F460623

General Info

Members Datasets Scaffolds Average Seq Length
535 214 1070 130

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_101072006|Ga0070674_1010720061
Length 151
Sequence LSRDFFVLCTTIFVLSSKSLQMDRINYSSGAKWEDIVGYSRAVRMGNTIEITGTVAVDENNAVVGLNDAYAQSKYIIQKIEKTLKRAGAGLEHVIRTRMFVTDISRWEEYGKAHGEFFGQIKPCTTMVEVKALIQPEFLIEIEATAIVGEH

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
199 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
200 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 2831426010 Nostoc sp. 106C Isolate Unclassified
214 2848694841 Nostoc sp. RF31YmG Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.37
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 1.31
Rhizosphere 91.59
Stem 0
Stem Tuber 0
Unclassified 13.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_101072006 3300005356 Unclassified 710
2 JGI24744J21845_10007969 3300002077 Bacteria 2187
3 Ga0065712_10017179 3300005290 Bacteria 3377
4 Ga0065715_10016693 3300005293 Bacteria 2351
5 Ga0065707_10222666 3300005295 Bacteria 1219
6 Ga0070676_10111174 3300005328 Bacteria 1706
7 Ga0070683_100000327 3300005329 Bacteria 32861
8 Ga0070683_100047014 3300005329 Bacteria 3987
9 Ga0070690_100006021 3300005330 Bacteria 6857
10 Ga0070690_100832148 3300005330 Unclassified 718
11 Ga0070670_100135752 3300005331 Bacteria 2126
12 Ga0070670_100194374 3300005331 Bacteria 1762
13 Ga0070670_100299930 3300005331 Bacteria 1405
14 Ga0070670_100485352 3300005331 Bacteria 1098
15 Ga0070677_10008266 3300005333 Bacteria 3496
16 Ga0068869_100008626 3300005334 Bacteria 6582
17 Ga0068869_100101195 3300005334 Bacteria 2180
18 Ga0068869_100532468 3300005334 Bacteria 985
19 Ga0068869_100547179 3300005334 Bacteria 972
20 Ga0068869_101069010 3300005334 Bacteria 705
21 Ga0070666_10000112 3300005335 Bacteria 55997
22 Ga0070666_10050266 3300005335 Bacteria 2803
23 Ga0070666_10080871 3300005335 Unclassified 2221
24 Ga0070666_10090141 3300005335 Bacteria 2105
25 Ga0070666_10970757 3300005335 Bacteria 630
26 Ga0070680_100087284 3300005336 Unclassified 2580
27 Ga0070680_101709233 3300005336 Bacteria 545
28 Ga0070682_100185053 3300005337 Bacteria 1458
29 Ga0070682_101183784 3300005337 Unclassified 644
30 Ga0068868_100030169 3300005338 Bacteria 4158
31 Ga0068868_100043035 3300005338 Bacteria 3527
32 Ga0068868_100079176 3300005338 Bacteria 2632
33 Ga0068868_100119276 3300005338 Bacteria 2150
34 Ga0068868_101547815 3300005338 Unclassified 622
35 Ga0070660_101499860 3300005339 Bacteria 573
36 Ga0070689_100013812 3300005340 Bacteria 5850
37 Ga0070689_100014980 3300005340 Bacteria 5645
38 Ga0070689_101092122 3300005340 Bacteria 713
39 Ga0070687_100108340 3300005343 Bacteria 1568
40 Ga0070661_100003284 3300005344 Bacteria 11166
41 Ga0070661_100249389 3300005344 Bacteria 1369
42 Ga0070661_100719829 3300005344 Bacteria 814
43 Ga0070668_100015227 3300005347 Bacteria 5746
44 Ga0070668_100875337 3300005347 Bacteria 802
45 Ga0070669_100273148 3300005353 Bacteria 1352
46 Ga0070669_100409937 3300005353 Bacteria 1110
47 Ga0070669_101148460 3300005353 Unclassified 670
48 Ga0070675_100014938 3300005354 Bacteria 6132
49 Ga0070675_100030473 3300005354 Bacteria 4355
50 Ga0070675_100038280 3300005354 Bacteria 3908
51 Ga0070675_100082815 3300005354 Bacteria 2677
52 Ga0070675_100561887 3300005354 Bacteria 1033
53 Ga0070671_100014491 3300005355 Bacteria 6372
54 Ga0070671_100513116 3300005355 Unclassified 1032
55 Ga0070674_100007487 3300005356 Bacteria 6442
56 Ga0070674_101190666 3300005356 Unclassified 676
57 Ga0070673_100019745 3300005364 Bacteria 4845
58 Ga0070673_100081139 3300005364 Bacteria 2630
59 Ga0070673_100115886 3300005364 Bacteria 2228
60 Ga0070673_100119259 3300005364 Bacteria 2198
61 Ga0070673_100629336 3300005364 Bacteria 981
62 Ga0070688_100016516 3300005365 Bacteria 4222
63 Ga0070688_100024744 3300005365 Bacteria 3547
64 Ga0070688_100088115 3300005365 Bacteria 2023
65 Ga0070688_100529089 3300005365 Bacteria 893
66 Ga0070659_100087432 3300005366 Bacteria 2495
67 Ga0070659_101906502 3300005366 Unclassified 533
68 Ga0070667_100089837 3300005367 Bacteria 2639
69 Ga0070667_100106255 3300005367 Bacteria 2430
70 Ga0070667_100239249 3300005367 Unclassified 1620
71 Ga0070667_100369609 3300005367 Bacteria 1301
72 Ga0070667_100504693 3300005367 Bacteria 1109
73 Ga0070714_100126191 3300005435 Bacteria 2282
74 Ga0070713_100295059 3300005436 Bacteria 1491
75 Ga0070700_100151158 3300005441 Bacteria 1588
76 Ga0070700_101725365 3300005441 Bacteria 538
77 Ga0070663_100366190 3300005455 Bacteria 1170
78 Ga0070663_100659899 3300005455 Bacteria 885
79 Ga0070663_100954961 3300005455 Bacteria 743
80 Ga0070678_100451121 3300005456 Bacteria 1126
81 Ga0070662_100133555 3300005457 Bacteria 1917
82 Ga0070662_100208306 3300005457 Bacteria 1555
83 Ga0070662_100575358 3300005457 Unclassified 946
84 Ga0070681_10233915 3300005458 Bacteria 1752
85 Ga0070681_10797740 3300005458 Bacteria 861
86 Ga0068867_100068530 3300005459 Bacteria 2648
87 Ga0068867_100169243 3300005459 Bacteria 1729
88 Ga0068867_100229115 3300005459 Bacteria 1501
89 Ga0068867_100272625 3300005459 Bacteria 1384
90 Ga0068867_100310618 3300005459 Bacteria 1303
91 Ga0068867_100760761 3300005459 Bacteria 860
92 Ga0068867_101223641 3300005459 Bacteria 691
93 Ga0070685_10200033 3300005466 Bacteria 1298
94 Ga0070685_10647598 3300005466 Unclassified 765
95 Ga0070685_11010843 3300005466 Bacteria 624
96 Ga0070699_100295094 3300005518 Unclassified 1454
97 Ga0070679_100625383 3300005530 Bacteria 1020
98 Ga0070679_101242192 3300005530 Bacteria 690
99 Ga0070684_100000290 3300005535 Bacteria 34902
100 Ga0070684_100024503 3300005535 Bacteria 5062
101 Ga0070684_100131147 3300005535 Bacteria 2261
102 Ga0070697_100756073 3300005536 Unclassified 859
103 Ga0068853_100000837 3300005539 Bacteria 21517
104 Ga0068853_100003897 3300005539 Bacteria 11438
105 Ga0068853_100026823 3300005539 Bacteria 4840
106 Ga0068853_100347637 3300005539 Bacteria 1379
107 Ga0070672_100003616 3300005543 Bacteria 10029
108 Ga0070672_100053315 3300005543 Bacteria 3161
109 Ga0070672_100183022 3300005543 Bacteria 1747
110 Ga0070672_100190336 3300005543 Bacteria 1713
111 Ga0070686_100001004 3300005544 Bacteria 16245
112 Ga0070686_100031548 3300005544 Bacteria 3241
113 Ga0070686_101414721 3300005544 Bacteria 584
114 Ga0070665_100007902 3300005548 Bacteria 10790
115 Ga0070665_100128970 3300005548 Bacteria 2531
116 Ga0070665_100150118 3300005548 Bacteria 2333
117 Ga0068855_100319035 3300005563 Bacteria 1718
118 Ga0068855_101518467 3300005563 Bacteria 687
119 Ga0070664_100000509 3300005564 Bacteria 29514
120 Ga0070664_100005422 3300005564 Bacteria 10239
121 Ga0070664_100054002 3300005564 Bacteria 3408
122 Ga0068857_100000579 3300005577 Bacteria 26747
123 Ga0068857_100189998 3300005577 Bacteria 1870
124 Ga0068857_100230792 3300005577 Bacteria 1693
125 Ga0068857_100983644 3300005577 Bacteria 812
126 Ga0068854_100022818 3300005578 Bacteria 4269
127 Ga0068854_100064864 3300005578 Bacteria 2654
128 Ga0068854_100086324 3300005578 Bacteria 2326
129 Ga0068856_100848833 3300005614 Bacteria 932
130 Ga0068852_100005128 3300005616 Bacteria 9334
131 Ga0068852_100014577 3300005616 Bacteria 6057
132 Ga0068852_100038926 3300005616 Bacteria 4000
133 Ga0068852_100939164 3300005616 Bacteria 883
134 Ga0068852_101076812 3300005616 Unclassified 824
135 Ga0068859_100000018 3300005617 Bacteria 248813
136 Ga0068859_100009296 3300005617 Bacteria 9924
137 Ga0068859_100231407 3300005617 Bacteria 1936
138 Ga0068859_100312389 3300005617 Bacteria 1665
139 Ga0068859_100933783 3300005617 Bacteria 951
140 Ga0068864_100002226 3300005618 Bacteria 16023
141 Ga0068864_100004779 3300005618 Bacteria 11103
142 Ga0068864_100393459 3300005618 Bacteria 1316
143 Ga0068866_10015867 3300005718 Bacteria 3356
144 Ga0068866_10064327 3300005718 Bacteria 1915
145 Ga0068866_10443749 3300005718 Unclassified 847
146 Ga0068866_10687498 3300005718 Bacteria 700
147 Ga0068861_100014393 3300005719 Bacteria 5553
148 Ga0068861_100096806 3300005719 Bacteria 2340
149 Ga0068861_101134320 3300005719 Bacteria 753
150 Ga0068851_10047859 3300005834 Unclassified 2166
151 Ga0068870_10125553 3300005840 Bacteria 1483
152 Ga0068870_10200169 3300005840 Bacteria 1210
153 Ga0068870_10238154 3300005840 Bacteria 1122
154 Ga0068870_11008349 3300005840 Unclassified 594
155 Ga0068863_100004036 3300005841 Bacteria 14494
156 Ga0068863_100026959 3300005841 Bacteria 5479
157 Ga0068863_100446377 3300005841 Bacteria 1269
158 Ga0068863_100629876 3300005841 Bacteria 1063
159 Ga0068863_101717580 3300005841 Bacteria 637
160 Ga0068858_100013296 3300005842 Bacteria 7761
161 Ga0068858_100115344 3300005842 Bacteria 2510
162 Ga0068858_102042387 3300005842 Unclassified 567
163 Ga0068860_100010496 3300005843 Bacteria 9156
164 Ga0068860_100081488 3300005843 Bacteria 3077
165 Ga0068860_100308200 3300005843 Bacteria 1552
166 Ga0068862_100169403 3300005844 Bacteria 1954
167 Ga0068862_100377876 3300005844 Bacteria 1321
168 Ga0068862_101363170 3300005844 Bacteria 712
169 Ga0068862_101700358 3300005844 Bacteria 639
170 Ga0068862_102549377 3300005844 Unclassified 523
171 Ga0081455_10973772 3300005937 Bacteria 525
172 Ga0070712_101043659 3300006175 Unclassified 708
173 Ga0075366_10010357 3300006195 Bacteria 5234
174 Ga0097621_100006209 3300006237 Bacteria 8473
175 Ga0097621_100057773 3300006237 Bacteria 3174
176 Ga0097621_100057960 3300006237 Bacteria 3169
177 Ga0068871_100153118 3300006358 Bacteria 1967
178 Ga0068871_101301336 3300006358 Unclassified 684
179 Ga0068871_101320049 3300006358 Bacteria 679
180 Ga0075433_10393473 3300006852 Bacteria 1223
181 Ga0068865_100103818 3300006881 Bacteria 2085
182 Ga0068865_101005510 3300006881 Bacteria 730
183 Ga0097620_100000018 3300006931 Bacteria 248813
184 Ga0097620_100009296 3300006931 Bacteria 9924
185 Ga0097620_100231393 3300006931 Bacteria 1936
186 Ga0097620_100312374 3300006931 Bacteria 1665
187 Ga0097620_100933784 3300006931 Bacteria 951
188 Ga0075435_100263415 3300007076 Bacteria 1469
189 Ga0111539_10073934 3300009094 Bacteria 4017
190 Ga0111539_10147167 3300009094 Unclassified 2758
191 Ga0111539_10503267 3300009094 Bacteria 1411
192 Ga0105245_10052931 3300009098 Bacteria 3642
193 Ga0105247_10014874 3300009101 Bacteria 4665
194 Ga0105243_10046640 3300009148 Bacteria 3409
195 Ga0105241_10001966 3300009174 Bacteria 15555
196 Ga0105241_10014589 3300009174 Bacteria 5753
197 Ga0105241_10151358 3300009174 Bacteria 1898
198 Ga0105241_11356729 3300009174 Bacteria 679
199 Ga0105242_10048296 3300009176 Bacteria 3459
200 Ga0105242_10229118 3300009176 Bacteria 1664
201 Ga0105242_11108134 3300009176 Bacteria 806
202 Ga0105242_12608760 3300009176 Unclassified 554
203 Ga0105248_10463189 3300009177 Bacteria 1429
204 Ga0105237_10003222 3300009545 Bacteria 19554
205 Ga0105237_11544857 3300009545 Bacteria 671
206 Ga0105237_12476589 3300009545 Bacteria 529
207 Ga0105238_10526652 3300009551 Bacteria 1185
208 Ga0105249_10007644 3300009553 Bacteria 9422
209 Ga0105249_10019500 3300009553 Bacteria 6051
210 Ga0105249_10049945 3300009553 Unclassified 3814
211 Ga0105249_10053213 3300009553 Bacteria 3700
212 Ga0105239_10017847 3300010375 Bacteria 7848
213 Ga0105239_10090565 3300010375 Bacteria 3374
214 Ga0105239_11111969 3300010375 Bacteria 910
215 Ga0105239_12160442 3300010375 Bacteria 647
216 Ga0105246_10005261 3300011119 Bacteria 7872
217 Ga0105246_10165488 3300011119 Bacteria 1688
218 Ga0105246_10424525 3300011119 Unclassified 1110
219 Ga0157371_10042293 3300013102 Bacteria 3248
220 Ga0157371_10182148 3300013102 Bacteria 1502
221 Ga0157371_10349713 3300013102 Bacteria 1076
222 Ga0157371_10716522 3300013102 Bacteria 750
223 Ga0157370_10016291 3300013104 Bacteria 7532
224 Ga0157370_10060172 3300013104 Bacteria 3607
225 Ga0157370_10147488 3300013104 Bacteria 2190
226 Ga0157369_10203669 3300013105 Unclassified 2076
227 Ga0157369_10651784 3300013105 Unclassified 1086
228 Ga0157374_10000587 3300013296 Bacteria 32144
229 Ga0157374_10000745 3300013296 Bacteria 28347
230 Ga0157374_10048817 3300013296 Bacteria 3929
231 Ga0157374_10093011 3300013296 Bacteria 2878
232 Ga0157374_10233179 3300013296 Bacteria 1809
233 Ga0157374_10244393 3300013296 Bacteria 1765
234 Ga0157374_10333328 3300013296 Bacteria 1505
235 Ga0157378_10001243 3300013297 Bacteria 23019
236 Ga0157378_10184357 3300013297 Bacteria 1965
237 Ga0157378_11933368 3300013297 Bacteria 639
238 Ga0163162_10001107 3300013306 Bacteria 24993
239 Ga0163162_10069880 3300013306 Bacteria 3563
240 Ga0163162_10074960 3300013306 Bacteria 3443
241 Ga0163162_11864386 3300013306 Bacteria 688
242 Ga0163162_12735946 3300013306 Unclassified 568
243 Ga0157372_10214763 3300013307 Bacteria 2229
244 Ga0157372_10269861 3300013307 Bacteria 1977
245 Ga0157372_10648502 3300013307 Bacteria 1230
246 Ga0157372_10667014 3300013307 Bacteria 1211
247 Ga0157372_11073894 3300013307 Bacteria 932
248 Ga0157372_11459023 3300013307 Bacteria 788
249 Ga0157375_10011638 3300013308 Bacteria 7774
250 Ga0157375_10012976 3300013308 Bacteria 7402
251 Ga0157375_10215721 3300013308 Bacteria 2077
252 Ga0157375_10297559 3300013308 Bacteria 1777
253 Ga0157375_10417441 3300013308 Bacteria 1508
254 Ga0157375_10444186 3300013308 Bacteria 1463
255 Ga0157375_10453112 3300013308 Bacteria 1449
256 Ga0157375_11973716 3300013308 Bacteria 693
257 Ga0163163_10000867 3300014325 Bacteria 25795
258 Ga0163163_10019391 3300014325 Bacteria 6387
259 Ga0163163_10036588 3300014325 Bacteria 4770
260 Ga0163163_10249127 3300014325 Bacteria 1827
261 Ga0163163_10435546 3300014325 Bacteria 1370
262 Ga0163163_11222984 3300014325 Bacteria 814
263 Ga0157380_10210691 3300014326 Bacteria 1731
264 Ga0157380_10303536 3300014326 Bacteria 1472
265 Ga0157380_10502503 3300014326 Bacteria 1178
266 Ga0157377_10003700 3300014745 Bacteria 6936
267 Ga0157377_10014761 3300014745 Bacteria 3982
268 Ga0157377_10108381 3300014745 Bacteria 1666
269 Ga0157377_10111805 3300014745 Bacteria 1643
270 Ga0157377_10577423 3300014745 Bacteria 798
271 Ga0157379_10200925 3300014968 Bacteria 1803
272 Ga0157379_10990694 3300014968 Bacteria 801
273 Ga0157376_10028617 3300014969 Bacteria 4430
274 Ga0157376_10076393 3300014969 Bacteria 2862
275 Ga0157376_11088513 3300014969 Bacteria 825
276 Ga0157376_11596253 3300014969 Bacteria 687
277 Ga0182006_1130986 3300015261 Bacteria 863
278 Ga0163161_10011620 3300017792 Bacteria 6114
279 Ga0206350_10935620 3300020080 Bacteria 960
280 Ga0213874_10029602 3300021377 Bacteria 1572
281 Ga0213874_10115099 3300021377 Bacteria 908
282 Ga0213874_10242085 3300021377 Bacteria 662
283 Ga0213876_10012187 3300021384 Bacteria 4579
284 Ga0213876_10036165 3300021384 Unclassified 2605
285 Ga0213876_10102078 3300021384 Bacteria 1520
286 Ga0213876_10138071 3300021384 Bacteria 1296
287 Ga0213875_10007646 3300021388 Bacteria 5569
288 Ga0213875_10018695 3300021388 Bacteria 3339
289 Ga0213875_10096614 3300021388 Bacteria 1378
290 Ga0213875_10116553 3300021388 Unclassified 1248
291 Ga0224712_10027953 3300022467 Unclassified 2011
292 Ga0207697_10113083 3300025315 Bacteria 1163
293 Ga0207697_10299701 3300025315 Bacteria 713
294 Ga0207656_10320284 3300025321 Bacteria 770
295 Ga0207682_10006928 3300025893 Bacteria 4545
296 Ga0207682_10064403 3300025893 Unclassified 1540
297 Ga0207642_10097074 3300025899 Bacteria 1470
298 Ga0207710_10021464 3300025900 Bacteria 2767
299 Ga0207688_10007004 3300025901 Bacteria 6132
300 Ga0207688_10394369 3300025901 Unclassified 858
301 Ga0207688_10916176 3300025901 Bacteria 555
302 Ga0207680_10000193 3300025903 Bacteria 29312
303 Ga0207680_10012375 3300025903 Bacteria 4343
304 Ga0207680_10038163 3300025903 Bacteria 2779
305 Ga0207680_10455554 3300025903 Unclassified 908
306 Ga0207647_10128749 3300025904 Bacteria 1489
307 Ga0207685_10012869 3300025905 Bacteria 2569
308 Ga0207645_10000050 3300025907 Bacteria 84659
309 Ga0207645_10234901 3300025907 Bacteria 1211
310 Ga0207643_10006065 3300025908 Bacteria 6458
311 Ga0207643_10075245 3300025908 Bacteria 1948
312 Ga0207643_11037389 3300025908 Bacteria 530
313 Ga0207654_10001980 3300025911 Bacteria 10581
314 Ga0207654_10366997 3300025911 Bacteria 994
315 Ga0207707_10653720 3300025912 Bacteria 886
316 Ga0207671_10002779 3300025914 Bacteria 18262
317 Ga0207660_10027253 3300025917 Unclassified 3897
318 Ga0207662_10354370 3300025918 Unclassified 986
319 Ga0207649_10000567 3300025920 Bacteria 25427
320 Ga0207649_10007810 3300025920 Bacteria 5820
321 Ga0207649_10049798 3300025920 Bacteria 2589
322 Ga0207652_11111279 3300025921 Bacteria 691
323 Ga0207681_10015127 3300025923 Bacteria 4811
324 Ga0207681_10030296 3300025923 Bacteria 3526
325 Ga0207681_10097299 3300025923 Unclassified 2115
326 Ga0207681_10261977 3300025923 Bacteria 1354
327 Ga0207681_10527006 3300025923 Bacteria 970
328 Ga0207694_10416397 3300025924 Bacteria 1119
329 Ga0207650_10159886 3300025925 Bacteria 1784
330 Ga0207650_10173380 3300025925 Bacteria 1715
331 Ga0207650_10509311 3300025925 Bacteria 1006
332 Ga0207650_11299649 3300025925 Bacteria 619
333 Ga0207650_11513527 3300025925 Bacteria 570
334 Ga0207659_10059932 3300025926 Bacteria 2738
335 Ga0207659_10144815 3300025926 Bacteria 1849
336 Ga0207659_10202701 3300025926 Bacteria 1585
337 Ga0207659_10284575 3300025926 Bacteria 1353
338 Ga0207687_10059396 3300025927 Bacteria 2694
339 Ga0207700_10258559 3300025928 Bacteria 1490
340 Ga0207664_11532761 3300025929 Unclassified 588
341 Ga0207644_10088304 3300025931 Bacteria 2306
342 Ga0207690_10003267 3300025932 Bacteria 9722
343 Ga0207690_10629794 3300025932 Unclassified 877
344 Ga0207690_11450731 3300025932 Unclassified 574
345 Ga0207706_10040287 3300025933 Bacteria 4140
346 Ga0207706_10487381 3300025933 Unclassified 1065
347 Ga0207686_10077825 3300025934 Bacteria 2154
348 Ga0207686_10082342 3300025934 Unclassified 2103
349 Ga0207686_10187063 3300025934 Bacteria 1473
350 Ga0207686_10224182 3300025934 Bacteria 1359
351 Ga0207670_10007146 3300025936 Bacteria 6221
352 Ga0207670_10109839 3300025936 Bacteria 1985
353 Ga0207670_10157043 3300025936 Bacteria 1694
354 Ga0207670_10857932 3300025936 Bacteria 759
355 Ga0207669_10006805 3300025937 Bacteria 5255
356 Ga0207669_10018579 3300025937 Bacteria 3598
357 Ga0207669_10381188 3300025937 Bacteria 1099
358 Ga0207669_11902090 3300025937 Unclassified 508
359 Ga0207704_10261924 3300025938 Bacteria 1304
360 Ga0207691_10004485 3300025940 Bacteria 13524
361 Ga0207691_10014830 3300025940 Bacteria 7427
362 Ga0207691_10088218 3300025940 Bacteria 2782
363 Ga0207691_10093329 3300025940 Bacteria 2695
364 Ga0207691_10096953 3300025940 Bacteria 2636
365 Ga0207711_10274359 3300025941 Bacteria 1552
366 Ga0207689_10000664 3300025942 Bacteria 32785
367 Ga0207689_10000843 3300025942 Bacteria 29516
368 Ga0207689_10003649 3300025942 Bacteria 14045
369 Ga0207689_10009455 3300025942 Bacteria 8416
370 Ga0207689_10013655 3300025942 Bacteria 6925
371 Ga0207689_10291325 3300025942 Bacteria 1352
372 Ga0207689_10993438 3300025942 Bacteria 708
373 Ga0207661_10000411 3300025944 Bacteria 27626
374 Ga0207661_10007500 3300025944 Bacteria 7759
375 Ga0207661_11736116 3300025944 Unclassified 570
376 Ga0207679_10000297 3300025945 Bacteria 37427
377 Ga0207679_10000800 3300025945 Bacteria 20460
378 Ga0207679_10176453 3300025945 Bacteria 1764
379 Ga0207679_10348345 3300025945 Bacteria 1290
380 Ga0207667_11120217 3300025949 Bacteria 770
381 Ga0207667_11235394 3300025949 Bacteria 726
382 Ga0207651_10025372 3300025960 Bacteria 3683
383 Ga0207651_10069067 3300025960 Bacteria 2494
384 Ga0207651_10104519 3300025960 Bacteria 2110
385 Ga0207651_11582351 3300025960 Bacteria 590
386 Ga0207712_10007405 3300025961 Bacteria 6931
387 Ga0207712_10040591 3300025961 Bacteria 3195
388 Ga0207712_10177175 3300025961 Unclassified 1671
389 Ga0207668_10066086 3300025972 Bacteria 2562
390 Ga0207640_10077182 3300025981 Bacteria 2264
391 Ga0207640_10792455 3300025981 Bacteria 820
392 Ga0207658_10004993 3300025986 Bacteria 9143
393 Ga0207658_10069994 3300025986 Bacteria 2653
394 Ga0207658_10100977 3300025986 Bacteria 2260
395 Ga0207658_10154194 3300025986 Bacteria 1875
396 Ga0207658_10823989 3300025986 Unclassified 843
397 Ga0207677_10014890 3300026023 Bacteria 4556
398 Ga0207677_10038772 3300026023 Bacteria 3126
399 Ga0207677_10089615 3300026023 Bacteria 2233
400 Ga0207677_11461382 3300026023 Unclassified 631
401 Ga0207703_10015149 3300026035 Bacteria 6018
402 Ga0207639_10001395 3300026041 Bacteria 16309
403 Ga0207639_10002886 3300026041 Bacteria 11551
404 Ga0207639_10026226 3300026041 Bacteria 4234
405 Ga0207639_10464313 3300026041 Unclassified 1151
406 Ga0207639_10560544 3300026041 Bacteria 1050
407 Ga0207678_10061294 3300026067 Bacteria 3235
408 Ga0207678_10730579 3300026067 Bacteria 872
409 Ga0207708_10131462 3300026075 Bacteria 1957
410 Ga0207708_10544240 3300026075 Unclassified 978
411 Ga0207702_11396560 3300026078 Unclassified 694
412 Ga0207641_10000015 3300026088 Bacteria 321332
413 Ga0207641_10708363 3300026088 Bacteria 992
414 Ga0207641_12500828 3300026088 Bacteria 515
415 Ga0207648_10000464 3300026089 Bacteria 45165
416 Ga0207648_10076229 3300026089 Bacteria 2923
417 Ga0207648_10197486 3300026089 Bacteria 1784
418 Ga0207648_10273217 3300026089 Bacteria 1510
419 Ga0207648_10399008 3300026089 Bacteria 1246
420 Ga0207648_10602736 3300026089 Bacteria 1012
421 Ga0207648_10691954 3300026089 Bacteria 944
422 Ga0207676_10005777 3300026095 Bacteria 8750
423 Ga0207676_10009634 3300026095 Bacteria 6874
424 Ga0207676_10403572 3300026095 Bacteria 1278
425 Ga0207674_10012404 3300026116 Bacteria 9527
426 Ga0207674_10025239 3300026116 Bacteria 6342
427 Ga0207674_10030912 3300026116 Bacteria 5628
428 Ga0207674_10031296 3300026116 Bacteria 5590
429 Ga0207675_100000144 3300026118 Bacteria 61517
430 Ga0207675_100036847 3300026118 Bacteria 4562
431 Ga0207675_100085078 3300026118 Bacteria 2967
432 Ga0207675_101756993 3300026118 Bacteria 640
433 Ga0207683_10000736 3300026121 Bacteria 29807
434 Ga0207683_10004211 3300026121 Bacteria 12434
435 Ga0207683_10975623 3300026121 Unclassified 787
436 Ga0207683_11462663 3300026121 Unclassified 631
437 Ga0207698_10032497 3300026142 Bacteria 3781
438 Ga0207698_10183844 3300026142 Bacteria 1855
439 Ga0207698_10274548 3300026142 Bacteria 1556
440 Ga0207698_11361783 3300026142 Unclassified 724
441 Ga0207428_10170029 3300027907 Bacteria 1651
442 Ga0207428_10508077 3300027907 Unclassified 875
443 Ga0268266_10028089 3300028379 Bacteria 4783
444 Ga0268266_10087127 3300028379 Bacteria 2731
445 Ga0268266_10096880 3300028379 Bacteria 2594
446 Ga0268265_11017835 3300028380 Bacteria 819
447 Ga0268264_10019547 3300028381 Bacteria 5534
448 Ga0268264_10021492 3300028381 Bacteria 5269
449 Ga0268264_10570187 3300028381 Bacteria 1112
450 Ga0268264_10649799 3300028381 Unclassified 1044
451 Ga0307516_10229057 3300031730 Bacteria 1563
452 Ga0307410_11221777 3300031852 Unclassified 655
453 Ga0307414_10245863 3300032004 Bacteria 1484
454 Ga0373935_0420439 3300035692 Bacteria 962
455 Ga0395900_0287438 3300037418 Bacteria 1634
456 Ga0395900_0639696 3300037418 Unclassified 1001
457 Ga0395898_0924827 3300037466 Bacteria 810
458 Ga0395905_0003668 3300037471 Bacteria 16282
459 Ga0395905_0329014 3300037471 Unclassified 1418
460 Ga0436364_0071076 3300037853 Bacteria 563
461 Ga0436364_0095149 3300037853 Unclassified 707
462 Ga0436364_0118784 3300037853 Unclassified 3807
463 Ga0436364_0378137 3300037853 Bacteria 57218
464 Ga0436364_0478514 3300037853 Bacteria 578677
465 Ga0436364_1231066 3300037853 Bacteria 40361
466 Ga0436364_1244063 3300037853 Unclassified 510
467 Ga0436364_1280004 3300037853 Bacteria 4765
468 Ga0436364_1354718 3300037853 Bacteria 3421
469 Ga0436365_0057363 3300039437 Bacteria 8044
470 Ga0436365_0080980 3300039437 Bacteria 624
471 Ga0436365_0610994 3300039437 Bacteria 2281
472 Ga0436365_0689239 3300039437 Unclassified 1017
473 Ga0436365_1297406 3300039437 Bacteria 511
474 Ga0436365_1313675 3300039437 Bacteria 3723
475 Ga0436365_1930067 3300039437 Bacteria 1244
476 Ga0436365_1932428 3300039437 Bacteria 7177
477 Ga0436360_0526332 3300039438 Bacteria 695
478 Ga0436360_1058969 3300039438 Unclassified 1630
479 Ga0436360_1343688 3300039438 Bacteria 2759
480 Ga0436363_0790653 3300039450 Bacteria 741
481 Ga0436363_1145334 3300039450 Bacteria 1056
482 Ga0436363_1374544 3300039450 Bacteria 1774
483 Ga0436363_1655516 3300039450 Bacteria 1621
484 Ga0436362_0214581 3300039453 Bacteria 4556
485 Ga0436362_0863249 3300039453 Bacteria 5563
486 Ga0439449_0080293 3300042007 Unclassified 1203
487 Ga0451577_0006113 3300042876 Bacteria 12094
488 Ga0495580_0600642 3300046472 Bacteria 727
489 Ga0495656_0825526 3300046615 Bacteria 501
490 Ga0495672_0003219 3300047320 Bacteria 14197
491 Ga0496104_0484410 3300048907 Bacteria 1148
492 Ga0496104_0922986 3300048907 Unclassified 778
493 Ga0496106_0913610 3300048909 Unclassified 693
494 Ga0496110_0048027 3300048913 Bacteria 3740
495 Ga0496110_0249569 3300048913 Bacteria 1615
496 Ga0496112_0445605 3300048915 Bacteria 1233
497 Ga0496114_0162968 3300048917 Bacteria 1940
498 Ga0501033_0319710 3300049570 Bacteria 1090
499 Ga0501034_0024225 3300049571 Bacteria 6173
500 Ga0501034_0032084 3300049571 Bacteria 5336
501 Ga0501036_0220832 3300049572 Bacteria 1591
502 Ga0501038_0030627 3300049574 Bacteria 4758
503 Ga0501038_0199630 3300049574 Bacteria 1606
504 Ga0501039_0084825 3300049575 Bacteria 2467
505 Ga0501043_0003893 3300049579 Bacteria 12252
506 Ga0501046_0056453 3300049580 Bacteria 3082
507 Ga0501047_0006977 3300049581 Bacteria 10603
508 Ga0501048_0006258 3300049582 Bacteria 9053
509 Ga0501067_0107473 3300049583 Bacteria 1551
510 Ga0501068_0027869 3300049584 Bacteria 3338
511 Ga0501070_0037645 3300049586 Bacteria 4038
512 Ga0501073_0006651 3300049589 Bacteria 8610
513 Ga0501074_0002599 3300049590 Bacteria 12616
514 Ga0501074_0128035 3300049590 Bacteria 1817
515 Ga0501235_052032 3300049669 Unclassified 950
516 Ga0501256_009556 3300049685 Bacteria 917
517 Ga0501225_0128357 3300049705 Bacteria 758
518 Ga0501080_0030856 3300049742 Bacteria 4994
519 Ga0501080_0914789 3300049742 Bacteria 764
520 Ga0501083_0015427 3300049744 Bacteria 5350
521 Ga0501283_063117 3300049779 Bacteria 672
522 Ga0501035_0002433 3300049822 Bacteria 18202
523 Ga0501035_0006963 3300049822 Bacteria 10560
524 Ga0501044_0021227 3300049823 Bacteria 6932
525 nmdc:mga0k408_294327_c1 3300050493 Bacteria 969
526 nmdc:mga09592_1597151_c1 3300050508 Unclassified 528
527 nmdc:mga08y16_1517630_c1 3300050511 Unclassified 630
528 nmdc:mga08y16_217167_c1 3300050511 Unclassified 1980
529 nmdc:mga08y16_520213_c1 3300050511 Unclassified 1207
530 nmdc:mga0a205_1139698_c1 3300050515 Bacteria 627
531 Ga0500611_000003 3300053727 Bacteria 333431
532 Ga0501084_0290283 3300054114 Bacteria 1381
533 Ga0501082_0627530 3300060353 Bacteria 940
534 2831431002 2831426010 Bacteria 8662725
535 2848701347 2848694841 Bacteria 9205737
536 Ga0070674_101072006
537 JGI24744J21845_10007969
538 Ga0065712_10017179
539 Ga0065715_10016693
540 Ga0065707_10222666
541 Ga0070676_10111174
542 Ga0070683_100000327
543 Ga0070683_100047014
544 Ga0070690_100006021
545 Ga0070690_100832148
546 Ga0070670_100135752
547 Ga0070670_100194374
548 Ga0070670_100299930
549 Ga0070670_100485352
550 Ga0070677_10008266
551 Ga0068869_100008626
552 Ga0068869_100101195
553 Ga0068869_100532468
554 Ga0068869_100547179
555 Ga0068869_101069010
556 Ga0070666_10000112
557 Ga0070666_10050266
558 Ga0070666_10080871
559 Ga0070666_10090141
560 Ga0070666_10970757
561 Ga0070680_100087284
562 Ga0070680_101709233
563 Ga0070682_100185053
564 Ga0070682_101183784
565 Ga0068868_100030169
566 Ga0068868_100043035
567 Ga0068868_100079176
568 Ga0068868_100119276
569 Ga0068868_101547815
570 Ga0070660_101499860
571 Ga0070689_100013812
572 Ga0070689_100014980
573 Ga0070689_101092122
574 Ga0070687_100108340
575 Ga0070661_100003284
576 Ga0070661_100249389
577 Ga0070661_100719829
578 Ga0070668_100015227
579 Ga0070668_100875337
580 Ga0070669_100273148
581 Ga0070669_100409937
582 Ga0070669_101148460
583 Ga0070675_100014938
584 Ga0070675_100030473
585 Ga0070675_100038280
586 Ga0070675_100082815
587 Ga0070675_100561887
588 Ga0070671_100014491
589 Ga0070671_100513116
590 Ga0070674_100007487
591 Ga0070674_101190666
592 Ga0070673_100019745
593 Ga0070673_100081139
594 Ga0070673_100115886
595 Ga0070673_100119259
596 Ga0070673_100629336
597 Ga0070688_100016516
598 Ga0070688_100024744
599 Ga0070688_100088115
600 Ga0070688_100529089
601 Ga0070659_100087432
602 Ga0070659_101906502
603 Ga0070667_100089837
604 Ga0070667_100106255
605 Ga0070667_100239249
606 Ga0070667_100369609
607 Ga0070667_100504693
608 Ga0070714_100126191
609 Ga0070713_100295059
610 Ga0070700_100151158
611 Ga0070700_101725365
612 Ga0070663_100366190
613 Ga0070663_100659899
614 Ga0070663_100954961
615 Ga0070678_100451121
616 Ga0070662_100133555
617 Ga0070662_100208306
618 Ga0070662_100575358
619 Ga0070681_10233915
620 Ga0070681_10797740
621 Ga0068867_100068530
622 Ga0068867_100169243
623 Ga0068867_100229115
624 Ga0068867_100272625
625 Ga0068867_100310618
626 Ga0068867_100760761
627 Ga0068867_101223641
628 Ga0070685_10200033
629 Ga0070685_10647598
630 Ga0070685_11010843
631 Ga0070699_100295094
632 Ga0070679_100625383
633 Ga0070679_101242192
634 Ga0070684_100000290
635 Ga0070684_100024503
636 Ga0070684_100131147
637 Ga0070697_100756073
638 Ga0068853_100000837
639 Ga0068853_100003897
640 Ga0068853_100026823
641 Ga0068853_100347637
642 Ga0070672_100003616
643 Ga0070672_100053315
644 Ga0070672_100183022
645 Ga0070672_100190336
646 Ga0070686_100001004
647 Ga0070686_100031548
648 Ga0070686_101414721
649 Ga0070665_100007902
650 Ga0070665_100128970
651 Ga0070665_100150118
652 Ga0068855_100319035
653 Ga0068855_101518467
654 Ga0070664_100000509
655 Ga0070664_100005422
656 Ga0070664_100054002
657 Ga0068857_100000579
658 Ga0068857_100189998
659 Ga0068857_100230792
660 Ga0068857_100983644
661 Ga0068854_100022818
662 Ga0068854_100064864
663 Ga0068854_100086324
664 Ga0068856_100848833
665 Ga0068852_100005128
666 Ga0068852_100014577
667 Ga0068852_100038926
668 Ga0068852_100939164
669 Ga0068852_101076812
670 Ga0068859_100000018
671 Ga0068859_100009296
672 Ga0068859_100231407
673 Ga0068859_100312389
674 Ga0068859_100933783
675 Ga0068864_100002226
676 Ga0068864_100004779
677 Ga0068864_100393459
678 Ga0068866_10015867
679 Ga0068866_10064327
680 Ga0068866_10443749
681 Ga0068866_10687498
682 Ga0068861_100014393
683 Ga0068861_100096806
684 Ga0068861_101134320
685 Ga0068851_10047859
686 Ga0068870_10125553
687 Ga0068870_10200169
688 Ga0068870_10238154
689 Ga0068870_11008349
690 Ga0068863_100004036
691 Ga0068863_100026959
692 Ga0068863_100446377
693 Ga0068863_100629876
694 Ga0068863_101717580
695 Ga0068858_100013296
696 Ga0068858_100115344
697 Ga0068858_102042387
698 Ga0068860_100010496
699 Ga0068860_100081488
700 Ga0068860_100308200
701 Ga0068862_100169403
702 Ga0068862_100377876
703 Ga0068862_101363170
704 Ga0068862_101700358
705 Ga0068862_102549377
706 Ga0081455_10973772
707 Ga0070712_101043659
708 Ga0075366_10010357
709 Ga0097621_100006209
710 Ga0097621_100057773
711 Ga0097621_100057960
712 Ga0068871_100153118
713 Ga0068871_101301336
714 Ga0068871_101320049
715 Ga0075433_10393473
716 Ga0068865_100103818
717 Ga0068865_101005510
718 Ga0097620_100000018
719 Ga0097620_100009296
720 Ga0097620_100231393
721 Ga0097620_100312374
722 Ga0097620_100933784
723 Ga0075435_100263415
724 Ga0111539_10073934
725 Ga0111539_10147167
726 Ga0111539_10503267
727 Ga0105245_10052931
728 Ga0105247_10014874
729 Ga0105243_10046640
730 Ga0105241_10001966
731 Ga0105241_10014589
732 Ga0105241_10151358
733 Ga0105241_11356729
734 Ga0105242_10048296
735 Ga0105242_10229118
736 Ga0105242_11108134
737 Ga0105242_12608760
738 Ga0105248_10463189
739 Ga0105237_10003222
740 Ga0105237_11544857
741 Ga0105237_12476589
742 Ga0105238_10526652
743 Ga0105249_10007644
744 Ga0105249_10019500
745 Ga0105249_10049945
746 Ga0105249_10053213
747 Ga0105239_10017847
748 Ga0105239_10090565
749 Ga0105239_11111969
750 Ga0105239_12160442
751 Ga0105246_10005261
752 Ga0105246_10165488
753 Ga0105246_10424525
754 Ga0157371_10042293
755 Ga0157371_10182148
756 Ga0157371_10349713
757 Ga0157371_10716522
758 Ga0157370_10016291
759 Ga0157370_10060172
760 Ga0157370_10147488
761 Ga0157369_10203669
762 Ga0157369_10651784
763 Ga0157374_10000587
764 Ga0157374_10000745
765 Ga0157374_10048817
766 Ga0157374_10093011
767 Ga0157374_10233179
768 Ga0157374_10244393
769 Ga0157374_10333328
770 Ga0157378_10001243
771 Ga0157378_10184357
772 Ga0157378_11933368
773 Ga0163162_10001107
774 Ga0163162_10069880
775 Ga0163162_10074960
776 Ga0163162_11864386
777 Ga0163162_12735946
778 Ga0157372_10214763
779 Ga0157372_10269861
780 Ga0157372_10648502
781 Ga0157372_10667014
782 Ga0157372_11073894
783 Ga0157372_11459023
784 Ga0157375_10011638
785 Ga0157375_10012976
786 Ga0157375_10215721
787 Ga0157375_10297559
788 Ga0157375_10417441
789 Ga0157375_10444186
790 Ga0157375_10453112
791 Ga0157375_11973716
792 Ga0163163_10000867
793 Ga0163163_10019391
794 Ga0163163_10036588
795 Ga0163163_10249127
796 Ga0163163_10435546
797 Ga0163163_11222984
798 Ga0157380_10210691
799 Ga0157380_10303536
800 Ga0157380_10502503
801 Ga0157377_10003700
802 Ga0157377_10014761
803 Ga0157377_10108381
804 Ga0157377_10111805
805 Ga0157377_10577423
806 Ga0157379_10200925
807 Ga0157379_10990694
808 Ga0157376_10028617
809 Ga0157376_10076393
810 Ga0157376_11088513
811 Ga0157376_11596253
812 Ga0182006_1130986
813 Ga0163161_10011620
814 Ga0206350_10935620
815 Ga0213874_10029602
816 Ga0213874_10115099
817 Ga0213874_10242085
818 Ga0213876_10012187
819 Ga0213876_10036165
820 Ga0213876_10102078
821 Ga0213876_10138071
822 Ga0213875_10007646
823 Ga0213875_10018695
824 Ga0213875_10096614
825 Ga0213875_10116553
826 Ga0224712_10027953
827 Ga0207697_10113083
828 Ga0207697_10299701
829 Ga0207656_10320284
830 Ga0207682_10006928
831 Ga0207682_10064403
832 Ga0207642_10097074
833 Ga0207710_10021464
834 Ga0207688_10007004
835 Ga0207688_10394369
836 Ga0207688_10916176
837 Ga0207680_10000193
838 Ga0207680_10012375
839 Ga0207680_10038163
840 Ga0207680_10455554
841 Ga0207647_10128749
842 Ga0207685_10012869
843 Ga0207645_10000050
844 Ga0207645_10234901
845 Ga0207643_10006065
846 Ga0207643_10075245
847 Ga0207643_11037389
848 Ga0207654_10001980
849 Ga0207654_10366997
850 Ga0207707_10653720
851 Ga0207671_10002779
852 Ga0207660_10027253
853 Ga0207662_10354370
854 Ga0207649_10000567
855 Ga0207649_10007810
856 Ga0207649_10049798
857 Ga0207652_11111279
858 Ga0207681_10015127
859 Ga0207681_10030296
860 Ga0207681_10097299
861 Ga0207681_10261977
862 Ga0207681_10527006
863 Ga0207694_10416397
864 Ga0207650_10159886
865 Ga0207650_10173380
866 Ga0207650_10509311
867 Ga0207650_11299649
868 Ga0207650_11513527
869 Ga0207659_10059932
870 Ga0207659_10144815
871 Ga0207659_10202701
872 Ga0207659_10284575
873 Ga0207687_10059396
874 Ga0207700_10258559
875 Ga0207664_11532761
876 Ga0207644_10088304
877 Ga0207690_10003267
878 Ga0207690_10629794
879 Ga0207690_11450731
880 Ga0207706_10040287
881 Ga0207706_10487381
882 Ga0207686_10077825
883 Ga0207686_10082342
884 Ga0207686_10187063
885 Ga0207686_10224182
886 Ga0207670_10007146
887 Ga0207670_10109839
888 Ga0207670_10157043
889 Ga0207670_10857932
890 Ga0207669_10006805
891 Ga0207669_10018579
892 Ga0207669_10381188
893 Ga0207669_11902090
894 Ga0207704_10261924
895 Ga0207691_10004485
896 Ga0207691_10014830
897 Ga0207691_10088218
898 Ga0207691_10093329
899 Ga0207691_10096953
900 Ga0207711_10274359
901 Ga0207689_10000664
902 Ga0207689_10000843
903 Ga0207689_10003649
904 Ga0207689_10009455
905 Ga0207689_10013655
906 Ga0207689_10291325
907 Ga0207689_10993438
908 Ga0207661_10000411
909 Ga0207661_10007500
910 Ga0207661_11736116
911 Ga0207679_10000297
912 Ga0207679_10000800
913 Ga0207679_10176453
914 Ga0207679_10348345
915 Ga0207667_11120217
916 Ga0207667_11235394
917 Ga0207651_10025372
918 Ga0207651_10069067
919 Ga0207651_10104519
920 Ga0207651_11582351
921 Ga0207712_10007405
922 Ga0207712_10040591
923 Ga0207712_10177175
924 Ga0207668_10066086
925 Ga0207640_10077182
926 Ga0207640_10792455
927 Ga0207658_10004993
928 Ga0207658_10069994
929 Ga0207658_10100977
930 Ga0207658_10154194
931 Ga0207658_10823989
932 Ga0207677_10014890
933 Ga0207677_10038772
934 Ga0207677_10089615
935 Ga0207677_11461382
936 Ga0207703_10015149
937 Ga0207639_10001395
938 Ga0207639_10002886
939 Ga0207639_10026226
940 Ga0207639_10464313
941 Ga0207639_10560544
942 Ga0207678_10061294
943 Ga0207678_10730579
944 Ga0207708_10131462
945 Ga0207708_10544240
946 Ga0207702_11396560
947 Ga0207641_10000015
948 Ga0207641_10708363
949 Ga0207641_12500828
950 Ga0207648_10000464
951 Ga0207648_10076229
952 Ga0207648_10197486
953 Ga0207648_10273217
954 Ga0207648_10399008
955 Ga0207648_10602736
956 Ga0207648_10691954
957 Ga0207676_10005777
958 Ga0207676_10009634
959 Ga0207676_10403572
960 Ga0207674_10012404
961 Ga0207674_10025239
962 Ga0207674_10030912
963 Ga0207674_10031296
964 Ga0207675_100000144
965 Ga0207675_100036847
966 Ga0207675_100085078
967 Ga0207675_101756993
968 Ga0207683_10000736
969 Ga0207683_10004211
970 Ga0207683_10975623
971 Ga0207683_11462663
972 Ga0207698_10032497
973 Ga0207698_10183844
974 Ga0207698_10274548
975 Ga0207698_11361783
976 Ga0207428_10170029
977 Ga0207428_10508077
978 Ga0268266_10028089
979 Ga0268266_10087127
980 Ga0268266_10096880
981 Ga0268265_11017835
982 Ga0268264_10019547
983 Ga0268264_10021492
984 Ga0268264_10570187
985 Ga0268264_10649799
986 Ga0307516_10229057
987 Ga0307410_11221777
988 Ga0307414_10245863
989 Ga0373935_0420439
990 Ga0395900_0287438
991 Ga0395900_0639696
992 Ga0395898_0924827
993 Ga0395905_0003668
994 Ga0395905_0329014
995 Ga0436364_0071076
996 Ga0436364_0095149
997 Ga0436364_0118784
998 Ga0436364_0378137
999 Ga0436364_0478514
1000 Ga0436364_1231066
1001 Ga0436364_1244063
1002 Ga0436364_1280004
1003 Ga0436364_1354718
1004 Ga0436365_0057363
1005 Ga0436365_0080980
1006 Ga0436365_0610994
1007 Ga0436365_0689239
1008 Ga0436365_1297406
1009 Ga0436365_1313675
1010 Ga0436365_1930067
1011 Ga0436365_1932428
1012 Ga0436360_0526332
1013 Ga0436360_1058969
1014 Ga0436360_1343688
1015 Ga0436363_0790653
1016 Ga0436363_1145334
1017 Ga0436363_1374544
1018 Ga0436363_1655516
1019 Ga0436362_0214581
1020 Ga0436362_0863249
1021 Ga0439449_0080293
1022 Ga0451577_0006113
1023 Ga0495580_0600642
1024 Ga0495656_0825526
1025 Ga0495672_0003219
1026 Ga0496104_0484410
1027 Ga0496104_0922986
1028 Ga0496106_0913610
1029 Ga0496110_0048027
1030 Ga0496110_0249569
1031 Ga0496112_0445605
1032 Ga0496114_0162968
1033 Ga0501033_0319710
1034 Ga0501034_0024225
1035 Ga0501034_0032084
1036 Ga0501036_0220832
1037 Ga0501038_0030627
1038 Ga0501038_0199630
1039 Ga0501039_0084825
1040 Ga0501043_0003893
1041 Ga0501046_0056453
1042 Ga0501047_0006977
1043 Ga0501048_0006258
1044 Ga0501067_0107473
1045 Ga0501068_0027869
1046 Ga0501070_0037645
1047 Ga0501073_0006651
1048 Ga0501074_0002599
1049 Ga0501074_0128035
1050 Ga0501235_052032
1051 Ga0501256_009556
1052 Ga0501225_0128357
1053 Ga0501080_0030856
1054 Ga0501080_0914789
1055 Ga0501083_0015427
1056 Ga0501283_063117
1057 Ga0501035_0002433
1058 Ga0501035_0006963
1059 Ga0501044_0021227
1060 nmdc:mga0k408_294327_c1
1061 nmdc:mga09592_1597151_c1
1062 nmdc:mga08y16_1517630_c1
1063 nmdc:mga08y16_217167_c1
1064 nmdc:mga08y16_520213_c1
1065 nmdc:mga0a205_1139698_c1
1066 Ga0500611_000003
1067 Ga0501084_0290283
1068 Ga0501082_0627530
1069 2831431002
1070 2848701347

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

29

148

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9713 4 129
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9633 4 129
6izh-assembly1.cif.gz_E crystal structure of deaminase amne from pseudomonas sp. ap-3 0.9573 23 128
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.9464 21 129
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.938 21 129
ID Description Score Start End Superfamily
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9713 4 129 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9633 4 129 3.30.1330.40
af_Q86I26_20_139_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9593 20 129 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9411 21 129 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9328 21 129 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A839GS20-F1-model_v4 Enamine deaminase RidA (YjgF/YER057c/UK114 family) 0.9994 3 128
AF-A0A4Q7MUX6-F1-model_v4 Enamine deaminase RidA (YjgF/YER057c/UK114 family) 0.9977 3 130
AF-A0A432HQY2-F1-model_v4 RidA family protein 0.9965 31 129
AF-A0A8A6HG69-F1-model_v4 deleted 0.9945 5 129
AF-A0A2H5YV86-F1-model_v4 Aminoacrylate peracid reductase RutC (EC 1.-.-.-) 0.9937 2 129 GO:0016491

Map