F460561

General Info

Members Datasets Scaffolds Average Seq Length
534 219 1068 206

Family's Representative Sequence

Representative Sequence 3300042011|Ga0439454_017448|Ga0439454_017448_26_787
Length 253
Sequence MQLYKGLLLRAFCTSIAAIQQPKLAIREKFFGTKDKMSLHLLTIWLNRMVNKEKDKSTEEKILSAAKKVFVRKGMAGARMQDIADEAGINKALLHYYFRNKEKLFEVIFMEAASKLFPRINEVFTSDLPLFEKIESFCSEYITVVSENPYLPLFVLNEINQDPEYFLQKVWSGQSKPQPXXXXQQIEREVKKGTIKKISPVSLLMNLVSLTIFPFVAKPMFQKNLGLDELQFRSIMEQRKKEIPKFIIDSIRK

Samples

Sample ID Description Type Environment
1 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 0.75
Rhizosphere 98.31
Stem 0
Stem Tuber 0
Unclassified 15.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439454_017448 3300042011 Bacteria 1025
2 JGI24741J21665_1025945 3300001915 Bacteria 893
3 JGI24751J29686_10002322 3300002459 Bacteria 3841
4 JGI24751J29686_10002413 3300002459 Bacteria 3767
5 Ga0065712_10004787 3300005290 Bacteria 3759
6 Ga0065712_10162696 3300005290 Bacteria 1291
7 Ga0065712_10188549 3300005290 Bacteria 1159
8 Ga0065715_10268983 3300005293 Unclassified 1116
9 Ga0070658_10069542 3300005327 Bacteria 2880
10 Ga0070658_10608070 3300005327 Bacteria 947
11 Ga0070676_10155725 3300005328 Bacteria 1466
12 Ga0070683_100002306 3300005329 Bacteria 15135
13 Ga0070683_100015970 3300005329 Bacteria 6606
14 Ga0070683_100626400 3300005329 Bacteria 1030
15 Ga0070690_100024488 3300005330 Unclassified 3710
16 Ga0070690_100050564 3300005330 Bacteria 2652
17 Ga0070670_100009051 3300005331 Bacteria 8507
18 Ga0070670_100021498 3300005331 Bacteria 5550
19 Ga0070670_100108407 3300005331 Bacteria 2393
20 Ga0070670_100287097 3300005331 Unclassified 1437
21 Ga0070670_100506809 3300005331 Bacteria 1074
22 Ga0070670_100909115 3300005331 Bacteria 798
23 Ga0068869_100028430 3300005334 Bacteria 3907
24 Ga0068869_100049314 3300005334 Bacteria 3047
25 Ga0068869_100057141 3300005334 Bacteria 2848
26 Ga0068869_100069906 3300005334 Unclassified 2597
27 Ga0070666_10038111 3300005335 Unclassified 3198
28 Ga0070666_10138750 3300005335 Bacteria 1693
29 Ga0070666_10170691 3300005335 Bacteria 1523
30 Ga0070680_100017166 3300005336 Bacteria 5703
31 Ga0070680_100052453 3300005336 Bacteria 3329
32 Ga0070680_100076714 3300005336 Bacteria 2751
33 Ga0070680_100347752 3300005336 Unclassified 1260
34 Ga0070682_100072795 3300005337 Unclassified 2203
35 Ga0068868_100001063 3300005338 Bacteria 18804
36 Ga0068868_100022140 3300005338 Unclassified 4793
37 Ga0068868_100046819 3300005338 Bacteria 3385
38 Ga0070689_100005751 3300005340 Bacteria 8503
39 Ga0070689_100019100 3300005340 Bacteria 5062
40 Ga0070689_100025849 3300005340 Bacteria 4414
41 Ga0070661_100000802 3300005344 Bacteria 22567
42 Ga0070661_100009511 3300005344 Bacteria 6733
43 Ga0070661_100368769 3300005344 Unclassified 1130
44 Ga0070661_100389609 3300005344 Unclassified 1100
45 Ga0070668_100010520 3300005347 Bacteria 6878
46 Ga0070668_100015099 3300005347 Bacteria 5770
47 Ga0070668_100111849 3300005347 Bacteria 2174
48 Ga0070669_100009067 3300005353 Bacteria 7094
49 Ga0070669_100096418 3300005353 Bacteria 2225
50 Ga0070675_100067460 3300005354 Unclassified 2960
51 Ga0070675_100180745 3300005354 Bacteria 1824
52 Ga0070671_100067658 3300005355 Unclassified 2978
53 Ga0070671_100293403 3300005355 Unclassified 1384
54 Ga0070671_100387595 3300005355 Bacteria 1194
55 Ga0070671_100770217 3300005355 Bacteria 837
56 Ga0070674_100056846 3300005356 Bacteria 2713
57 Ga0070674_100434418 3300005356 Bacteria 1080
58 Ga0070674_100556451 3300005356 Bacteria 963
59 Ga0070673_100042077 3300005364 Bacteria 3520
60 Ga0070688_100005900 3300005365 Bacteria 6485
61 Ga0070688_100037062 3300005365 Unclassified 2970
62 Ga0070688_100139119 3300005365 Bacteria 1647
63 Ga0070688_100338672 3300005365 Bacteria 1098
64 Ga0070659_100036423 3300005366 Bacteria 3837
65 Ga0070659_100053443 3300005366 Bacteria 3179
66 Ga0070667_100059799 3300005367 Bacteria 3224
67 Ga0070667_100076041 3300005367 Unclassified 2867
68 Ga0070667_100085594 3300005367 Bacteria 2703
69 Ga0070667_100579431 3300005367 Unclassified 1033
70 Ga0070667_100903978 3300005367 Bacteria 822
71 Ga0070709_10049639 3300005434 Unclassified 2625
72 Ga0070714_100005072 3300005435 Bacteria 10020
73 Ga0070714_100010482 3300005435 Bacteria 7325
74 Ga0070710_10019783 3300005437 Bacteria 3485
75 Ga0070700_100076647 3300005441 Bacteria 2148
76 Ga0070700_100370111 3300005441 Bacteria 1068
77 Ga0070663_100421686 3300005455 Bacteria 1095
78 Ga0070678_100044598 3300005456 Bacteria 3167
79 Ga0070678_100090873 3300005456 Unclassified 2342
80 Ga0070678_100225066 3300005456 Unclassified 1561
81 Ga0070678_100622884 3300005456 Bacteria 965
82 Ga0070662_100013468 3300005457 Bacteria 5444
83 Ga0070662_100058094 3300005457 Bacteria 2814
84 Ga0070662_100306787 3300005457 Bacteria 1291
85 Ga0070681_10159026 3300005458 Bacteria 2183
86 Ga0070681_10316972 3300005458 Bacteria 1469
87 Ga0068867_100139779 3300005459 Bacteria 1892
88 Ga0068867_100175873 3300005459 Bacteria 1698
89 Ga0068867_100211334 3300005459 Bacteria 1558
90 Ga0068867_100359336 3300005459 Unclassified 1218
91 Ga0068867_100490808 3300005459 Bacteria 1054
92 Ga0068867_100703725 3300005459 Bacteria 892
93 Ga0070685_10031385 3300005466 Unclassified 2968
94 Ga0070685_10042854 3300005466 Bacteria 2585
95 Ga0070685_10142639 3300005466 Bacteria 1510
96 Ga0070698_100005585 3300005471 Bacteria 13750
97 Ga0070698_100005948 3300005471 Bacteria 13308
98 Ga0070698_100066526 3300005471 Bacteria 3627
99 Ga0070679_100001469 3300005530 Bacteria 20899
100 Ga0070679_100821684 3300005530 Bacteria 872
101 Ga0070684_100000772 3300005535 Bacteria 22197
102 Ga0070684_100004165 3300005535 Bacteria 10957
103 Ga0070684_100245603 3300005535 Bacteria 1636
104 Ga0070684_101192523 3300005535 Unclassified 716
105 Ga0068853_100001075 3300005539 Bacteria 19291
106 Ga0068853_100053760 3300005539 Bacteria 3468
107 Ga0068853_100218425 3300005539 Bacteria 1740
108 Ga0070672_100016283 3300005543 Bacteria 5320
109 Ga0070672_100460744 3300005543 Unclassified 1096
110 Ga0070686_100007568 3300005544 Bacteria 6065
111 Ga0070665_100021077 3300005548 Bacteria 6553
112 Ga0070665_100130277 3300005548 Bacteria 2517
113 Ga0068855_100211766 3300005563 Bacteria 2177
114 Ga0068855_100736558 3300005563 Bacteria 1052
115 Ga0070664_100000505 3300005564 Bacteria 29592
116 Ga0070664_100004719 3300005564 Bacteria 10933
117 Ga0070664_100033251 3300005564 Unclassified 4318
118 Ga0070664_100052458 3300005564 Bacteria 3455
119 Ga0070664_100406310 3300005564 Bacteria 1246
120 Ga0068857_100001366 3300005577 Bacteria 19225
121 Ga0068857_100033074 3300005577 Bacteria 4572
122 Ga0068857_100049806 3300005577 Unclassified 3716
123 Ga0068857_100099080 3300005577 Bacteria 2614
124 Ga0068857_100120401 3300005577 Bacteria 2363
125 Ga0068857_100209665 3300005577 Bacteria 1778
126 Ga0068854_100049621 3300005578 Unclassified 2999
127 Ga0070702_100020388 3300005615 Bacteria 3472
128 Ga0068852_100004584 3300005616 Bacteria 9786
129 Ga0068852_100188844 3300005616 Bacteria 1943
130 Ga0068852_100298341 3300005616 Bacteria 1559
131 Ga0068852_101105083 3300005616 Bacteria 813
132 Ga0068859_100027214 3300005617 Bacteria 5736
133 Ga0068859_100083156 3300005617 Bacteria 3244
134 Ga0068859_100088006 3300005617 Bacteria 3155
135 Ga0068859_100286702 3300005617 Unclassified 1739
136 Ga0068859_100985732 3300005617 Bacteria 925
137 Ga0068859_101498420 3300005617 Bacteria 744
138 Ga0068864_100054711 3300005618 Unclassified 3445
139 Ga0068864_100122411 3300005618 Bacteria 2328
140 Ga0068864_100200539 3300005618 Unclassified 1833
141 Ga0068866_10023531 3300005718 Bacteria 2868
142 Ga0068866_10080201 3300005718 Unclassified 1750
143 Ga0068861_100003722 3300005719 Bacteria 10171
144 Ga0068861_100048731 3300005719 Bacteria 3204
145 Ga0068861_100133990 3300005719 Bacteria 2014
146 Ga0068861_100135016 3300005719 Bacteria 2007
147 Ga0068861_100766819 3300005719 Unclassified 902
148 Ga0068851_10142565 3300005834 Unclassified 1304
149 Ga0068870_10278515 3300005840 Bacteria 1048
150 Ga0068863_100003170 3300005841 Bacteria 16256
151 Ga0068863_100093749 3300005841 Unclassified 2849
152 Ga0068858_100039810 3300005842 Bacteria 4357
153 Ga0068858_100216438 3300005842 Unclassified 1813
154 Ga0068860_100082198 3300005843 Bacteria 3063
155 Ga0068860_100137258 3300005843 Bacteria 2349
156 Ga0068860_100485410 3300005843 Unclassified 1232
157 Ga0068862_100001846 3300005844 Bacteria 19205
158 Ga0068862_100067354 3300005844 Bacteria 3087
159 Ga0068862_100099088 3300005844 Bacteria 2547
160 Ga0081539_10000916 3300005985 Bacteria 55685
161 Ga0081539_10018471 3300005985 Bacteria 4837
162 Ga0070717_10000765 3300006028 Bacteria 21027
163 Ga0075366_10015790 3300006195 Bacteria 4334
164 Ga0097621_100059062 3300006237 Bacteria 3139
165 Ga0097621_100061557 3300006237 Bacteria 3079
166 Ga0097621_100256057 3300006237 Bacteria 1534
167 Ga0097621_100451145 3300006237 Bacteria 1159
168 Ga0068871_100048000 3300006358 Bacteria 3444
169 Ga0068871_100085730 3300006358 Unclassified 2616
170 Ga0075428_100043655 3300006844 Bacteria 4929
171 Ga0075428_100429517 3300006844 Bacteria 1415
172 Ga0075430_100064504 3300006846 Bacteria 3077
173 Ga0075431_100005665 3300006847 Bacteria 12346
174 Ga0075431_100115808 3300006847 Bacteria 2767
175 Ga0075429_100014673 3300006880 Bacteria 6793
176 Ga0075429_100033309 3300006880 Bacteria 4476
177 Ga0075429_100081129 3300006880 Bacteria 2828
178 Ga0075429_100535019 3300006880 Bacteria 1027
179 Ga0068865_100031844 3300006881 Bacteria 3519
180 Ga0068865_100065129 3300006881 Bacteria 2566
181 Ga0068865_100548662 3300006881 Bacteria 970
182 Ga0097620_100027213 3300006931 Bacteria 5736
183 Ga0097620_100083165 3300006931 Bacteria 3244
184 Ga0097620_100088009 3300006931 Bacteria 3155
185 Ga0097620_100286709 3300006931 Unclassified 1739
186 Ga0097620_100985940 3300006931 Bacteria 925
187 Ga0097620_101498471 3300006931 Bacteria 744
188 Ga0111539_10015995 3300009094 Bacteria 9320
189 Ga0111539_10059808 3300009094 Bacteria 4517
190 Ga0111539_10082802 3300009094 Bacteria 3774
191 Ga0111539_10688375 3300009094 Bacteria 1190
192 Ga0105247_10052519 3300009101 Bacteria 2513
193 Ga0114129_10156929 3300009147 Bacteria 3111
194 Ga0105243_10135634 3300009148 Bacteria 2093
195 Ga0105241_10307920 3300009174 Bacteria 1362
196 Ga0105242_10030519 3300009176 Bacteria 4304
197 Ga0105242_10167445 3300009176 Unclassified 1929
198 Ga0105242_10184072 3300009176 Bacteria 1845
199 Ga0105242_10259437 3300009176 Bacteria 1569
200 Ga0105249_10010436 3300009553 Bacteria 8163
201 Ga0105249_10029655 3300009553 Bacteria 4942
202 Ga0105249_10069048 3300009553 Bacteria 3261
203 Ga0105249_10124188 3300009553 Bacteria 2456
204 Ga0105249_10988377 3300009553 Unclassified 910
205 Ga0105239_10137513 3300010375 Unclassified 2720
206 Ga0105239_11598967 3300010375 Unclassified 754
207 Ga0105246_10020025 3300011119 Bacteria 4288
208 Ga0105246_10046086 3300011119 Unclassified 2972
209 Ga0157373_10030138 3300013100 Bacteria 3904
210 Ga0157373_10031460 3300013100 Bacteria 3820
211 Ga0157371_10014381 3300013102 Bacteria 5973
212 Ga0157371_10028755 3300013102 Bacteria 4023
213 Ga0157371_10037665 3300013102 Unclassified 3461
214 Ga0157371_10037897 3300013102 Bacteria 3450
215 Ga0157371_10095424 3300013102 Bacteria 2108
216 Ga0157371_10125194 3300013102 Unclassified 1828
217 Ga0157371_10197921 3300013102 Unclassified 1440
218 Ga0157371_10326975 3300013102 Bacteria 1113
219 Ga0157370_10000263 3300013104 Bacteria 66700
220 Ga0157370_10043995 3300013104 Bacteria 4296
221 Ga0157370_10779300 3300013104 Bacteria 871
222 Ga0157369_10018964 3300013105 Bacteria 7705
223 Ga0157369_10144839 3300013105 Bacteria 2512
224 Ga0157369_10358010 3300013105 Bacteria 1515
225 Ga0157369_11216357 3300013105 Bacteria 769
226 Ga0157374_10002918 3300013296 Bacteria 14328
227 Ga0157374_10007884 3300013296 Bacteria 9090
228 Ga0157374_10109889 3300013296 Bacteria 2651
229 Ga0157374_10129203 3300013296 Unclassified 2444
230 Ga0157374_10209760 3300013296 Bacteria 1910
231 Ga0157378_10012333 3300013297 Bacteria 7483
232 Ga0157378_10014153 3300013297 Bacteria 6981
233 Ga0157378_10102451 3300013297 Bacteria 2615
234 Ga0157378_10341093 3300013297 Unclassified 1461
235 Ga0157378_11480574 3300013297 Bacteria 723
236 Ga0163162_10025708 3300013306 Bacteria 5821
237 Ga0163162_10065714 3300013306 Unclassified 3675
238 Ga0163162_10080280 3300013306 Bacteria 3330
239 Ga0163162_10092054 3300013306 Unclassified 3115
240 Ga0163162_10128999 3300013306 Bacteria 2637
241 Ga0163162_10136894 3300013306 Bacteria 2560
242 Ga0163162_10157430 3300013306 Bacteria 2392
243 Ga0163162_10296717 3300013306 Unclassified 1748
244 Ga0163162_10653690 3300013306 Unclassified 1175
245 Ga0157372_10044971 3300013307 Bacteria 4894
246 Ga0157372_10265586 3300013307 Bacteria 1993
247 Ga0157372_10357028 3300013307 Bacteria 1703
248 Ga0157372_10482006 3300013307 Bacteria 1446
249 Ga0157372_10699044 3300013307 Unclassified 1180
250 Ga0157372_10730537 3300013307 Bacteria 1151
251 Ga0157372_11199257 3300013307 Bacteria 877
252 Ga0157375_10011610 3300013308 Bacteria 7782
253 Ga0157375_10141767 3300013308 Bacteria 2531
254 Ga0157375_10155364 3300013308 Bacteria 2426
255 Ga0163163_10008995 3300014325 Bacteria 8899
256 Ga0163163_10093924 3300014325 Unclassified 3016
257 Ga0163163_10154925 3300014325 Bacteria 2335
258 Ga0163163_10376488 3300014325 Bacteria 1477
259 Ga0163163_10560485 3300014325 Bacteria 1205
260 Ga0157380_10020317 3300014326 Bacteria 4963
261 Ga0157380_10043757 3300014326 Bacteria 3507
262 Ga0157380_10253112 3300014326 Bacteria 1595
263 Ga0157380_10265396 3300014326 Unclassified 1562
264 Ga0157380_10505120 3300014326 Bacteria 1175
265 Ga0157377_10003612 3300014745 Bacteria 7007
266 Ga0157377_10006329 3300014745 Bacteria 5639
267 Ga0157377_10052824 3300014745 Unclassified 2296
268 Ga0157379_10021385 3300014968 Bacteria 5727
269 Ga0157379_10024716 3300014968 Bacteria 5332
270 Ga0157379_10043900 3300014968 Bacteria 3991
271 Ga0157379_10071364 3300014968 Bacteria 3107
272 Ga0157379_10796989 3300014968 Bacteria 892
273 Ga0157376_10015885 3300014969 Bacteria 5700
274 Ga0157376_10378283 3300014969 Bacteria 1363
275 Ga0157376_10509298 3300014969 Bacteria 1184
276 Ga0163161_10002549 3300017792 Bacteria 13011
277 Ga0163161_10012223 3300017792 Bacteria 5955
278 Ga0163161_10145664 3300017792 Bacteria 1796
279 Ga0163161_10208540 3300017792 Bacteria 1509
280 Ga0163161_10272871 3300017792 Unclassified 1324
281 Ga0163161_10420719 3300017792 Unclassified 1075
282 Ga0207697_10006128 3300025315 Bacteria 5491
283 Ga0207697_10038761 3300025315 Bacteria 1955
284 Ga0207697_10057560 3300025315 Unclassified 1613
285 Ga0207682_10024567 3300025893 Bacteria 2387
286 Ga0207642_10017992 3300025899 Bacteria 2702
287 Ga0207642_10068913 3300025899 Bacteria 1676
288 Ga0207642_10136903 3300025899 Bacteria 1286
289 Ga0207688_10060838 3300025901 Unclassified 2128
290 Ga0207680_10143608 3300025903 Unclassified 1584
291 Ga0207680_10163231 3300025903 Bacteria 1496
292 Ga0207680_10219551 3300025903 Bacteria 1303
293 Ga0207699_10014775 3300025906 Unclassified 4037
294 Ga0207699_10364920 3300025906 Bacteria 1022
295 Ga0207645_10000354 3300025907 Bacteria 38157
296 Ga0207645_10024656 3300025907 Bacteria 3896
297 Ga0207645_10089634 3300025907 Bacteria 1978
298 Ga0207643_10050573 3300025908 Bacteria 2357
299 Ga0207705_10013458 3300025909 Bacteria 5902
300 Ga0207654_10614520 3300025911 Bacteria 776
301 Ga0207660_10031924 3300025917 Bacteria 3632
302 Ga0207660_10228086 3300025917 Bacteria 1464
303 Ga0207660_10794357 3300025917 Unclassified 772
304 Ga0207662_10024919 3300025918 Bacteria 3444
305 Ga0207662_10353891 3300025918 Unclassified 987
306 Ga0207662_10411405 3300025918 Bacteria 919
307 Ga0207657_10011684 3300025919 Bacteria 8701
308 Ga0207657_10017212 3300025919 Bacteria 6942
309 Ga0207657_10217611 3300025919 Bacteria 1531
310 Ga0207649_10001160 3300025920 Bacteria 15873
311 Ga0207649_10007972 3300025920 Bacteria 5762
312 Ga0207652_10003426 3300025921 Bacteria 13089
313 Ga0207652_10046045 3300025921 Bacteria 3720
314 Ga0207681_10068857 3300025923 Bacteria 2460
315 Ga0207681_10137467 3300025923 Bacteria 1815
316 Ga0207681_10303615 3300025923 Bacteria 1264
317 Ga0207650_10047341 3300025925 Bacteria 3169
318 Ga0207650_10060964 3300025925 Bacteria 2815
319 Ga0207650_10206926 3300025925 Bacteria 1574
320 Ga0207650_10240182 3300025925 Unclassified 1464
321 Ga0207650_10305498 3300025925 Bacteria 1300
322 Ga0207650_10345323 3300025925 Bacteria 1223
323 Ga0207659_10086078 3300025926 Bacteria 2336
324 Ga0207700_10003696 3300025928 Bacteria 8925
325 Ga0207700_10007957 3300025928 Bacteria 6527
326 Ga0207664_10006880 3300025929 Bacteria 7861
327 Ga0207664_10055997 3300025929 Unclassified 3131
328 Ga0207644_10025302 3300025931 Unclassified 4082
329 Ga0207644_10192645 3300025931 Bacteria 1604
330 Ga0207644_10263790 3300025931 Bacteria 1378
331 Ga0207644_10401329 3300025931 Bacteria 1121
332 Ga0207690_10058342 3300025932 Bacteria 2611
333 Ga0207706_10006556 3300025933 Bacteria 10783
334 Ga0207706_10039716 3300025933 Bacteria 4173
335 Ga0207706_10062224 3300025933 Bacteria 3287
336 Ga0207706_10135521 3300025933 Bacteria 2166
337 Ga0207686_10644657 3300025934 Bacteria 837
338 Ga0207670_10141389 3300025936 Unclassified 1775
339 Ga0207670_10165121 3300025936 Bacteria 1656
340 Ga0207669_10271761 3300025937 Bacteria 1273
341 Ga0207669_10395395 3300025937 Bacteria 1081
342 Ga0207704_10044526 3300025938 Bacteria 2630
343 Ga0207704_10071969 3300025938 Unclassified 2196
344 Ga0207704_10135965 3300025938 Unclassified 1711
345 Ga0207704_10191899 3300025938 Bacteria 1487
346 Ga0207704_10565657 3300025938 Bacteria 926
347 Ga0207691_10025231 3300025940 Bacteria 5582
348 Ga0207691_10029719 3300025940 Bacteria 5110
349 Ga0207691_10133234 3300025940 Bacteria 2194
350 Ga0207691_10186480 3300025940 Unclassified 1811
351 Ga0207689_10003402 3300025942 Bacteria 14529
352 Ga0207689_10006527 3300025942 Bacteria 10294
353 Ga0207689_10038084 3300025942 Bacteria 3984
354 Ga0207689_10055671 3300025942 Bacteria 3255
355 Ga0207689_10750374 3300025942 Bacteria 824
356 Ga0207661_10000929 3300025944 Bacteria 19227
357 Ga0207661_10006780 3300025944 Bacteria 8110
358 Ga0207661_10229285 3300025944 Bacteria 1644
359 Ga0207661_10371742 3300025944 Bacteria 1293
360 Ga0207679_10000232 3300025945 Bacteria 43046
361 Ga0207679_10006857 3300025945 Bacteria 7217
362 Ga0207679_10033582 3300025945 Bacteria 3611
363 Ga0207679_10108385 3300025945 Unclassified 2187
364 Ga0207679_10133921 3300025945 Bacteria 1992
365 Ga0207667_10033896 3300025949 Bacteria 5486
366 Ga0207667_10773546 3300025949 Bacteria 958
367 Ga0207651_10028121 3300025960 Bacteria 3542
368 Ga0207651_10052142 3300025960 Bacteria 2788
369 Ga0207651_10393964 3300025960 Bacteria 1176
370 Ga0207712_10014046 3300025961 Bacteria 5140
371 Ga0207712_10031639 3300025961 Bacteria 3566
372 Ga0207712_10145468 3300025961 Bacteria 1824
373 Ga0207712_10279807 3300025961 Unclassified 1361
374 Ga0207712_10316010 3300025961 Bacteria 1287
375 Ga0207712_10491190 3300025961 Bacteria 1048
376 Ga0207668_10050700 3300025972 Unclassified 2862
377 Ga0207668_10053711 3300025972 Bacteria 2793
378 Ga0207668_10739588 3300025972 Unclassified 867
379 Ga0207640_10039254 3300025981 Bacteria 2995
380 Ga0207640_10079812 3300025981 Unclassified 2231
381 Ga0207640_10521139 3300025981 Bacteria 993
382 Ga0207658_10052125 3300025986 Unclassified 3019
383 Ga0207658_10075241 3300025986 Bacteria 2569
384 Ga0207677_10034678 3300026023 Bacteria 3270
385 Ga0207677_10059862 3300026023 Bacteria 2629
386 Ga0207677_10379418 3300026023 Bacteria 1193
387 Ga0207703_10016225 3300026035 Bacteria 5805
388 Ga0207703_10287183 3300026035 Unclassified 1496
389 Ga0207639_10084890 3300026041 Bacteria 2517
390 Ga0207639_10619977 3300026041 Bacteria 999
391 Ga0207678_10451411 3300026067 Bacteria 1117
392 Ga0207708_10219815 3300026075 Unclassified 1522
393 Ga0207708_10466552 3300026075 Bacteria 1054
394 Ga0207708_11064864 3300026075 Bacteria 704
395 Ga0207641_10004439 3300026088 Bacteria 12154
396 Ga0207641_11142859 3300026088 Bacteria 778
397 Ga0207648_10000404 3300026089 Bacteria 48036
398 Ga0207648_10001472 3300026089 Bacteria 25920
399 Ga0207648_10028636 3300026089 Bacteria 4938
400 Ga0207648_10054096 3300026089 Bacteria 3507
401 Ga0207648_10079442 3300026089 Bacteria 2861
402 Ga0207648_10203174 3300026089 Bacteria 1758
403 Ga0207648_10267386 3300026089 Bacteria 1527
404 Ga0207676_10036804 3300026095 Bacteria 3726
405 Ga0207676_10037115 3300026095 Unclassified 3711
406 Ga0207676_10099647 3300026095 Unclassified 2405
407 Ga0207676_10169086 3300026095 Bacteria 1903
408 Ga0207676_10225403 3300026095 Bacteria 1672
409 Ga0207674_10009679 3300026116 Bacteria 10985
410 Ga0207674_10064304 3300026116 Bacteria 3701
411 Ga0207674_10089594 3300026116 Bacteria 3069
412 Ga0207674_10108382 3300026116 Bacteria 2754
413 Ga0207674_10131565 3300026116 Bacteria 2465
414 Ga0207674_10174999 3300026116 Bacteria 2099
415 Ga0207674_10185949 3300026116 Bacteria 2028
416 Ga0207675_100000326 3300026118 Bacteria 45358
417 Ga0207675_100031508 3300026118 Bacteria 4938
418 Ga0207675_100037522 3300026118 Bacteria 4520
419 Ga0207675_100202430 3300026118 Bacteria 1907
420 Ga0207675_100212948 3300026118 Bacteria 1859
421 Ga0207675_100285250 3300026118 Bacteria 1605
422 Ga0207683_10003746 3300026121 Bacteria 13185
423 Ga0207683_10103551 3300026121 Bacteria 2543
424 Ga0207683_10279767 3300026121 Bacteria 1525
425 Ga0207683_10582112 3300026121 Bacteria 1035
426 Ga0207683_10897741 3300026121 Bacteria 823
427 Ga0207698_10017457 3300026142 Bacteria 4870
428 Ga0207698_10074085 3300026142 Bacteria 2714
429 Ga0207698_10628627 3300026142 Bacteria 1061
430 Ga0207428_10152627 3300027907 Bacteria 1757
431 Ga0268266_10067836 3300028379 Bacteria 3088
432 Ga0268266_10101845 3300028379 Bacteria 2532
433 Ga0268266_10777187 3300028379 Bacteria 925
434 Ga0268265_10379755 3300028380 Bacteria 1299
435 Ga0268264_10057356 3300028381 Bacteria 3258
436 Ga0268264_10083705 3300028381 Bacteria 2733
437 Ga0268264_10520434 3300028381 Bacteria 1163
438 Ga0265338_10245687 3300028800 Bacteria 1323
439 Ga0265324_10068561 3300029957 Bacteria 1209
440 Ga0307408_100101076 3300031548 Bacteria 2197
441 Ga0307405_10002560 3300031731 Bacteria 8068
442 Ga0307410_10058893 3300031852 Bacteria 2620
443 Ga0307406_10163752 3300031901 Bacteria 1602
444 Ga0307407_10006466 3300031903 Bacteria 5211
445 Ga0307412_10003625 3300031911 Bacteria 8578
446 Ga0307409_100001406 3300031995 Bacteria 11777
447 Ga0307416_100032115 3300032002 Bacteria 3962
448 Ga0307414_10007419 3300032004 Bacteria 6161
449 Ga0307411_10015740 3300032005 Bacteria 4259
450 Ga0307415_100026187 3300032126 Bacteria 3674
451 Ga0373957_0082100 3300035120 Bacteria 1274
452 Ga0373943_0186318 3300035170 Bacteria 1143
453 Ga0373955_0013680 3300035172 Bacteria 3932
454 Ga0373924_0071536 3300035410 Bacteria 1464
455 Ga0373935_0278617 3300035692 Bacteria 1177
456 Ga0373933_0115285 3300035724 Bacteria 1679
457 Ga0395905_0547333 3300037471 Bacteria 1059
458 Ga0439465_0044047 3300041413 Bacteria 1449
459 Ga0453683_0022168 3300044673 Bacteria 4053
460 Ga0453683_0195686 3300044673 Bacteria 1283
461 Ga0453684_0066771 3300044712 Bacteria 4578
462 Ga0453684_0262131 3300044712 Bacteria 1979
463 Ga0466958_0075447 3300045836 Unclassified 2068
464 Ga0466958_0299184 3300045836 Bacteria 1033
465 Ga0466967_0368932 3300045976 Unclassified 1392
466 Ga0495638_0357469 3300046460 Bacteria 769
467 Ga0495653_0349335 3300046463 Bacteria 951
468 Ga0495580_0110566 3300046472 Bacteria 1909
469 Ga0495608_0293909 3300046511 Bacteria 1007
470 Ga0495618_0042877 3300046514 Bacteria 2854
471 Ga0495628_0007334 3300046516 Bacteria 9549
472 Ga0495586_0456934 3300046535 Bacteria 736
473 Ga0495667_0094567 3300046559 Bacteria 1935
474 Ga0495634_0069131 3300046642 Bacteria 2331
475 Ga0495634_0154377 3300046642 Bacteria 1450
476 Ga0495611_0139403 3300046648 Bacteria 1132
477 Ga0495646_0306422 3300046680 Bacteria 839
478 Ga0495658_0442592 3300046683 Bacteria 830
479 Ga0495613_0152615 3300046689 Bacteria 1647
480 Ga0495686_0010384 3300047472 Bacteria 6628
481 Ga0495686_0052545 3300047472 Bacteria 2555
482 Ga0496108_0186759 3300048911 Bacteria 1796
483 Ga0496110_0243398 3300048913 Bacteria 1637
484 Ga0496112_0290570 3300048915 Bacteria 1581
485 Ga0496113_0303869 3300048916 Bacteria 1278
486 Ga0501032_0020511 3300049569 Bacteria 4601
487 Ga0501034_0000410 3300049571 Bacteria 72148
488 Ga0501034_0001945 3300049571 Bacteria 26170
489 Ga0501034_0019303 3300049571 Bacteria 6976
490 Ga0501034_0044164 3300049571 Bacteria 4507
491 Ga0501036_0244603 3300049572 Bacteria 1504
492 Ga0501036_0322616 3300049572 Bacteria 1290
493 Ga0501037_0005753 3300049573 Bacteria 9054
494 Ga0501038_0281584 3300049574 Bacteria 1309
495 Ga0501039_0087577 3300049575 Bacteria 2426
496 Ga0501039_0100013 3300049575 Bacteria 2263
497 Ga0501043_0017443 3300049579 Bacteria 5627
498 Ga0501043_0103058 3300049579 Unclassified 2242
499 Ga0501043_0202002 3300049579 Bacteria 1542
500 Ga0501046_0017485 3300049580 Bacteria 5982
501 Ga0501046_0211024 3300049580 Bacteria 1441
502 Ga0501047_0004355 3300049581 Bacteria 13318
503 Ga0501068_0347262 3300049584 Bacteria 953
504 Ga0501070_0014107 3300049586 Bacteria 6727
505 Ga0501070_0026739 3300049586 Bacteria 4840
506 Ga0501073_0000921 3300049589 Bacteria 21203
507 Ga0501073_0169923 3300049589 Bacteria 1509
508 Ga0501074_0004884 3300049590 Bacteria 9613
509 Ga0501074_0200162 3300049590 Bacteria 1423
510 Ga0501253_059453 3300049683 Bacteria 820
511 Ga0501080_0235331 3300049742 Bacteria 1673
512 Ga0501080_0273625 3300049742 Bacteria 1536
513 Ga0501083_0286170 3300049744 Bacteria 1072
514 Ga0501035_0014708 3300049822 Bacteria 7223
515 Ga0501035_0056449 3300049822 Bacteria 3503
516 Ga0501044_0021107 3300049823 Bacteria 6953
517 Ga0501044_0397333 3300049823 Bacteria 1291
518 Ga0501284_00021 3300050005 Bacteria 89729
519 nmdc:mga0k408_5067_c1 3300050493 Bacteria 6981
520 nmdc:mga09592_20327_c1 3300050508 Bacteria 5458
521 nmdc:mga09592_45558_c1 3300050508 Bacteria 3695
522 nmdc:mga09592_570816_c1 3300050508 Bacteria 971
523 nmdc:mga0qj67_426866_c1 3300050509 Bacteria 1068
524 nmdc:mga0qj67_99517_c1 3300050509 Bacteria 2343
525 nmdc:mga06r32_115302_c1 3300050510 Bacteria 2646
526 nmdc:mga06r32_418268_c1 3300050510 Bacteria 1322
527 nmdc:mga08y16_606717_c1 3300050511 Bacteria 1103
528 nmdc:mga08y16_80503_c1 3300050511 Unclassified 3396
529 nmdc:mga08y16_846821_c1 3300050511 Bacteria 904
530 nmdc:mga0n895_615771_c1 3300050512 Bacteria 1087
531 Ga0500641_0099617 3300053096 Bacteria 1246
532 Ga0500568_0000236 3300053139 Bacteria 47278
533 Ga0500611_000006 3300053727 Bacteria 226069
534 Ga0501082_0671700 3300060353 Unclassified 907
535 Ga0439454_017448
536 JGI24741J21665_1025945
537 JGI24751J29686_10002322
538 JGI24751J29686_10002413
539 Ga0065712_10004787
540 Ga0065712_10162696
541 Ga0065712_10188549
542 Ga0065715_10268983
543 Ga0070658_10069542
544 Ga0070658_10608070
545 Ga0070676_10155725
546 Ga0070683_100002306
547 Ga0070683_100015970
548 Ga0070683_100626400
549 Ga0070690_100024488
550 Ga0070690_100050564
551 Ga0070670_100009051
552 Ga0070670_100021498
553 Ga0070670_100108407
554 Ga0070670_100287097
555 Ga0070670_100506809
556 Ga0070670_100909115
557 Ga0068869_100028430
558 Ga0068869_100049314
559 Ga0068869_100057141
560 Ga0068869_100069906
561 Ga0070666_10038111
562 Ga0070666_10138750
563 Ga0070666_10170691
564 Ga0070680_100017166
565 Ga0070680_100052453
566 Ga0070680_100076714
567 Ga0070680_100347752
568 Ga0070682_100072795
569 Ga0068868_100001063
570 Ga0068868_100022140
571 Ga0068868_100046819
572 Ga0070689_100005751
573 Ga0070689_100019100
574 Ga0070689_100025849
575 Ga0070661_100000802
576 Ga0070661_100009511
577 Ga0070661_100368769
578 Ga0070661_100389609
579 Ga0070668_100010520
580 Ga0070668_100015099
581 Ga0070668_100111849
582 Ga0070669_100009067
583 Ga0070669_100096418
584 Ga0070675_100067460
585 Ga0070675_100180745
586 Ga0070671_100067658
587 Ga0070671_100293403
588 Ga0070671_100387595
589 Ga0070671_100770217
590 Ga0070674_100056846
591 Ga0070674_100434418
592 Ga0070674_100556451
593 Ga0070673_100042077
594 Ga0070688_100005900
595 Ga0070688_100037062
596 Ga0070688_100139119
597 Ga0070688_100338672
598 Ga0070659_100036423
599 Ga0070659_100053443
600 Ga0070667_100059799
601 Ga0070667_100076041
602 Ga0070667_100085594
603 Ga0070667_100579431
604 Ga0070667_100903978
605 Ga0070709_10049639
606 Ga0070714_100005072
607 Ga0070714_100010482
608 Ga0070710_10019783
609 Ga0070700_100076647
610 Ga0070700_100370111
611 Ga0070663_100421686
612 Ga0070678_100044598
613 Ga0070678_100090873
614 Ga0070678_100225066
615 Ga0070678_100622884
616 Ga0070662_100013468
617 Ga0070662_100058094
618 Ga0070662_100306787
619 Ga0070681_10159026
620 Ga0070681_10316972
621 Ga0068867_100139779
622 Ga0068867_100175873
623 Ga0068867_100211334
624 Ga0068867_100359336
625 Ga0068867_100490808
626 Ga0068867_100703725
627 Ga0070685_10031385
628 Ga0070685_10042854
629 Ga0070685_10142639
630 Ga0070698_100005585
631 Ga0070698_100005948
632 Ga0070698_100066526
633 Ga0070679_100001469
634 Ga0070679_100821684
635 Ga0070684_100000772
636 Ga0070684_100004165
637 Ga0070684_100245603
638 Ga0070684_101192523
639 Ga0068853_100001075
640 Ga0068853_100053760
641 Ga0068853_100218425
642 Ga0070672_100016283
643 Ga0070672_100460744
644 Ga0070686_100007568
645 Ga0070665_100021077
646 Ga0070665_100130277
647 Ga0068855_100211766
648 Ga0068855_100736558
649 Ga0070664_100000505
650 Ga0070664_100004719
651 Ga0070664_100033251
652 Ga0070664_100052458
653 Ga0070664_100406310
654 Ga0068857_100001366
655 Ga0068857_100033074
656 Ga0068857_100049806
657 Ga0068857_100099080
658 Ga0068857_100120401
659 Ga0068857_100209665
660 Ga0068854_100049621
661 Ga0070702_100020388
662 Ga0068852_100004584
663 Ga0068852_100188844
664 Ga0068852_100298341
665 Ga0068852_101105083
666 Ga0068859_100027214
667 Ga0068859_100083156
668 Ga0068859_100088006
669 Ga0068859_100286702
670 Ga0068859_100985732
671 Ga0068859_101498420
672 Ga0068864_100054711
673 Ga0068864_100122411
674 Ga0068864_100200539
675 Ga0068866_10023531
676 Ga0068866_10080201
677 Ga0068861_100003722
678 Ga0068861_100048731
679 Ga0068861_100133990
680 Ga0068861_100135016
681 Ga0068861_100766819
682 Ga0068851_10142565
683 Ga0068870_10278515
684 Ga0068863_100003170
685 Ga0068863_100093749
686 Ga0068858_100039810
687 Ga0068858_100216438
688 Ga0068860_100082198
689 Ga0068860_100137258
690 Ga0068860_100485410
691 Ga0068862_100001846
692 Ga0068862_100067354
693 Ga0068862_100099088
694 Ga0081539_10000916
695 Ga0081539_10018471
696 Ga0070717_10000765
697 Ga0075366_10015790
698 Ga0097621_100059062
699 Ga0097621_100061557
700 Ga0097621_100256057
701 Ga0097621_100451145
702 Ga0068871_100048000
703 Ga0068871_100085730
704 Ga0075428_100043655
705 Ga0075428_100429517
706 Ga0075430_100064504
707 Ga0075431_100005665
708 Ga0075431_100115808
709 Ga0075429_100014673
710 Ga0075429_100033309
711 Ga0075429_100081129
712 Ga0075429_100535019
713 Ga0068865_100031844
714 Ga0068865_100065129
715 Ga0068865_100548662
716 Ga0097620_100027213
717 Ga0097620_100083165
718 Ga0097620_100088009
719 Ga0097620_100286709
720 Ga0097620_100985940
721 Ga0097620_101498471
722 Ga0111539_10015995
723 Ga0111539_10059808
724 Ga0111539_10082802
725 Ga0111539_10688375
726 Ga0105247_10052519
727 Ga0114129_10156929
728 Ga0105243_10135634
729 Ga0105241_10307920
730 Ga0105242_10030519
731 Ga0105242_10167445
732 Ga0105242_10184072
733 Ga0105242_10259437
734 Ga0105249_10010436
735 Ga0105249_10029655
736 Ga0105249_10069048
737 Ga0105249_10124188
738 Ga0105249_10988377
739 Ga0105239_10137513
740 Ga0105239_11598967
741 Ga0105246_10020025
742 Ga0105246_10046086
743 Ga0157373_10030138
744 Ga0157373_10031460
745 Ga0157371_10014381
746 Ga0157371_10028755
747 Ga0157371_10037665
748 Ga0157371_10037897
749 Ga0157371_10095424
750 Ga0157371_10125194
751 Ga0157371_10197921
752 Ga0157371_10326975
753 Ga0157370_10000263
754 Ga0157370_10043995
755 Ga0157370_10779300
756 Ga0157369_10018964
757 Ga0157369_10144839
758 Ga0157369_10358010
759 Ga0157369_11216357
760 Ga0157374_10002918
761 Ga0157374_10007884
762 Ga0157374_10109889
763 Ga0157374_10129203
764 Ga0157374_10209760
765 Ga0157378_10012333
766 Ga0157378_10014153
767 Ga0157378_10102451
768 Ga0157378_10341093
769 Ga0157378_11480574
770 Ga0163162_10025708
771 Ga0163162_10065714
772 Ga0163162_10080280
773 Ga0163162_10092054
774 Ga0163162_10128999
775 Ga0163162_10136894
776 Ga0163162_10157430
777 Ga0163162_10296717
778 Ga0163162_10653690
779 Ga0157372_10044971
780 Ga0157372_10265586
781 Ga0157372_10357028
782 Ga0157372_10482006
783 Ga0157372_10699044
784 Ga0157372_10730537
785 Ga0157372_11199257
786 Ga0157375_10011610
787 Ga0157375_10141767
788 Ga0157375_10155364
789 Ga0163163_10008995
790 Ga0163163_10093924
791 Ga0163163_10154925
792 Ga0163163_10376488
793 Ga0163163_10560485
794 Ga0157380_10020317
795 Ga0157380_10043757
796 Ga0157380_10253112
797 Ga0157380_10265396
798 Ga0157380_10505120
799 Ga0157377_10003612
800 Ga0157377_10006329
801 Ga0157377_10052824
802 Ga0157379_10021385
803 Ga0157379_10024716
804 Ga0157379_10043900
805 Ga0157379_10071364
806 Ga0157379_10796989
807 Ga0157376_10015885
808 Ga0157376_10378283
809 Ga0157376_10509298
810 Ga0163161_10002549
811 Ga0163161_10012223
812 Ga0163161_10145664
813 Ga0163161_10208540
814 Ga0163161_10272871
815 Ga0163161_10420719
816 Ga0207697_10006128
817 Ga0207697_10038761
818 Ga0207697_10057560
819 Ga0207682_10024567
820 Ga0207642_10017992
821 Ga0207642_10068913
822 Ga0207642_10136903
823 Ga0207688_10060838
824 Ga0207680_10143608
825 Ga0207680_10163231
826 Ga0207680_10219551
827 Ga0207699_10014775
828 Ga0207699_10364920
829 Ga0207645_10000354
830 Ga0207645_10024656
831 Ga0207645_10089634
832 Ga0207643_10050573
833 Ga0207705_10013458
834 Ga0207654_10614520
835 Ga0207660_10031924
836 Ga0207660_10228086
837 Ga0207660_10794357
838 Ga0207662_10024919
839 Ga0207662_10353891
840 Ga0207662_10411405
841 Ga0207657_10011684
842 Ga0207657_10017212
843 Ga0207657_10217611
844 Ga0207649_10001160
845 Ga0207649_10007972
846 Ga0207652_10003426
847 Ga0207652_10046045
848 Ga0207681_10068857
849 Ga0207681_10137467
850 Ga0207681_10303615
851 Ga0207650_10047341
852 Ga0207650_10060964
853 Ga0207650_10206926
854 Ga0207650_10240182
855 Ga0207650_10305498
856 Ga0207650_10345323
857 Ga0207659_10086078
858 Ga0207700_10003696
859 Ga0207700_10007957
860 Ga0207664_10006880
861 Ga0207664_10055997
862 Ga0207644_10025302
863 Ga0207644_10192645
864 Ga0207644_10263790
865 Ga0207644_10401329
866 Ga0207690_10058342
867 Ga0207706_10006556
868 Ga0207706_10039716
869 Ga0207706_10062224
870 Ga0207706_10135521
871 Ga0207686_10644657
872 Ga0207670_10141389
873 Ga0207670_10165121
874 Ga0207669_10271761
875 Ga0207669_10395395
876 Ga0207704_10044526
877 Ga0207704_10071969
878 Ga0207704_10135965
879 Ga0207704_10191899
880 Ga0207704_10565657
881 Ga0207691_10025231
882 Ga0207691_10029719
883 Ga0207691_10133234
884 Ga0207691_10186480
885 Ga0207689_10003402
886 Ga0207689_10006527
887 Ga0207689_10038084
888 Ga0207689_10055671
889 Ga0207689_10750374
890 Ga0207661_10000929
891 Ga0207661_10006780
892 Ga0207661_10229285
893 Ga0207661_10371742
894 Ga0207679_10000232
895 Ga0207679_10006857
896 Ga0207679_10033582
897 Ga0207679_10108385
898 Ga0207679_10133921
899 Ga0207667_10033896
900 Ga0207667_10773546
901 Ga0207651_10028121
902 Ga0207651_10052142
903 Ga0207651_10393964
904 Ga0207712_10014046
905 Ga0207712_10031639
906 Ga0207712_10145468
907 Ga0207712_10279807
908 Ga0207712_10316010
909 Ga0207712_10491190
910 Ga0207668_10050700
911 Ga0207668_10053711
912 Ga0207668_10739588
913 Ga0207640_10039254
914 Ga0207640_10079812
915 Ga0207640_10521139
916 Ga0207658_10052125
917 Ga0207658_10075241
918 Ga0207677_10034678
919 Ga0207677_10059862
920 Ga0207677_10379418
921 Ga0207703_10016225
922 Ga0207703_10287183
923 Ga0207639_10084890
924 Ga0207639_10619977
925 Ga0207678_10451411
926 Ga0207708_10219815
927 Ga0207708_10466552
928 Ga0207708_11064864
929 Ga0207641_10004439
930 Ga0207641_11142859
931 Ga0207648_10000404
932 Ga0207648_10001472
933 Ga0207648_10028636
934 Ga0207648_10054096
935 Ga0207648_10079442
936 Ga0207648_10203174
937 Ga0207648_10267386
938 Ga0207676_10036804
939 Ga0207676_10037115
940 Ga0207676_10099647
941 Ga0207676_10169086
942 Ga0207676_10225403
943 Ga0207674_10009679
944 Ga0207674_10064304
945 Ga0207674_10089594
946 Ga0207674_10108382
947 Ga0207674_10131565
948 Ga0207674_10174999
949 Ga0207674_10185949
950 Ga0207675_100000326
951 Ga0207675_100031508
952 Ga0207675_100037522
953 Ga0207675_100202430
954 Ga0207675_100212948
955 Ga0207675_100285250
956 Ga0207683_10003746
957 Ga0207683_10103551
958 Ga0207683_10279767
959 Ga0207683_10582112
960 Ga0207683_10897741
961 Ga0207698_10017457
962 Ga0207698_10074085
963 Ga0207698_10628627
964 Ga0207428_10152627
965 Ga0268266_10067836
966 Ga0268266_10101845
967 Ga0268266_10777187
968 Ga0268265_10379755
969 Ga0268264_10057356
970 Ga0268264_10083705
971 Ga0268264_10520434
972 Ga0265338_10245687
973 Ga0265324_10068561
974 Ga0307408_100101076
975 Ga0307405_10002560
976 Ga0307410_10058893
977 Ga0307406_10163752
978 Ga0307407_10006466
979 Ga0307412_10003625
980 Ga0307409_100001406
981 Ga0307416_100032115
982 Ga0307414_10007419
983 Ga0307411_10015740
984 Ga0307415_100026187
985 Ga0373957_0082100
986 Ga0373943_0186318
987 Ga0373955_0013680
988 Ga0373924_0071536
989 Ga0373935_0278617
990 Ga0373933_0115285
991 Ga0395905_0547333
992 Ga0439465_0044047
993 Ga0453683_0022168
994 Ga0453683_0195686
995 Ga0453684_0066771
996 Ga0453684_0262131
997 Ga0466958_0075447
998 Ga0466958_0299184
999 Ga0466967_0368932
1000 Ga0495638_0357469
1001 Ga0495653_0349335
1002 Ga0495580_0110566
1003 Ga0495608_0293909
1004 Ga0495618_0042877
1005 Ga0495628_0007334
1006 Ga0495586_0456934
1007 Ga0495667_0094567
1008 Ga0495634_0069131
1009 Ga0495634_0154377
1010 Ga0495611_0139403
1011 Ga0495646_0306422
1012 Ga0495658_0442592
1013 Ga0495613_0152615
1014 Ga0495686_0010384
1015 Ga0495686_0052545
1016 Ga0496108_0186759
1017 Ga0496110_0243398
1018 Ga0496112_0290570
1019 Ga0496113_0303869
1020 Ga0501032_0020511
1021 Ga0501034_0000410
1022 Ga0501034_0001945
1023 Ga0501034_0019303
1024 Ga0501034_0044164
1025 Ga0501036_0244603
1026 Ga0501036_0322616
1027 Ga0501037_0005753
1028 Ga0501038_0281584
1029 Ga0501039_0087577
1030 Ga0501039_0100013
1031 Ga0501043_0017443
1032 Ga0501043_0103058
1033 Ga0501043_0202002
1034 Ga0501046_0017485
1035 Ga0501046_0211024
1036 Ga0501047_0004355
1037 Ga0501068_0347262
1038 Ga0501070_0014107
1039 Ga0501070_0026739
1040 Ga0501073_0000921
1041 Ga0501073_0169923
1042 Ga0501074_0004884
1043 Ga0501074_0200162
1044 Ga0501253_059453
1045 Ga0501080_0235331
1046 Ga0501080_0273625
1047 Ga0501083_0286170
1048 Ga0501035_0014708
1049 Ga0501035_0056449
1050 Ga0501044_0021107
1051 Ga0501044_0397333
1052 Ga0501284_00021
1053 nmdc:mga0k408_5067_c1
1054 nmdc:mga09592_20327_c1
1055 nmdc:mga09592_45558_c1
1056 nmdc:mga09592_570816_c1
1057 nmdc:mga0qj67_426866_c1
1058 nmdc:mga0qj67_99517_c1
1059 nmdc:mga06r32_115302_c1
1060 nmdc:mga06r32_418268_c1
1061 nmdc:mga08y16_606717_c1
1062 nmdc:mga08y16_80503_c1
1063 nmdc:mga08y16_846821_c1
1064 nmdc:mga0n895_615771_c1
1065 Ga0500641_0099617
1066 Ga0500568_0000236
1067 Ga0500611_000006
1068 Ga0501082_0671700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

62

108

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4x1e-assembly1.cif.gz_B crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant 0.8002 13 202
4x1e-assembly1.cif.gz_B crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant 0.7788 13 202
5k7z-assembly2.cif.gz_C crystal structure of aibr in complex with isovaleryl coenzyme a and operator dna 0.7639 9 167
3vpr-assembly2.cif.gz_D crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 0.7633 8 205
3vpr-assembly2.cif.gz_C crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 0.7624 14 205
ID Description Score Start End Superfamily
3whbA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9936 10 52 1.10.10.60
2wv1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9888 10 52 1.10.10.60
3whcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.987 9 52 1.10.10.60
3whcE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9842 10 52 1.10.10.60
5gpaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9838 13 52 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1Q3X7Q2-F1-model_v4 HTH tetR-type domain-containing protein 0.9391 10 205 GO:0003677
AF-A0A537J9P7-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9367 1 134 GO:0003677
AF-A0A3S2WB26-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9347 8 205 GO:0003677
AF-A0A3S2WB26-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9302 8 205 GO:0003677
AF-A0A2A4NF25-F1-model_v4 TetR family transcriptional regulator 0.9292 10 205 GO:0003677

Map