_64_669 177
3 3300005444 Ga0070694_100039734 Ga0070694_1000397341 178
4 3300050511 nmdc:mga08y16_298348_c1 nmdc:mga08y16_298348_c1_774_1445 187
5 3300045051 Ga0451576_0286150 Ga0451576_0286150_582_1253 188
6 3300009147 Ga0114129_10107512 Ga0114129_101075121 191
7 3300036401 Ga0373937_0083131 Ga0373937_0083131_1970_2569 191
8 3300046454 Ga0495592_0043494 Ga0495592_0043494_2373_2972 191
9 3300046461 Ga0495641_0067585 Ga0495641_0067585_46_645 191
10 3300046462 Ga0495651_0320212 Ga0495651_0320212_216_815 191
11 3300046463 Ga0495653_0140416 Ga0495653_0140416_133_732 191
12 3300046476 Ga0495662_0020837 Ga0495662_0020837_818_1417 191
13 3300046511 Ga0495608_0000364 Ga0495608_0000364_15258_15857 191
14 3300046514 Ga0495618_0139754 Ga0495618_0139754_383_982 191
15 3300046516 Ga0495628_0176370 Ga0495628_0176370_667_1266 191
16 3300046517 Ga0495630_0079077 Ga0495630_0079077_1305_1904 191
17 3300046526 Ga0495666_0096783 Ga0495666_0096783_597_1196 191
18 3300046529 Ga0495652_0056357 Ga0495652_0056357_2274_2873 191
19 3300046533 Ga0495640_0019833 Ga0495640_0019833_3487_4086 191
20 3300046535 Ga0495586_0003547 Ga0495586_0003547_4941_5540 191
21 3300046536 Ga0495587_0128981 Ga0495587_0128981_109_708 191
22 3300046543 Ga0495645_0086923 Ga0495645_0086923_23_622 191
23 3300046559 Ga0495667_0052819 Ga0495667_0052819_1305_1904 191
24 3300046642 Ga0495634_0001971 Ga0495634_0001971_15219_15818 191
25 3300046678 Ga0495599_0051359 Ga0495599_0051359_826_1425 191
26 3300046680 Ga0495646_0208278 Ga0495646_0208278_425_1024 191
27 3300046689 Ga0495613_0067732 Ga0495613_0067732_700_1299 191
28 3300046809 Ga0495600_0039238 Ga0495600_0039238_1903_2502 191
29 3300047317 Ga0495604_0013831 Ga0495604_0013831_849_1448 191
30 3300047322 Ga0495680_0001489 Ga0495680_0001489_4105_4704 191
31 3300047444 Ga0495675_0113864 Ga0495675_0113864_365_964 191
32 3300047471 Ga0495684_0263694 Ga0495684_0263694_464_1063 191
33 3300047673 Ga0495593_0217692 Ga0495593_0217692_136_735 191
34 3300050513 nmdc:mga0rr50_115981_c1 nmdc:mga0rr50_115981_c1_1268_1879 191
35 3300053077 Ga0495601_0049839 Ga0495601_0049839_1624_2223 191
36 3300053084 Ga0495595_0174718 Ga0495595_0174718_237_836 191
37 3300047315 Ga0495581_0106471 Ga0495581_0106471_920_1543 192
38 3300025932 Ga0207690_11123967 Ga0207690_111239671 193
39 3300006852 Ga0075433_10189694 Ga0075433_101896943 194
40 3300005518 Ga0070699_100389461 Ga0070699_1003894612 195
41 3300005536 Ga0070697_100059500 Ga0070697_1000595003 195
42 3300005840 Ga0068870_10123249 Ga0068870_101232492 195
43 3300013105 Ga0157369_10935753 Ga0157369_109357531 195
44 3300041997 Ga0439431_0073621 Ga0439431_0073621_287_886 195
45 3300042156 Ga0439446_0015276 Ga0439446_0015276_657_1256 195
46 3300042435 Ga0439434_0011042 Ga0439434_0011042_1705_2304 195
47 3300046454 Ga0495592_0686251 Ga0495592_0686251_11_601 195
48 3300049576 Ga0501040_0188243 Ga0501040_0188243_735_1349 195
49 3300049584 Ga0501068_0074864 Ga0501068_0074864_1105_1719 195
50 3300049587 Ga0501071_0000800 Ga0501071_0000800_8752_9366 195
51 3300049588 Ga0501072_0052224 Ga0501072_0052224_1243_1857 195
52 3300049591 Ga0501075_0019775 Ga0501075_0019775_3199_3813 195
53 3300049741 Ga0501079_0529441 Ga0501079_0529441_124_738 195
54 3300049742 Ga0501080_0005893 Ga0501080_0005893_1501_2115 195
55 3300049744 Ga0501083_0348217 Ga0501083_0348217_268_882 195
56 3300054114 Ga0501084_0125754 Ga0501084_0125754_1219_1833 195
57 3300061734 Ga0530510_0103922 Ga0530510_0103922_785_1399 195
58 3300006852 Ga0075433_10478654 Ga0075433_104786542 196
59 3300007076 Ga0075435_100115056 Ga0075435_1001150562 196
60 3300041512 Ga0451853_0943965 Ga0451853_0943965_58_708 196
61 3300045976 Ga0466967_0010778 Ga0466967_0010778_2942_3535 196
62 3300005546 Ga0070696_100024432 Ga0070696_1000244322 197
63 3300005549 Ga0070704_100174028 Ga0070704_1001740282 197
64 3300005549 Ga0070704_100667767 Ga0070704_1006677671 197
65 3300005614 Ga0068856_100372430 Ga0068856_1003724302 197
66 3300006844 Ga0075428_100101766 Ga0075428_1001017662 197
67 3300006846 Ga0075430_100015801 Ga0075430_1000158016 197
68 3300006847 Ga0075431_100082409 Ga0075431_1000824092 197
69 3300006852 Ga0075433_10464557 Ga0075433_104645571 197
70 3300006871 Ga0075434_100000699 Ga0075434_10000069918 197
71 3300006914 Ga0075436_100024973 Ga0075436_1000249735 197
72 3300007076 Ga0075435_100010825 Ga0075435_1000108257 197
73 3300009147 Ga0114129_10307235 Ga0114129_103072352 197
74 3300013297 Ga0157378_10583665 Ga0157378_105836651 197
75 3300042876 Ga0451577_0163381 Ga0451577_0163381_579_1217 197
76 3300049593 Ga0501077_0102979 Ga0501077_0102979_520_1128 197
77 3300050507 nmdc:mga05p37_497013_c1 nmdc:mga05p37_497013_c1_669_1271 197
78 3300050509 nmdc:mga0qj67_32877_c1 nmdc:mga0qj67_32877_c1_1875_2519 197
79 3300050510 nmdc:mga06r32_1023920_c1 nmdc:mga06r32_1023920_c1_154_756 197
80 3300050510 nmdc:mga06r32_540188_c1 nmdc:mga06r32_540188_c1_321_965 197
81 3300050512 nmdc:mga0n895_16714_c1 nmdc:mga0n895_16714_c1_4259_4879 197
82 3300050513 nmdc:mga0rr50_14657_c1 nmdc:mga0rr50_14657_c1_503_1123 197
83 3300050514 nmdc:mga08x19_12881_c2 nmdc:mga08x19_12881_c2_2230_2850 197
84 3300050515 nmdc:mga0a205_249616_c1 nmdc:mga0a205_249616_c1_513_1151 197
85 3300050515 nmdc:mga0a205_458679_c1 nmdc:mga0a205_458679_c1_371_991 197
86 3300005439 Ga0070711_100191545 Ga0070711_1001915453 198
87 3300005440 Ga0070705_100492267 Ga0070705_1004922672 198
88 3300005549 Ga0070704_100246963 Ga0070704_1002469633 198
89 3300006871 Ga0075434_100009949 Ga0075434_1000099499 198
90 3300025905 Ga0207685_10032306 Ga0207685_100323062 198
91 3300025936 Ga0207670_10120864 Ga0207670_101208643 198
92 3300027360 Ga0209969_1003311 Ga0209969_10033112 198
93 3300027364 Ga0209967_1002463 Ga0209967_10024632 198
94 3300027462 Ga0210000_1000637 Ga0210000_10006375 198
95 3300027471 Ga0209995_1006752 Ga0209995_10067522 198
96 3300031731 Ga0307405_10427294 Ga0307405_104272942 198
97 3300032002 Ga0307416_100334676 Ga0307416_1003346763 198
98 3300046536 Ga0495587_0424474 Ga0495587_0424474_83_697 198
99 3300047322 Ga0495680_0507006 Ga0495680_0507006_173_787 198
100 3300050512 nmdc:mga0n895_116147_c1 nmdc:mga0n895_116147_c1_1878_2519 198
101 3300050514 nmdc:mga08x19_239057_c1 nmdc:mga08x19_239057_c1_162_803 198
102 3300005444 Ga0070694_100208925 Ga0070694_1002089252 199
103 3300005471 Ga0070698_100007519 Ga0070698_1000075198 199
104 3300006844 Ga0075428_100169561 Ga0075428_1001695612 199
105 3300006847 Ga0075431_100392373 Ga0075431_1003923732 199
106 3300006852 Ga0075433_10648746 Ga0075433_106487462 199
107 3300006880 Ga0075429_100000271 Ga0075429_10000027124 199
108 3300009147 Ga0114129_10006193 Ga0114129_1000619321 199
109 3300009148 Ga0105243_10235245 Ga0105243_102352452 199
110 3300025916 Ga0207663_10098707 Ga0207663_100987072 199
111 3300050507 nmdc:mga05p37_1059_c1 nmdc:mga05p37_1059_c1_15422_16033 199
112 3300050508 nmdc:mga09592_61_c1 nmdc:mga09592_61_c1_16896_17507 199
113 3300050510 nmdc:mga06r32_5626_c1 nmdc:mga06r32_5626_c1_3654_4265 199
114 3300005354 Ga0070675_100578795 Ga0070675_1005787952 200
115 3300005440 Ga0070705_100220098 Ga0070705_1002200981 200
116 3300005441 Ga0070700_100512562 Ga0070700_1005125622 200
117 3300005458 Ga0070681_10000790 Ga0070681_100007907 200
118 3300005468 Ga0070707_101189057 Ga0070707_1011890571 200
119 3300005518 Ga0070699_100574523 Ga0070699_1005745232 200
120 3300005530 Ga0070679_100176348 Ga0070679_1001763482 200
121 3300005535 Ga0070684_100921956 Ga0070684_1009219561 200
122 3300005545 Ga0070695_100090283 Ga0070695_1000902834 200
123 3300005617 Ga0068859_100014168 Ga0068859_1000141684 200
124 3300005617 Ga0068859_100455188 Ga0068859_1004551881 200
125 3300005841 Ga0068863_100843831 Ga0068863_1008438312 200
126 3300006846 Ga0075430_100473318 Ga0075430_1004733182 200
127 3300006847 Ga0075431_100179112 Ga0075431_1001791122 200
128 3300006847 Ga0075431_100393998 Ga0075431_1003939982 200
129 3300006852 Ga0075433_10272233 Ga0075433_102722332 200
130 3300006871 Ga0075434_101206552 Ga0075434_1012065522 200
131 3300006931 Ga0097620_100014167 Ga0097620_1000141674 200
132 3300006931 Ga0097620_100455185 Ga0097620_1004551851 200
133 3300009094 Ga0111539_10032731 Ga0111539_100327313 200
134 3300009094 Ga0111539_10080149 Ga0111539_100801494 200
135 3300009148 Ga0105243_10302391 Ga0105243_103023912 200
136 3300009553 Ga0105249_10602609 Ga0105249_106026091 200
137 3300025912 Ga0207707_10042871 Ga0207707_100428713 200
138 3300025917 Ga0207660_10032377 Ga0207660_100323773 200
139 3300025921 Ga0207652_10257707 Ga0207652_102577072 200
140 3300025961 Ga0207712_10335397 Ga0207712_103353971 200
141 3300026075 Ga0207708_10589878 Ga0207708_105898782 200
142 3300026088 Ga0207641_10302303 Ga0207641_103023032 200
143 3300026095 Ga0207676_10125498 Ga0207676_101254982 200
144 3300026116 Ga0207674_10544912 Ga0207674_105449122 200
145 3300026118 Ga0207675_100661068 Ga0207675_1006610682 200
146 3300027907 Ga0207428_10136244 Ga0207428_101362441 200
147 3300035115 Ga0373941_0003835 Ga0373941_0003835_698_1306 200
148 3300035121 Ga0373960_0029353 Ga0373960_0029353_806_1414 200
149 3300035691 Ga0373931_0046606 Ga0373931_0046606_704_1312 200
150 3300035691 Ga0373931_0602623 Ga0373931_0602623_64_687 200
151 3300037471 Ga0395905_0660260 Ga0395905_0660260_281_889 200
152 3300045051 Ga0451576_0100294 Ga0451576_0100294_1763_2377 200
153 3300046459 Ga0495629_0204425 Ga0495629_0204425_335_985 200
154 3300046476 Ga0495662_0022123 Ga0495662_0022123_2021_2671 200
155 3300046517 Ga0495630_0016353 Ga0495630_0016353_1855_2505 200
156 3300046529 Ga0495652_0341266 Ga0495652_0341266_397_1047 200
157 3300046539 Ga0495621_0064635 Ga0495621_0064635_166_774 200
158 3300046663 Ga0495635_0031920 Ga0495635_0031920_1010_1660 200
159 3300046690 Ga0495624_0040123 Ga0495624_0040123_737_1387 200
160 3300047317 Ga0495604_0099264 Ga0495604_0099264_645_1295 200
161 3300049568 Ga0501031_0045363 Ga0501031_0045363_442_1056 200
162 3300049570 Ga0501033_0006772 Ga0501033_0006772_7387_8001 200
163 3300049571 Ga0501034_0327001 Ga0501034_0327001_453_1067 200
164 3300049572 Ga0501036_0001519 Ga0501036_0001519_15931_16545 200
165 3300049573 Ga0501037_0035564 Ga0501037_0035564_895_1509 200
166 3300049574 Ga0501038_0001082 Ga0501038_0001082_20086_20700 200
167 3300049575 Ga0501039_0000168 Ga0501039_0000168_21881_22495 200
168 3300049576 Ga0501040_0005928 Ga0501040_0005928_35_649 200
169 3300049577 Ga0501041_0003011 Ga0501041_0003011_7369_7983 200
170 3300049578 Ga0501042_0013075 Ga0501042_0013075_3984_4598 200
171 3300049579 Ga0501043_0135365 Ga0501043_0135365_926_1540 200
172 3300049580 Ga0501046_0000501 Ga0501046_0000501_38066_38680 200
173 3300049581 Ga0501047_0158316 Ga0501047_0158316_510_1124 200
174 3300049582 Ga0501048_0071002 Ga0501048_0071002_748_1362 200
175 3300049583 Ga0501067_0017198 Ga0501067_0017198_3287_3895 200
176 3300049584 Ga0501068_0010587 Ga0501068_0010587_2659_3273 200
177 3300049587 Ga0501071_0016723 Ga0501071_0016723_4237_4851 200
178 3300049588 Ga0501072_0002835 Ga0501072_0002835_7228_7842 200
179 3300049588 Ga0501072_0064490 Ga0501072_0064490_1460_2080 200
180 3300049590 Ga0501074_0035203 Ga0501074_0035203_2138_2752 200
181 3300049591 Ga0501075_0000046 Ga0501075_0000046_23441_24055 200
182 3300049592 Ga0501076_0004704 Ga0501076_0004704_1857_2471 200
183 3300049592 Ga0501076_0239379 Ga0501076_0239379_575_1195 200
184 3300049593 Ga0501077_0006891 Ga0501077_0006891_427_1041 200
185 3300049741 Ga0501079_0006512 Ga0501079_0006512_7259_7873 200
186 3300049742 Ga0501080_0038280 Ga0501080_0038280_902_1516 200
187 3300049743 Ga0501081_0004833 Ga0501081_0004833_8006_8620 200
188 3300049743 Ga0501081_0406326 Ga0501081_0406326_111_731 200
189 3300049744 Ga0501083_0072854 Ga0501083_0072854_889_1503 200
190 3300049822 Ga0501035_0115673 Ga0501035_0115673_616_1230 200
191 3300049823 Ga0501044_0200328 Ga0501044_0200328_1303_1917 200
192 3300049824 Ga0501045_0000436 Ga0501045_0000436_13165_13779 200
193 3300050508 nmdc:mga09592_58099_c1 nmdc:mga09592_58099_c1_370_1020 200
194 3300050509 nmdc:mga0qj67_211797_c1 nmdc:mga0qj67_211797_c1_19_624 200
195 3300050510 nmdc:mga06r32_83882_c1 nmdc:mga06r32_83882_c1_862_1476 200
196 3300050511 nmdc:mga08y16_29545_c1 nmdc:mga08y16_29545_c1_4190_4840 200
197 3300050513 nmdc:mga0rr50_323477_c1 nmdc:mga0rr50_323477_c1_623_1237 200
198 3300050515 nmdc:mga0a205_234755_c1 nmdc:mga0a205_234755_c1_748_1395 200
199 3300053077 Ga0495601_0172627 Ga0495601_0172627_167_817 200
200 3300054114 Ga0501084_0006816 Ga0501084_0006816_8115_8729 200
201 3300060353 Ga0501082_0001259 Ga0501082_0001259_852_1466 200
202 3300061734 Ga0530510_0011848 Ga0530510_0011848_3846_4460 200
203 3300005330 Ga0070690_100000148 Ga0070690_10000014813 201
204 3300005334 Ga0068869_100000103 Ga0068869_10000010322 201
205 3300005340 Ga0070689_100001211 Ga0070689_10000121114 201
206 3300005340 Ga0070689_100466408 Ga0070689_1004664082 201
207 3300005343 Ga0070687_100000105 Ga0070687_10000010516 201
208 3300005343 Ga0070687_100257175 Ga0070687_1002571752 201
209 3300005343 Ga0070687_100744990 Ga0070687_1007449901 201
210 3300005345 Ga0070692_10002047 Ga0070692_100020473 201
211 3300005438 Ga0070701_10004680 Ga0070701_100046805 201
212 3300005545 Ga0070695_100000259 Ga0070695_10000025910 201
213 3300005545 Ga0070695_100107288 Ga0070695_1001072882 201
214 3300005547 Ga0070693_100000101 Ga0070693_10000010114 201
215 3300005547 Ga0070693_100126323 Ga0070693_1001263232 201
216 3300005563 Ga0068855_100001986 Ga0068855_10000198618 201
217 3300005578 Ga0068854_100020898 Ga0068854_1000208984 201
218 3300005614 Ga0068856_100034678 Ga0068856_1000346782 201
219 3300005615 Ga0070702_100174272 Ga0070702_1001742722 201
220 3300005617 Ga0068859_100004200 Ga0068859_1000042002 201
221 3300005719 Ga0068861_100000826 Ga0068861_10000082618 201
222 3300005840 Ga0068870_10178142 Ga0068870_101781422 201
223 3300005841 Ga0068863_100223527 Ga0068863_1002235272 201
224 3300005842 Ga0068858_100002013 Ga0068858_1000020134 201
225 3300005843 Ga0068860_100001309 Ga0068860_10000130916 201
226 3300005843 Ga0068860_100088352 Ga0068860_1000883523 201
227 3300005844 Ga0068862_100033569 Ga0068862_1000335693 201
228 3300006237 Ga0097621_100000106 Ga0097621_10000010617 201
229 3300006358 Ga0068871_100016457 Ga0068871_1000164574 201
230 3300006844 Ga0075428_100000134 Ga0075428_10000013429 201
231 3300006852 Ga0075433_10009655 Ga0075433_100096553 201
232 3300006871 Ga0075434_100000593 Ga0075434_10000059329 201
233 3300006880 Ga0075429_100000955 Ga0075429_1000009554 201
234 3300006881 Ga0068865_100000231 Ga0068865_10000023111 201
235 3300006914 Ga0075436_100007710 Ga0075436_1000077103 201
236 3300006931 Ga0097620_100004200 Ga0097620_1000042002 201
237 3300006931 Ga0097620_100149062 Ga0097620_1001490623 201
238 3300007076 Ga0075435_100077188 Ga0075435_1000771883 201
239 3300009092 Ga0105250_10032592 Ga0105250_100325923 201
240 3300009094 Ga0111539_10063590 Ga0111539_100635903 201
241 3300009094 Ga0111539_10186410 Ga0111539_101864103 201
242 3300009094 Ga0111539_10349193 Ga0111539_103491931 201
243 3300009098 Ga0105245_10000347 Ga0105245_1000034720 201
244 3300009098 Ga0105245_10168628 Ga0105245_101686282 201
245 3300009101 Ga0105247_10467247 Ga0105247_104672471 201
246 3300009147 Ga0114129_10023204 Ga0114129_100232044 201
247 3300009148 Ga0105243_10000535 Ga0105243_1000053525 201
248 3300009174 Ga0105241_10241263 Ga0105241_102412632 201
249 3300009176 Ga0105242_10000905 Ga0105242_100009057 201
250 3300009176 Ga0105242_10001418 Ga0105242_1000141817 201
251 3300009177 Ga0105248_10221641 Ga0105248_102216413 201
252 3300009553 Ga0105249_10001515 Ga0105249_100015154 201
253 3300010375 Ga0105239_10647571 Ga0105239_106475712 201
254 3300011119 Ga0105246_10129300 Ga0105246_101293001 201
255 3300013297 Ga0157378_10000447 Ga0157378_1000044719 201
256 3300014326 Ga0157380_10320089 Ga0157380_103200892 201
257 3300014745 Ga0157377_10072821 Ga0157377_100728212 201
258 3300014745 Ga0157377_10385433 Ga0157377_103854331 201
259 3300014968 Ga0157379_10728039 Ga0157379_107280391 201
260 3300014969 Ga0157376_10033483 Ga0157376_100334832 201
261 3300025885 Ga0207653_10018261 Ga0207653_100182612 201
262 3300025899 Ga0207642_10007904 Ga0207642_100079043 201
263 3300025908 Ga0207643_10162223 Ga0207643_101622232 201
264 3300025912 Ga0207707_10068136 Ga0207707_100681363 201
265 3300025917 Ga0207660_10003601 Ga0207660_100036017 201
266 3300025918 Ga0207662_10000109 Ga0207662_1000010911 201
267 3300025921 Ga0207652_10107500 Ga0207652_101075002 201
268 3300025926 Ga0207659_10097882 Ga0207659_100978822 201
269 3300025927 Ga0207687_10001220 Ga0207687_1000122010 201
270 3300025931 Ga0207644_10389081 Ga0207644_103890812 201
271 3300025933 Ga0207706_10287129 Ga0207706_102871291 201
272 3300025934 Ga0207686_10003414 Ga0207686_100034147 201
273 3300025935 Ga0207709_10001794 Ga0207709_100017944 201
274 3300025936 Ga0207670_10026770 Ga0207670_100267704 201
275 3300025936 Ga0207670_10684354 Ga0207670_106843541 201
276 3300025938 Ga0207704_10001838 Ga0207704_100018383 201
277 3300025941 Ga0207711_10124004 Ga0207711_101240041 201
278 3300025942 Ga0207689_10000532 Ga0207689_1000053216 201
279 3300025949 Ga0207667_10053712 Ga0207667_100537124 201
280 3300025961 Ga0207712_10002829 Ga0207712_100028294 201
281 3300025981 Ga0207640_10048593 Ga0207640_100485933 201
282 3300026023 Ga0207677_10002506 Ga0207677_100025063 201
283 3300026035 Ga0207703_10011836 Ga0207703_100118363 201
284 3300026075 Ga0207708_10000712 Ga0207708_100007123 201
285 3300026078 Ga0207702_10006394 Ga0207702_100063944 201
286 3300026088 Ga0207641_10342461 Ga0207641_103424612 201
287 3300026089 Ga0207648_10000505 Ga0207648_1000050521 201
288 3300026118 Ga0207675_100000625 Ga0207675_10000062535 201
289 3300026118 Ga0207675_101095812 Ga0207675_1010958121 201
290 3300026142 Ga0207698_10576904 Ga0207698_105769042 201
291 3300027907 Ga0207428_10006818 Ga0207428_100068184 201
292 3300027907 Ga0207428_10407639 Ga0207428_104076391 201
293 3300028380 Ga0268265_10003684 Ga0268265_100036848 201
294 3300028381 Ga0268264_10004078 Ga0268264_100040786 201
295 3300028381 Ga0268264_10314235 Ga0268264_103142352 201
296 3300031995 Ga0307409_100395095 Ga0307409_1003950953 201
297 3300032005 Ga0307411_10055576 Ga0307411_100555762 201
298 3300034816 Ga0373930_0007408 Ga0373930_0007408_333_956 201
299 3300034817 Ga0373948_0000598 Ga0373948_0000598_836_1459 201
300 3300034817 Ga0373948_0027773 Ga0373948_0027773_299_922 201
301 3300035084 Ga0373928_0004346 Ga0373928_0004346_1047_1670 201
302 3300035088 Ga0373940_0009465 Ga0373940_0009465_303_926 201
303 3300035090 Ga0373949_0005757 Ga0373949_0005757_1346_1969 201
304 3300035091 Ga0373951_0028316 Ga0373951_0028316_33_656 201
305 3300035112 Ga0373932_0006499 Ga0373932_0006499_1020_1643 201
306 3300035113 Ga0373936_0013970 Ga0373936_0013970_281_931 201
307 3300035114 Ga0373939_0001027 Ga0373939_0001027_1064_1687 201
308 3300035116 Ga0373945_0003206 Ga0373945_0003206_1292_1942 201
309 3300035118 Ga0373954_0054081 Ga0373954_0054081_735_1355 201
310 3300035119 Ga0373956_0086693 Ga0373956_0086693_52_672 201
311 3300035121 Ga0373960_0041752 Ga0373960_0041752_163_786 201
312 3300035170 Ga0373943_0005804 Ga0373943_0005804_3933_4583 201
313 3300035171 Ga0373946_0003055 Ga0373946_0003055_4301_4951 201
314 3300035172 Ga0373955_0365428 Ga0373955_0365428_178_828 201
315 3300035242 Ga0373962_0007763 Ga0373962_0007763_160_783 201
316 3300035410 Ga0373924_0002459 Ga0373924_0002459_1529_2206 201
317 3300035691 Ga0373931_0000483 Ga0373931_0000483_9202_9825 201
318 3300035691 Ga0373931_0023496 Ga0373931_0023496_1865_2488 201
319 3300035692 Ga0373935_0010422 Ga0373935_0010422_2126_2776 201
320 3300035695 Ga0373927_0053308 Ga0373927_0053308_888_1538 201
321 3300035724 Ga0373933_0046950 Ga0373933_0046950_230_850 201
322 3300035725 Ga0373947_0359373 Ga0373947_0359373_320_943 201
323 3300036401 Ga0373937_0001839 Ga0373937_0001839_3556_4233 201
324 3300037068 Ga0373925_0115925 Ga0373925_0115925_335_985 201
325 3300042435 Ga0439434_0159997 Ga0439434_0159997_87_704 201
326 3300042876 Ga0451577_0149623 Ga0451577_0149623_1235_1858 201
327 3300045051 Ga0451576_0004079 Ga0451576_0004079_3655_4278 201
328 3300045051 Ga0451576_0035246 Ga0451576_0035246_939_1562 201
329 3300045051 Ga0451576_0240475 Ga0451576_0240475_40_666 201
330 3300045051 Ga0451576_0351779 Ga0451576_0351779_13_636 201
331 3300046455 Ga0495603_0013227 Ga0495603_0013227_3821_4471 201
332 3300046472 Ga0495580_0112413 Ga0495580_0112413_1087_1737 201
333 3300046475 Ga0495639_0009054 Ga0495639_0009054_2780_3430 201
334 3300046517 Ga0495630_0336884 Ga0495630_0336884_473_1123 201
335 3300046526 Ga0495666_0021756 Ga0495666_0021756_577_1227 201
336 3300046529 Ga0495652_0188574 Ga0495652_0188574_149_826 201
337 3300046535 Ga0495586_0011068 Ga0495586_0011068_3663_4313 201
338 3300046537 Ga0495598_0023632 Ga0495598_0023632_142_756 201
339 3300046559 Ga0495667_0038999 Ga0495667_0038999_123_743 201
340 3300046615 Ga0495656_0023166 Ga0495656_0023166_1498_2112 201
341 3300046681 Ga0495647_0013125 Ga0495647_0013125_1261_1911 201
342 3300046683 Ga0495658_0014162 Ga0495658_0014162_1491_2141 201
343 3300047321 Ga0495676_0039942 Ga0495676_0039942_510_1160 201
344 3300049576 Ga0501040_0436371 Ga0501040_0436371_13_654 201
345 3300050507 nmdc:mga05p37_13652_c1 nmdc:mga05p37_13652_c1_5315_5938 201
346 3300050508 nmdc:mga09592_438_c1 nmdc:mga09592_438_c1_24780_25403 201
347 3300050510 nmdc:mga06r32_542710_c1 nmdc:mga06r32_542710_c1_427_1041 201
348 3300050511 nmdc:mga08y16_149524_c1 nmdc:mga08y16_149524_c1_591_1226 201
349 3300050511 nmdc:mga08y16_2424_c1 nmdc:mga08y16_2424_c1_16484_17107 201
350 3300050511 nmdc:mga08y16_588693_c1 nmdc:mga08y16_588693_c1_484_1110 201
351 3300050512 nmdc:mga0n895_231047_c1 nmdc:mga0n895_231047_c1_460_1083 201
352 3300050512 nmdc:mga0n895_24918_c1 nmdc:mga0n895_24918_c1_1265_1900 201
353 3300050514 nmdc:mga08x19_34762_c1 nmdc:mga08x19_34762_c1_2528_3148 201
354 3300050515 nmdc:mga0a205_11673_c1 nmdc:mga0a205_11673_c1_1357_1992 201
355 3300005330 Ga0070690_100102933 Ga0070690_1001029332 202
356 3300005336 Ga0070680_100252946 Ga0070680_1002529461 202
357 3300005467 Ga0070706_100181005 Ga0070706_1001810053 202
358 3300005518 Ga0070699_100084515 Ga0070699_1000845152 202
359 3300005535 Ga0070684_100307192 Ga0070684_1003071922 202
360 3300005536 Ga0070697_100072789 Ga0070697_1000727895 202
361 3300005545 Ga0070695_100011635 Ga0070695_1000116354 202
362 3300005546 Ga0070696_100020737 Ga0070696_1000207378 202
363 3300006237 Ga0097621_100029641 Ga0097621_1000296413 202
364 3300006358 Ga0068871_100018352 Ga0068871_1000183526 202
365 3300006914 Ga0075436_100003269 Ga0075436_10000326910 202
366 3300006914 Ga0075436_100007082 Ga0075436_1000070826 202
367 3300007076 Ga0075435_100135489 Ga0075435_1001354894 202
368 3300025910 Ga0207684_10110876 Ga0207684_101108763 202
369 3300025918 Ga0207662_10146942 Ga0207662_101469423 202
370 3300025936 Ga0207670_10290899 Ga0207670_102908991 202
371 3300025944 Ga0207661_10085851 Ga0207661_100858514 202
372 3300045051 Ga0451576_0515641 Ga0451576_0515641_490_1110 202
373 3300046525 Ga0495663_0054832 Ga0495663_0054832_586_1197 202
374 3300046528 Ga0495642_0262036 Ga0495642_0262036_60_671 202
375 3300046684 Ga0495669_0002704 Ga0495669_0002704_3199_3810 202
376 3300046684 Ga0495669_0210245 Ga0495669_0210245_117_737 202
377 3300049572 Ga0501036_0090031 Ga0501036_0090031_1455_2084 202
378 3300049573 Ga0501037_0431657 Ga0501037_0431657_153_773 202
379 3300049575 Ga0501039_0074536 Ga0501039_0074536_624_1253 202
380 3300049577 Ga0501041_0052131 Ga0501041_0052131_595_1224 202
381 3300049578 Ga0501042_0202132 Ga0501042_0202132_95_724 202
382 3300049579 Ga0501043_0101630 Ga0501043_0101630_372_1001 202
383 3300049582 Ga0501048_0117901 Ga0501048_0117901_665_1294 202
384 3300049587 Ga0501071_0076987 Ga0501071_0076987_1017_1646 202
385 3300049587 Ga0501071_0219580 Ga0501071_0219580_41_661 202
386 3300049588 Ga0501072_0016776 Ga0501072_0016776_3775_4404 202
387 3300049589 Ga0501073_0137248 Ga0501073_0137248_34_663 202
388 3300049590 Ga0501074_0087050 Ga0501074_0087050_932_1561 202
389 3300049591 Ga0501075_0012948 Ga0501075_0012948_1167_1796 202
390 3300049591 Ga0501075_0046477 Ga0501075_0046477_954_1574 202
391 3300049592 Ga0501076_0015921 Ga0501076_0015921_2066_2695 202
392 3300049592 Ga0501076_0028921 Ga0501076_0028921_2890_3510 202
393 3300049593 Ga0501077_0051590 Ga0501077_0051590_1105_1734 202
394 3300049593 Ga0501077_0163351 Ga0501077_0163351_274_894 202
395 3300049741 Ga0501079_0042566 Ga0501079_0042566_1101_1730 202
396 3300049743 Ga0501081_0004168 Ga0501081_0004168_963_1583 202
397 3300049744 Ga0501083_0045645 Ga0501083_0045645_947_1576 202
398 3300049824 Ga0501045_0012202 Ga0501045_0012202_5077_5706 202
399 3300050514 nmdc:mga08x19_7002_c1 nmdc:mga08x19_7002_c1_2174_2788 202
400 3300050515 nmdc:mga0a205_30448_c1 nmdc:mga0a205_30448_c1_517_1125 202
401 3300054114 Ga0501084_0197076 Ga0501084_0197076_973_1602 202
402 3300060353 Ga0501082_0044906 Ga0501082_0044906_1080_1709 202
403 3300060353 Ga0501082_0283137 Ga0501082_0283137_42_662 202
404 3300061734 Ga0530510_0068286 Ga0530510_0068286_449_1078 202
405 3300005444 Ga0070694_100023655 Ga0070694_1000236553 203
406 3300005545 Ga0070695_100050132 Ga0070695_1000501323 203
407 3300005546 Ga0070696_100105391 Ga0070696_1001053913 203
408 3300005549 Ga0070704_100024044 Ga0070704_1000240444 203
409 3300005844 Ga0068862_100315047 Ga0068862_1003150472 203
410 3300006852 Ga0075433_10263397 Ga0075433_102633973 203
411 3300007076 Ga0075435_100002111 Ga0075435_1000021113 203
412 3300025907 Ga0207645_10246457 Ga0207645_102464572 203
413 3300025925 Ga0207650_10384890 Ga0207650_103848902 203
414 3300027462 Ga0210000_1003102 Ga0210000_10031024 203
415 3300032002 Ga0307416_100455048 Ga0307416_1004550481 203
416 3300032005 Ga0307411_10203651 Ga0307411_102036512 203
417 3300036401 Ga0373937_0001291 Ga0373937_0001291_12453_13121 203
418 3300038996 Ga0242420_037789 Ga0242420_037789_186_797 203
419 3300041404 Ga0439436_0104444 Ga0439436_0104444_53_667 203
420 3300041406 Ga0439439_0037543 Ga0439439_0037543_392_1006 203
421 3300046462 Ga0495651_0237030 Ga0495651_0237030_354_977 203
422 3300048088 Ga0495602_0598902 Ga0495602_0598902_12_635 203
423 3300050509 nmdc:mga0qj67_278368_c1 nmdc:mga0qj67_278368_c1_362_985 203
424 3300050513 nmdc:mga0rr50_52459_c1 nmdc:mga0rr50_52459_c1_856_1512 203
425 3300050514 nmdc:mga08x19_158475_c1 nmdc:mga08x19_158475_c1_724_1362 203
426 3300059426 Ga0590077_023352 Ga0590077_023352_221_898 203
427 3300005330 Ga0070690_100330720 Ga0070690_1003307202 204
428 3300005338 Ga0068868_100724191 Ga0068868_1007241911 204
429 3300005354 Ga0070675_100031722 Ga0070675_1000317223 204
430 3300005364 Ga0070673_100210043 Ga0070673_1002100432 204
431 3300005440 Ga0070705_100050267 Ga0070705_1000502672 204
432 3300005441 Ga0070700_100006464 Ga0070700_1000064644 204
433 3300005441 Ga0070700_100401626 Ga0070700_1004016262 204
434 3300005457 Ga0070662_100398048 Ga0070662_1003980482 204
435 3300005459 Ga0068867_100000441 Ga0068867_1000004414 204
436 3300005543 Ga0070672_100203609 Ga0070672_1002036092 204
437 3300005544 Ga0070686_100635517 Ga0070686_1006355171 204
438 3300005545 Ga0070695_100175240 Ga0070695_1001752402 204
439 3300005615 Ga0070702_100094609 Ga0070702_1000946093 204
440 3300005718 Ga0068866_10089639 Ga0068866_100896392 204
441 3300005719 Ga0068861_100006057 Ga0068861_1000060574 204
442 3300005719 Ga0068861_100052305 Ga0068861_1000523053 204
443 3300005719 Ga0068861_100504100 Ga0068861_1005041001 204
444 3300005844 Ga0068862_100007502 Ga0068862_1000075028 204
445 3300005844 Ga0068862_100170415 Ga0068862_1001704153 204
446 3300006844 Ga0075428_100332189 Ga0075428_1003321893 204
447 3300006847 Ga0075431_100260871 Ga0075431_1002608713 204
448 3300006881 Ga0068865_100015043 Ga0068865_1000150435 204
449 3300009094 Ga0111539_10263245 Ga0111539_102632453 204
450 3300009148 Ga0105243_10009085 Ga0105243_100090856 204
451 3300009553 Ga0105249_10065151 Ga0105249_100651513 204
452 3300014326 Ga0157380_10036817 Ga0157380_100368173 204
453 3300025899 Ga0207642_10065474 Ga0207642_100654742 204
454 3300025908 Ga0207643_10042106 Ga0207643_100421063 204
455 3300025918 Ga0207662_10100672 Ga0207662_101006721 204
456 3300025923 Ga0207681_10009140 Ga0207681_100091405 204
457 3300025926 Ga0207659_10453369 Ga0207659_104533692 204
458 3300025935 Ga0207709_10017865 Ga0207709_100178654 204
459 3300025936 Ga0207670_10176230 Ga0207670_101762302 204
460 3300025937 Ga0207669_10012921 Ga0207669_100129213 204
461 3300025938 Ga0207704_10012020 Ga0207704_100120203 204
462 3300025940 Ga0207691_10092168 Ga0207691_100921682 204
463 3300025961 Ga0207712_10009606 Ga0207712_100096064 204
464 3300025972 Ga0207668_10011102 Ga0207668_100111025 204
465 3300026075 Ga0207708_10019272 Ga0207708_100192725 204
466 3300026089 Ga0207648_10002083 Ga0207648_100020839 204
467 3300026118 Ga0207675_100000760 Ga0207675_1000007607 204
468 3300026118 Ga0207675_100115594 Ga0207675_1001155944 204
469 3300027907 Ga0207428_10044980 Ga0207428_100449803 204
470 3300028380 Ga0268265_10006319 Ga0268265_100063196 204
471 3300031548 Ga0307408_100544112 Ga0307408_1005441122 204
472 3300031911 Ga0307412_10224288 Ga0307412_102242882 204
473 3300032005 Ga0307411_10288948 Ga0307411_102889483 204
474 3300035112 Ga0373932_0039800 Ga0373932_0039800_702_1328 204
475 3300050511 nmdc:mga08y16_49560_c1 nmdc:mga08y16_49560_c1_2129_2755 204
476 3300050511 nmdc:mga08y16_77372_c1 nmdc:mga08y16_77372_c1_2004_2642 204
477 3300003503 JGI26141J51220_1004571 JGI26141J51220_10045712 205
478 3300006844 Ga0075428_100209012 Ga0075428_1002090122 205
479 3300006846 Ga0075430_100136869 Ga0075430_1001368691 205
480 3300006847 Ga0075431_100088136 Ga0075431_1000881363 205
481 3300006880 Ga0075429_100016200 Ga0075429_1000162004 205
482 3300027471 Ga0209995_1010945 Ga0209995_10109453 205
483 3300027682 Ga0209971_1007160 Ga0209971_10071603 205
484 3300027695 Ga0209966_1008965 Ga0209966_10089652 205
485 3300027876 Ga0209974_10046999 Ga0209974_100469992 205
486 3300035207 Ga0373942_0006896 Ga0373942_0006896_556_1293 205
487 3300041410 Ga0439461_0056042 Ga0439461_0056042_148_765 205
488 3300042001 Ga0439441_000107 Ga0439441_000107_1104_1724 205
489 3300042001 Ga0439441_004278 Ga0439441_004278_1128_1745 205
490 3300042003 Ga0439443_002781 Ga0439443_002781_815_1435 205
491 3300042013 Ga0439456_071711 Ga0439456_071711_68_685 205
492 3300042015 Ga0439462_0101862 Ga0439462_0101862_118_735 205
493 3300042436 Ga0439435_0000155 Ga0439435_0000155_3328_3948 205
494 3300042436 Ga0439435_0021342 Ga0439435_0021342_445_1062 205
495 3300049570 Ga0501033_0105917 Ga0501033_0105917_922_1542 205
496 3300049572 Ga0501036_0035515 Ga0501036_0035515_1460_2080 205
497 3300049573 Ga0501037_0271377 Ga0501037_0271377_475_1092 205
498 3300049574 Ga0501038_0149327 Ga0501038_0149327_823_1443 205
499 3300049575 Ga0501039_0025260 Ga0501039_0025260_1439_2059 205
500 3300049575 Ga0501039_0061710 Ga0501039_0061710_1542_2162 205
501 3300049575 Ga0501039_0068050 Ga0501039_0068050_1115_1732 205
502 3300049576 Ga0501040_0103527 Ga0501040_0103527_825_1445 205
503 3300049576 Ga0501040_0157887 Ga0501040_0157887_647_1267 205
504 3300049577 Ga0501041_0020525 Ga0501041_0020525_3210_3827 205
505 3300049577 Ga0501041_0038361 Ga0501041_0038361_677_1297 205
506 3300049578 Ga0501042_0062155 Ga0501042_0062155_952_1569 205
507 3300049580 Ga0501046_0070470 Ga0501046_0070470_1752_2372 205
508 3300049582 Ga0501048_0096591 Ga0501048_0096591_105_788 205
509 3300049582 Ga0501048_0179546 Ga0501048_0179546_641_1258 205
510 3300049582 Ga0501048_0464819 Ga0501048_0464819_184_804 205
511 3300049587 Ga0501071_0034607 Ga0501071_0034607_1831_2451 205
512 3300049587 Ga0501071_0038597 Ga0501071_0038597_277_960 205
513 3300049588 Ga0501072_0000728 Ga0501072_0000728_2112_2732 205
514 3300049588 Ga0501072_0164930 Ga0501072_0164930_228_911 205
515 3300049590 Ga0501074_0107598 Ga0501074_0107598_1010_1693 205
516 3300049591 Ga0501075_0017641 Ga0501075_0017641_1917_2537 205
517 3300049591 Ga0501075_0489320 Ga0501075_0489320_242_862 205
518 3300049592 Ga0501076_0001789 Ga0501076_0001789_2656_3276 205
519 3300049592 Ga0501076_0158177 Ga0501076_0158177_1067_1750 205
520 3300049592 Ga0501076_0630981 Ga0501076_0630981_223_843 205
521 3300049741 Ga0501079_0183646 Ga0501079_0183646_248_868 205
522 3300049743 Ga0501081_0076684 Ga0501081_0076684_1304_1924 205
523 3300049824 Ga0501045_0075826 Ga0501045_0075826_131_814 205
524 3300049824 Ga0501045_0084253 Ga0501045_0084253_970_1590 205
525 3300050508 nmdc:mga09592_40811_c1 nmdc:mga09592_40811_c1_1623_2240 205
526 3300050509 nmdc:mga0qj67_12994_c1 nmdc:mga0qj67_12994_c1_2592_3209 205
527 3300050509 nmdc:mga0qj67_87999_c1 nmdc:mga0qj67_87999_c1_1048_1665 205
528 3300050510 nmdc:mga06r32_146177_c1 nmdc:mga06r32_146177_c1_1071_1688 205
529 3300050510 nmdc:mga06r32_633175_c1 nmdc:mga06r32_633175_c1_109_726 205
530 3300054114 Ga0501084_0012160 Ga0501084_0012160_2059_2679 205
531 3300054114 Ga0501084_0108881 Ga0501084_0108881_851_1534 205
532 3300060353 Ga0501082_0079044 Ga0501082_0079044_1994_2614 205
533 3300061734 Ga0530510_0000342 Ga0530510_0000342_3719_4339 205
534 3300061734 Ga0530510_0319153 Ga0530510_0319153_39_722 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02622

DUF179

Uncharacterized ACR, COG1678

38

191

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ew0-assembly1.cif.gz_A x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1. 0.793 29 183
2haf-assembly1.cif.gz_A crystal structure of a putative translation repressor from vibrio cholerae 0.7538 24 187
2ew0-assembly1.cif.gz_A x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1. 0.71 29 183
2mui-assembly1.cif.gz_A solution structure of the algh protein from pseudomonas aeruginosa, pa0405, upf0301 0.6762 21 204
2haf-assembly1.cif.gz_A crystal structure of a putative translation repressor from vibrio cholerae 0.6759 24 187
ID Description Score Start End Superfamily
af_Q7G645_112_287_3.40.1740.10 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.7889 27 184 3.40.1740.10
2ew0A00 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.7867 29 183 3.40.1740.10
af_P0A8W5_4_171_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7833 27 183 3.40.50.1000
af_A0A1D6G7F1_154_345_3.40.1740.10 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.7788 29 187 3.40.1740.10
af_P0A8W5_4_171_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7343 27 183 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A537E1G2-F1-model_v4 YqgE/AlgH family protein 0.8963 20 195 GO:0005829
AF-A0A536XXI8-F1-model_v4 YqgE/AlgH family protein 0.893 21 193 GO:0005829
AF-A0A521YMU9-F1-model_v4 YqgE/AlgH family protein 0.8817 21 198 GO:0005829
AF-A0A536TQB7-F1-model_v4 YqgE/AlgH family protein 0.8758 20 196 GO:0005829
AF-A0A536X7L8-F1-model_v4 YqgE/AlgH family protein 0.875 44 195

Feature Viewer

pLDDT pTM Quality
73.61 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map