F460638

General Info

Members Datasets Scaffolds Average Seq Length
535 257 1070 216

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10002475|Ga0075366_100024757
Length 243
Sequence MERKRRGEIKPTRSNSSNRWMHEHVTDPYVHEAKRLGYRSRSAFKILEIDQKCKLLKPGMTVVDLGAAPGGWSQMVSPKVGAPGGDVAPKTGAEASKSSGKSRKGRVIAIDLLEMQGLAGVEFIQADFSTDEGLALVTATLGKDHKADLVMSDMAPNISGIGISDQAKSMYLCELALDFAAGFLQPNGAFVVKTFQGVGFTEFFQSMKTTFKEVKSVKPKASRDRSTEIYLVGQGLRASTQRG

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
67 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
68 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
69 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
70 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
82 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
83 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
84 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
98 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
106 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
107 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
110 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
145 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
157 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
158 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
159 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
164 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
187 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
190 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
191 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
192 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
202 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
203 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
204 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
205 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
206 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
207 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
208 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
209 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
210 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
213 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
214 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
215 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
216 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
217 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
218 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
219 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
220 2738541297 Duganella sp. GV083 Isolate Unclassified
221 2738541357 Duganella sp. GV053 Isolate Unclassified
222 2738543003 Duganella sp. GV066 Isolate Unclassified
223 2738543026 Duganella sp. GV089 Isolate Unclassified
224 2738543029 Duganella sp. GV039 Isolate Unclassified
225 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
226 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
227 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
228 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
229 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
230 2842711865 Duganella sp. R-73148 Isolate Unclassified
231 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
232 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
233 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
234 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
235 2857553236 Duganella sp. R-74557 Isolate Unclassified
236 2857558681 Duganella sp. R-74565 Isolate Unclassified
237 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
238 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
239 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
240 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
241 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
242 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
243 2904424332 Duganella sp. 1411 Isolate Rhizosphere
244 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
245 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
246 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
247 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
248 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
249 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
250 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
251 2919476304 Duganella sp. 3397 Isolate Unclassified
252 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
253 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
254 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
255 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
256 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
257 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.78
Metatranscriptomes 0
Isolates 8.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.48
Nodule 0.75
Rhizoplane 4.49
Rhizosphere 77.76
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10002475 3300006195 Bacteria 9465
2 JGI25155J39150_1000275 3300002704 Bacteria 18778
3 JGI25156J39149_1002838 3300002705 Bacteria 5959
4 JGI25154J39366_1001607 3300002738 Bacteria 7679
5 rootH2_10024853 3300003320 Bacteria 1002
6 Ga0055525_1000047 3300003759 Bacteria 261507
7 Ga0055529_1000125 3300003763 Bacteria 110810
8 Ga0065165_1019953 3300005262 Bacteria 2377
9 Ga0065714_10083160 3300005288 Bacteria 2265
10 Ga0070658_10273733 3300005327 Bacteria 1436
11 Ga0070682_100438685 3300005337 Bacteria 997
12 Ga0070660_100056401 3300005339 Bacteria 3039
13 Ga0070660_100161031 3300005339 Bacteria 1808
14 Ga0070660_100606578 3300005339 Bacteria 915
15 Ga0070661_100235102 3300005344 Bacteria 1409
16 Ga0070661_100488205 3300005344 Bacteria 984
17 Ga0070668_100278488 3300005347 Bacteria 1396
18 Ga0070659_100267538 3300005366 Bacteria 1419
19 Ga0070667_100347981 3300005367 Bacteria 1341
20 Ga0070714_100003989 3300005435 Bacteria 11096
21 Ga0070662_100296908 3300005457 Bacteria 1311
22 Ga0068855_100000037 3300005563 Bacteria 158161
23 Ga0070664_100594956 3300005564 Bacteria 1025
24 Ga0068857_100200958 3300005577 Bacteria 1817
25 Ga0068866_10089364 3300005718 Bacteria 1674
26 Ga0068858_100165715 3300005842 Bacteria 2082
27 Ga0081539_10003666 3300005985 Bacteria 18444
28 Ga0075365_10007553 3300006038 Bacteria 6102
29 Ga0075365_10041245 3300006038 Bacteria 3015
30 Ga0075368_10002260 3300006042 Bacteria 6260
31 Ga0075363_100003613 3300006048 Bacteria 6626
32 Ga0075364_10005797 3300006051 Bacteria 7207
33 Ga0070716_100072557 3300006173 Bacteria 2027
34 Ga0075362_10008887 3300006177 Bacteria 3862
35 Ga0075367_10002015 3300006178 Bacteria 9068
36 Ga0075369_10011342 3300006186 Bacteria 3505
37 Ga0075369_10026560 3300006186 Bacteria 2414
38 Ga0075366_10111227 3300006195 Bacteria 1647
39 Ga0075370_10033429 3300006353 Bacteria 2880
40 Ga0075370_10266106 3300006353 Bacteria 1017
41 Ga0079104_1003020 3300006946 Bacteria 8261
42 Ga0105244_10023223 3300009036 Bacteria 3402
43 Ga0105244_10083964 3300009036 Bacteria 1573
44 Ga0105240_10190525 3300009093 Bacteria 2412
45 Ga0105240_10227932 3300009093 Bacteria 2167
46 Ga0105243_10018177 3300009148 Bacteria 5322
47 Ga0105237_10122054 3300009545 Bacteria 2600
48 Ga0105237_11000262 3300009545 Bacteria 843
49 Ga0105239_10492733 3300010375 Bacteria 1393
50 Ga0105246_10579956 3300011119 Bacteria 966
51 Ga0157371_10000013 3300013102 Bacteria 352631
52 Ga0157371_10380919 3300013102 Bacteria 1030
53 Ga0157370_10001049 3300013104 Bacteria 34805
54 Ga0157370_10224539 3300013104 Bacteria 1739
55 Ga0157370_10620573 3300013104 Bacteria 989
56 Ga0157374_10181849 3300013296 Bacteria 2054
57 Ga0157378_10050117 3300013297 Bacteria 3715
58 Ga0157372_10434256 3300013307 Bacteria 1531
59 Ga0157372_10491272 3300013307 Bacteria 1431
60 Ga0182008_10016736 3300014497 Bacteria 3805
61 Ga0182008_10400130 3300014497 Bacteria 737
62 Ga0182006_1000035 3300015261 Bacteria 232349
63 Ga0182006_1000096 3300015261 Bacteria 104597
64 Ga0182006_1022210 3300015261 Bacteria 2639
65 Ga0182007_10000040 3300015262 Bacteria 120364
66 Ga0182005_1000013 3300015265 Bacteria 396391
67 Ga0182005_1000025 3300015265 Bacteria 235532
68 Ga0163161_10048114 3300017792 Bacteria 3079
69 Ga0163161_10211355 3300017792 Bacteria 1499
70 Ga0213872_10000020 3300021361 Bacteria 159607
71 Ga0213872_10019675 3300021361 Bacteria 3109
72 Ga0209437_108904 3300025233 Bacteria 1587
73 Ga0209455_1000044 3300025272 Bacteria 410787
74 Ga0207705_10078474 3300025909 Bacteria 2403
75 Ga0207657_10091544 3300025919 Bacteria 2536
76 Ga0207657_10453933 3300025919 Bacteria 1006
77 Ga0207657_10522609 3300025919 Bacteria 929
78 Ga0207649_10100132 3300025920 Bacteria 1916
79 Ga0207690_10039891 3300025932 Bacteria 3066
80 Ga0207690_10210151 3300025932 Bacteria 1483
81 Ga0207706_10474013 3300025933 Bacteria 1082
82 Ga0207686_10187850 3300025934 Bacteria 1470
83 Ga0207709_10025077 3300025935 Bacteria 3411
84 Ga0207679_10040399 3300025945 Bacteria 3339
85 Ga0207667_10000053 3300025949 Bacteria 226712
86 Ga0207658_10087973 3300025986 Bacteria 2400
87 Ga0207703_10277411 3300026035 Bacteria 1521
88 Ga0207674_10106065 3300026116 Bacteria 2788
89 Ga0209281_1007059 3300027111 Bacteria 2846
90 Ga0307511_10001014 3300030521 Bacteria 29824
91 Ga0316181_1218544 3300030744 Bacteria 3290
92 Ga0316182_1199092 3300030745 Bacteria 1605
93 Ga0265328_10000005 3300031239 Bacteria 230229
94 Ga0265328_10001363 3300031239 Bacteria 11272
95 Ga0265328_10011926 3300031239 Bacteria 3465
96 Ga0265331_10000070 3300031250 Bacteria 152331
97 Ga0265331_10001058 3300031250 Bacteria 21454
98 Ga0265327_10000156 3300031251 Bacteria 146362
99 Ga0265327_10000472 3300031251 Bacteria 71196
100 Ga0265327_10018727 3300031251 Bacteria 4279
101 Ga0307408_100000294 3300031548 Bacteria 48528
102 Ga0307507_10059523 3300033179 Bacteria 3575
103 Ga0395899_0005514 3300037312 Bacteria 9803
104 Ga0395899_0208194 3300037312 Bacteria 1360
105 Ga0395899_0227147 3300037312 Bacteria 1290
106 Ga0395900_0000331 3300037418 Bacteria 69780
107 Ga0395900_0039845 3300037418 Bacteria 4841
108 Ga0395900_0116900 3300037418 Bacteria 2736
109 Ga0395900_0342376 3300037418 Bacteria 1470
110 Ga0395900_0376926 3300037418 Bacteria 1387
111 Ga0395900_0424199 3300037418 Bacteria 1290
112 Ga0395900_0703921 3300037418 Bacteria 943
113 Ga0395898_0093570 3300037466 Bacteria 2888
114 Ga0395898_0339473 3300037466 Bacteria 1432
115 Ga0395905_0403751 3300037471 Bacteria 1261
116 Ga0395901_0000097 3300038443 Bacteria 118528
117 Ga0395901_0028671 3300038443 Bacteria 5726
118 Ga0395901_0706435 3300038443 Bacteria 1005
119 Ga0436361_0314818 3300039447 Bacteria 1557
120 Ga0436361_0498733 3300039447 Bacteria 3114
121 Ga0436361_0594223 3300039447 Bacteria 49801
122 Ga0436361_0922237 3300039447 Bacteria 22454
123 Ga0451804_0636132 3300041463 Bacteria 772
124 Ga0439448_0020276 3300042005 Bacteria 2055
125 Ga0439448_0091997 3300042005 Bacteria 1025
126 Ga0439455_0111585 3300042012 Bacteria 761
127 Ga0439458_0004250 3300042157 Bacteria 3305
128 Ga0451577_0045277 3300042876 Bacteria 3938
129 Ga0466969_0006928 3300044656 Bacteria 6031
130 Ga0466969_0045626 3300044656 Bacteria 2175
131 Ga0453683_0076793 3300044673 Bacteria 2092
132 Ga0466965_0067998 3300044683 Bacteria 1788
133 Ga0453684_0000005 3300044712 Bacteria 1431632
134 Ga0453684_0000163 3300044712 Bacteria 296196
135 Ga0453684_0000386 3300044712 Bacteria 180948
136 Ga0466971_0082169 3300044719 Bacteria 1470
137 Ga0466968_0169739 3300044735 Bacteria 1010
138 Ga0466957_0317123 3300044842 Bacteria 1051
139 Ga0466960_0056664 3300044901 Bacteria 1909
140 Ga0451576_0001961 3300045051 Bacteria 32770
141 Ga0451576_0058004 3300045051 Bacteria 4047
142 Ga0451576_0103062 3300045051 Bacteria 2968
143 Ga0451576_0929813 3300045051 Unclassified 912
144 Ga0466958_0348328 3300045836 Bacteria 953
145 Ga0466958_0416343 3300045836 Bacteria 868
146 Ga0466967_0307423 3300045976 Bacteria 1526
147 Ga0495617_000004 3300046452 Bacteria 511274
148 Ga0495617_000009 3300046452 Bacteria 312936
149 Ga0495617_018168 3300046452 Bacteria 2377
150 Ga0495617_031790 3300046452 Bacteria 1771
151 Ga0495627_000008 3300046453 Bacteria 572150
152 Ga0495627_006670 3300046453 Bacteria 4497
153 Ga0495627_023646 3300046453 Bacteria 2010
154 Ga0495603_0052996 3300046455 Bacteria 2407
155 Ga0495590_0013563 3300046457 Bacteria 2992
156 Ga0495629_0006506 3300046459 Bacteria 8656
157 Ga0495638_0137311 3300046460 Bacteria 1430
158 Ga0495650_0000011 3300046471 Bacteria 615329
159 Ga0495650_0000494 3300046471 Bacteria 59876
160 Ga0495650_0000593 3300046471 Bacteria 50088
161 Ga0495650_0028439 3300046471 Bacteria 2566
162 Ga0495582_0021333 3300046473 Bacteria 3545
163 Ga0495605_0000024 3300046474 Bacteria 236016
164 Ga0495605_0015140 3300046474 Bacteria 4203
165 Ga0495605_0047984 3300046474 Bacteria 2092
166 Ga0495605_0066053 3300046474 Bacteria 1719
167 Ga0495605_0077298 3300046474 Bacteria 1561
168 Ga0495584_0004700 3300046491 Bacteria 7312
169 Ga0495584_0018909 3300046491 Bacteria 3500
170 Ga0495584_0026934 3300046491 Bacteria 2913
171 Ga0495584_0057393 3300046491 Bacteria 1958
172 Ga0495584_0149034 3300046491 Bacteria 1188
173 Ga0495584_0176680 3300046491 Bacteria 1085
174 Ga0495584_0201995 3300046491 Bacteria 1010
175 Ga0495585_0017853 3300046492 Bacteria 4095
176 Ga0495585_0021109 3300046492 Bacteria 3740
177 Ga0495585_0029443 3300046492 Bacteria 3125
178 Ga0495585_0032805 3300046492 Bacteria 2940
179 Ga0495585_0055498 3300046492 Bacteria 2188
180 Ga0495585_0158847 3300046492 Bacteria 1174
181 Ga0495594_0011814 3300046499 Bacteria 4541
182 Ga0495596_0011263 3300046500 Bacteria 3863
183 Ga0495596_0011276 3300046500 Bacteria 3861
184 Ga0495596_0032096 3300046500 Bacteria 2095
185 Ga0495607_0006535 3300046501 Bacteria 8196
186 Ga0495607_0036400 3300046501 Bacteria 2965
187 Ga0495607_0038773 3300046501 Bacteria 2851
188 Ga0495607_0044902 3300046501 Bacteria 2602
189 Ga0495607_0079132 3300046501 Bacteria 1811
190 Ga0495607_0158591 3300046501 Bacteria 1151
191 Ga0495607_0183740 3300046501 Bacteria 1046
192 Ga0495583_0003595 3300046506 Bacteria 11632
193 Ga0495583_0014453 3300046506 Bacteria 4355
194 Ga0495583_0016161 3300046506 Bacteria 4023
195 Ga0495583_0017569 3300046506 Bacteria 3793
196 Ga0495583_0019334 3300046506 Bacteria 3558
197 Ga0495583_0024000 3300046506 Bacteria 3073
198 Ga0495583_0153247 3300046506 Bacteria 954
199 Ga0495583_0158597 3300046506 Bacteria 934
200 Ga0495583_0212173 3300046506 Bacteria 784
201 Ga0495606_0000927 3300046507 Bacteria 43195
202 Ga0495606_0043133 3300046507 Bacteria 3011
203 Ga0495606_0068443 3300046507 Bacteria 2246
204 Ga0495606_0143644 3300046507 Bacteria 1407
205 Ga0495606_0215008 3300046507 Bacteria 1086
206 Ga0495610_0091031 3300046512 Bacteria 1382
207 Ga0495610_0168228 3300046512 Bacteria 921
208 Ga0495610_0211781 3300046512 Bacteria 787
209 Ga0495616_0000567 3300046513 Bacteria 27995
210 Ga0495616_0005459 3300046513 Bacteria 7820
211 Ga0495616_0016582 3300046513 Bacteria 4074
212 Ga0495616_0019296 3300046513 Bacteria 3722
213 Ga0495616_0021514 3300046513 Bacteria 3492
214 Ga0495616_0027344 3300046513 Bacteria 3027
215 Ga0495616_0044278 3300046513 Bacteria 2258
216 Ga0495616_0051240 3300046513 Bacteria 2059
217 Ga0495616_0063906 3300046513 Bacteria 1797
218 Ga0495616_0082985 3300046513 Bacteria 1529
219 Ga0495616_0171617 3300046513 Bacteria 969
220 Ga0495616_0190919 3300046513 Bacteria 905
221 Ga0495631_0014519 3300046518 Bacteria 3799
222 Ga0495631_0029309 3300046518 Bacteria 2504
223 Ga0495631_0050423 3300046518 Bacteria 1820
224 Ga0495631_0051377 3300046518 Bacteria 1801
225 Ga0495631_0062609 3300046518 Bacteria 1611
226 Ga0495631_0099370 3300046518 Bacteria 1252
227 Ga0495631_0218182 3300046518 Bacteria 814
228 Ga0495632_0005838 3300046519 Bacteria 8057
229 Ga0495632_0022036 3300046519 Bacteria 3422
230 Ga0495632_0024467 3300046519 Bacteria 3206
231 Ga0495632_0026745 3300046519 Bacteria 3032
232 Ga0495632_0033167 3300046519 Bacteria 2653
233 Ga0495632_0180746 3300046519 Bacteria 966
234 Ga0495637_0039723 3300046520 Bacteria 2029
235 Ga0495643_0000346 3300046522 Bacteria 63025
236 Ga0495643_0012630 3300046522 Bacteria 5087
237 Ga0495643_0030060 3300046522 Bacteria 3036
238 Ga0495643_0062471 3300046522 Bacteria 1971
239 Ga0495643_0087382 3300046522 Bacteria 1613
240 Ga0495643_0176092 3300046522 Bacteria 1042
241 Ga0495644_0005136 3300046523 Bacteria 5125
242 Ga0495644_0009052 3300046523 Bacteria 3832
243 Ga0495644_0009840 3300046523 Bacteria 3680
244 Ga0495644_0053003 3300046523 Bacteria 1524
245 Ga0495644_0086974 3300046523 Bacteria 1178
246 Ga0495644_0142217 3300046523 Bacteria 916
247 Ga0495648_0000290 3300046524 Bacteria 57025
248 Ga0495648_0013732 3300046524 Bacteria 5970
249 Ga0495648_0022393 3300046524 Bacteria 4350
250 Ga0495648_0031398 3300046524 Bacteria 3498
251 Ga0495648_0043069 3300046524 Bacteria 2833
252 Ga0495648_0058665 3300046524 Bacteria 2300
253 Ga0495663_0048740 3300046525 Bacteria 1307
254 Ga0495666_0019043 3300046526 Bacteria 3409
255 Ga0495642_0003195 3300046528 Bacteria 6490
256 Ga0495642_0011766 3300046528 Bacteria 3370
257 Ga0495642_0012301 3300046528 Bacteria 3298
258 Ga0495642_0013208 3300046528 Bacteria 3190
259 Ga0495642_0104441 3300046528 Bacteria 1208
260 Ga0495642_0128939 3300046528 Bacteria 1088
261 Ga0495642_0174828 3300046528 Bacteria 933
262 Ga0495654_0025293 3300046530 Bacteria 3059
263 Ga0495654_0090123 3300046530 Bacteria 1424
264 Ga0495654_0097401 3300046530 Bacteria 1358
265 Ga0495654_0099259 3300046530 Bacteria 1342
266 Ga0495654_0107132 3300046530 Bacteria 1279
267 Ga0495665_0245868 3300046531 Bacteria 921
268 Ga0495665_0400864 3300046531 Bacteria 696
269 Ga0495586_0043652 3300046535 Bacteria 2414
270 Ga0495609_0000030 3300046538 Bacteria 215885
271 Ga0495609_0010440 3300046538 Bacteria 4451
272 Ga0495609_0010610 3300046538 Bacteria 4413
273 Ga0495609_0037046 3300046538 Bacteria 2200
274 Ga0495609_0056762 3300046538 Bacteria 1734
275 Ga0495609_0128833 3300046538 Bacteria 1084
276 Ga0495609_0183994 3300046538 Bacteria 878
277 Ga0495597_0014538 3300046542 Bacteria 3745
278 Ga0495597_0026824 3300046542 Bacteria 2645
279 Ga0495597_0040274 3300046542 Bacteria 2088
280 Ga0495597_0058467 3300046542 Bacteria 1685
281 Ga0495597_0073753 3300046542 Bacteria 1467
282 Ga0495597_0152101 3300046542 Bacteria 949
283 Ga0495597_0153221 3300046542 Bacteria 944
284 Ga0495622_0051793 3300046557 Bacteria 1904
285 Ga0495622_0108602 3300046557 Bacteria 1270
286 Ga0495633_0000271 3300046558 Bacteria 60538
287 Ga0495633_0012923 3300046558 Bacteria 4417
288 Ga0495633_0018039 3300046558 Bacteria 3590
289 Ga0495633_0019858 3300046558 Bacteria 3390
290 Ga0495633_0024173 3300046558 Bacteria 3004
291 Ga0495633_0094112 3300046558 Bacteria 1392
292 Ga0495633_0176617 3300046558 Bacteria 983
293 Ga0495656_0049916 3300046615 Bacteria 1784
294 Ga0495656_0068480 3300046615 Bacteria 1569
295 Ga0495656_0199842 3300046615 Bacteria 991
296 Ga0495668_0002794 3300046616 Bacteria 13898
297 Ga0495668_0020751 3300046616 Bacteria 3775
298 Ga0495668_0022209 3300046616 Bacteria 3628
299 Ga0495668_0026520 3300046616 Bacteria 3287
300 Ga0495668_0358502 3300046616 Bacteria 800
301 Ga0495668_0466072 3300046616 Bacteria 695
302 Ga0495611_0089313 3300046648 Bacteria 1423
303 Ga0495611_0168561 3300046648 Bacteria 1023
304 Ga0495625_0072104 3300046660 Bacteria 2422
305 Ga0495625_0159012 3300046660 Bacteria 1515
306 Ga0495625_0318682 3300046660 Bacteria 990
307 Ga0495625_0335045 3300046660 Bacteria 960
308 Ga0495625_0356308 3300046660 Bacteria 923
309 Ga0495635_0001055 3300046663 Bacteria 18247
310 Ga0495661_0003016 3300046665 Bacteria 12690
311 Ga0495661_0023036 3300046665 Bacteria 4047
312 Ga0495661_0026310 3300046665 Bacteria 3748
313 Ga0495661_0053811 3300046665 Bacteria 2419
314 Ga0495661_0066768 3300046665 Bacteria 2115
315 Ga0495661_0069649 3300046665 Bacteria 2060
316 Ga0495661_0089806 3300046665 Bacteria 1750
317 Ga0495661_0128769 3300046665 Bacteria 1389
318 Ga0495661_0172670 3300046665 Bacteria 1151
319 Ga0495588_0000078 3300046674 Bacteria 214254
320 Ga0495588_0021100 3300046674 Bacteria 3206
321 Ga0495588_0032117 3300046674 Bacteria 2644
322 Ga0495588_0056553 3300046674 Bacteria 2025
323 Ga0495623_0078531 3300046679 Bacteria 2046
324 Ga0495669_0000057 3300046684 Bacteria 76704
325 Ga0495669_0000300 3300046684 Bacteria 27496
326 Ga0495669_0052105 3300046684 Bacteria 1837
327 Ga0495669_0272872 3300046684 Bacteria 813
328 Ga0495613_0052335 3300046689 Bacteria 3008
329 Ga0495613_0265214 3300046689 Bacteria 1195
330 Ga0495670_0031651 3300046691 Bacteria 2629
331 Ga0495670_0037555 3300046691 Bacteria 2414
332 Ga0495670_0037740 3300046691 Bacteria 2408
333 Ga0495670_0038742 3300046691 Bacteria 2377
334 Ga0495670_0039377 3300046691 Bacteria 2357
335 Ga0495670_0070088 3300046691 Bacteria 1773
336 Ga0495670_0123074 3300046691 Bacteria 1348
337 Ga0495670_0344590 3300046691 Bacteria 801
338 Ga0495670_0468333 3300046691 Bacteria 683
339 Ga0495671_0014453 3300046692 Bacteria 4248
340 Ga0495671_0045634 3300046692 Bacteria 2193
341 Ga0495671_0106501 3300046692 Bacteria 1369
342 Ga0495671_0270608 3300046692 Bacteria 819
343 Ga0495649_0016251 3300046694 Bacteria 4220
344 Ga0495649_0048714 3300046694 Bacteria 2303
345 Ga0495649_0054619 3300046694 Bacteria 2159
346 Ga0495589_0000021 3300046794 Bacteria 197941
347 Ga0495589_0015027 3300046794 Bacteria 3984
348 Ga0495589_0018583 3300046794 Bacteria 3563
349 Ga0495589_0026665 3300046794 Bacteria 2926
350 Ga0495589_0033697 3300046794 Bacteria 2571
351 Ga0495589_0136801 3300046794 Bacteria 1174
352 Ga0495660_0018126 3300046810 Bacteria 4048
353 Ga0495660_0043715 3300046810 Bacteria 2469
354 Ga0495660_0048746 3300046810 Bacteria 2315
355 Ga0495660_0052263 3300046810 Bacteria 2220
356 Ga0495660_0054214 3300046810 Bacteria 2172
357 Ga0495660_0090284 3300046810 Bacteria 1593
358 Ga0495660_0100935 3300046810 Bacteria 1485
359 Ga0495660_0191465 3300046810 Bacteria 982
360 Ga0495660_0211579 3300046810 Bacteria 919
361 Ga0495581_0024181 3300047315 Bacteria 3520
362 Ga0495604_0125913 3300047317 Bacteria 1847
363 Ga0495636_0027149 3300047318 Bacteria 2332
364 Ga0495636_0192061 3300047318 Bacteria 930
365 Ga0495636_0302368 3300047318 Bacteria 748
366 Ga0495672_0000031 3300047320 Bacteria 298258
367 Ga0495672_0019596 3300047320 Bacteria 4459
368 Ga0495672_0024609 3300047320 Bacteria 3874
369 Ga0495672_0114201 3300047320 Bacteria 1445
370 Ga0495676_0037581 3300047321 Bacteria 4028
371 Ga0495676_0290304 3300047321 Bacteria 1105
372 Ga0495680_0045790 3300047322 Bacteria 3452
373 Ga0495683_0012100 3300047323 Bacteria 4536
374 Ga0495683_0050854 3300047323 Bacteria 2073
375 Ga0495683_0075523 3300047323 Bacteria 1650
376 Ga0495687_000407 3300047443 Bacteria 53252
377 Ga0495687_010545 3300047443 Bacteria 5060
378 Ga0495687_017002 3300047443 Bacteria 3642
379 Ga0495687_025311 3300047443 Bacteria 2808
380 Ga0495675_0023477 3300047444 Bacteria 3929
381 Ga0495677_0000029 3300047445 Bacteria 91481
382 Ga0495677_0018533 3300047445 Bacteria 2522
383 Ga0495677_0025206 3300047445 Bacteria 2157
384 Ga0495677_0117602 3300047445 Bacteria 1012
385 Ga0495679_018541 3300047446 Bacteria 2468
386 Ga0495679_022130 3300047446 Bacteria 2181
387 Ga0495679_033506 3300047446 Bacteria 1640
388 Ga0495679_041958 3300047446 Bacteria 1413
389 Ga0495679_071968 3300047446 Bacteria 994
390 Ga0495685_017538 3300047447 Bacteria 2452
391 Ga0495685_024221 3300047447 Bacteria 2088
392 Ga0495685_037146 3300047447 Bacteria 1671
393 Ga0495685_046579 3300047447 Bacteria 1475
394 Ga0495673_0000026 3300047469 Bacteria 476378
395 Ga0495673_0218919 3300047469 Bacteria 705
396 Ga0495681_0016324 3300047470 Bacteria 4166
397 Ga0495681_0017670 3300047470 Bacteria 3951
398 Ga0495681_0020448 3300047470 Bacteria 3592
399 Ga0495681_0030366 3300047470 Bacteria 2752
400 Ga0495681_0068128 3300047470 Bacteria 1620
401 Ga0495681_0129842 3300047470 Bacteria 1073
402 Ga0495681_0142862 3300047470 Bacteria 1009
403 Ga0495686_0000738 3300047472 Bacteria 43615
404 Ga0495686_0125112 3300047472 Bacteria 1529
405 Ga0495593_0015115 3300047673 Bacteria 4383
406 Ga0495614_0003050 3300048089 Bacteria 7465
407 Ga0495615_0065675 3300048090 Bacteria 967
408 Ga0495626_0009200 3300048091 Bacteria 5347
409 Ga0495626_0015845 3300048091 Bacteria 3847
410 Ga0495626_0016880 3300048091 Bacteria 3698
411 Ga0495626_0033977 3300048091 Bacteria 2441
412 Ga0495626_0184133 3300048091 Bacteria 864
413 Ga0496100_0063388 3300048903 Bacteria 2442
414 Ga0496100_0367224 3300048903 Bacteria 1090
415 Ga0496101_0020529 3300048904 Bacteria 4524
416 Ga0496101_0071264 3300048904 Bacteria 2547
417 Ga0496102_0000198 3300048905 Bacteria 81732
418 Ga0496102_0099041 3300048905 Bacteria 2705
419 Ga0496102_0132452 3300048905 Bacteria 2334
420 Ga0496103_0028205 3300048906 Bacteria 3405
421 Ga0496104_0264325 3300048907 Bacteria 1633
422 Ga0496105_0107014 3300048908 Bacteria 2308
423 Ga0496107_0088394 3300048910 Bacteria 2262
424 Ga0496108_0263227 3300048911 Bacteria 1501
425 Ga0496108_0392629 3300048911 Bacteria 1212
426 Ga0496109_0069130 3300048912 Bacteria 3238
427 Ga0496109_0278255 3300048912 Bacteria 1577
428 Ga0496110_0017718 3300048913 Bacteria 5958
429 Ga0496110_0382513 3300048913 Bacteria 1282
430 Ga0496111_0027877 3300048914 Bacteria 4000
431 Ga0496111_0155586 3300048914 Bacteria 1696
432 Ga0496111_0618430 3300048914 Bacteria 792
433 Ga0496113_0200467 3300048916 Bacteria 1586
434 Ga0496113_0211702 3300048916 Bacteria 1543
435 Ga0496116_0017608 3300048919 Bacteria 5537
436 Ga0496117_0000045 3300048920 Bacteria 301047
437 Ga0496118_0000041 3300048921 Bacteria 301047
438 Ga0496121_0079669 3300048924 Bacteria 2599
439 Ga0496121_0114323 3300048924 Bacteria 2052
440 Ga0496122_0032256 3300048925 Bacteria 4336
441 Ga0496122_0036552 3300048925 Bacteria 3968
442 Ga0496122_0057424 3300048925 Bacteria 2890
443 Ga0496123_0028191 3300048926 Bacteria 4163
444 Ga0496123_0034600 3300048926 Bacteria 3615
445 Ga0496124_0140028 3300048927 Bacteria 1910
446 Ga0496124_0145645 3300048927 Bacteria 1864
447 Ga0496124_0239756 3300048927 Bacteria 1349
448 Ga0496124_0309645 3300048927 Bacteria 1136
449 Ga0496124_0565536 3300048927 Bacteria 747
450 Ga0496125_0040174 3300048928 Bacteria 4015
451 Ga0496125_0056065 3300048928 Bacteria 3203
452 Ga0496125_0135794 3300048928 Bacteria 1721
453 Ga0496125_0143533 3300048928 Bacteria 1655
454 Ga0496125_0216187 3300048928 Bacteria 1239
455 Ga0496126_0116721 3300048929 Bacteria 2319
456 Ga0495678_000006 3300049459 Bacteria 463690
457 Ga0495678_000769 3300049459 Bacteria 28986
458 Ga0495678_017365 3300049459 Bacteria 3263
459 Ga0495678_019925 3300049459 Bacteria 2980
460 Ga0495678_021048 3300049459 Bacteria 2877
461 Ga0495682_0010283 3300049460 Bacteria 3628
462 Ga0495682_0012989 3300049460 Bacteria 3178
463 Ga0501047_0208966 3300049581 Bacteria 1811
464 Ga0501221_028769 3300049704 Bacteria 1146
465 Ga0501234_041180 3300049707 Bacteria 757
466 Ga0501269_015776 3300049766 Bacteria 928
467 Ga0501279_024022 3300049775 Bacteria 880
468 Ga0501044_0333125 3300049823 Bacteria 1440
469 Ga0501044_0624804 3300049823 Bacteria 968
470 nmdc:mga03683_6153_c1 3300050489 Bacteria 4098
471 nmdc:mga03n38_79082_c1 3300050490 Bacteria 1541
472 nmdc:mga00v17_10738_c1 3300050491 Bacteria 5016
473 nmdc:mga0yw44_1007_c1 3300050492 Bacteria 10783
474 nmdc:mga0yw44_30617_c1 3300050492 Bacteria 3121
475 nmdc:mga0k408_185636_c1 3300050493 Bacteria 1240
476 nmdc:mga06z11_52010_c1 3300050494 Bacteria 2100
477 nmdc:mga07m45_196608_c1 3300050496 Bacteria 1173
478 nmdc:mga0sz30_55450_c1 3300050516 Bacteria 1687
479 nmdc:mga0sz30_8585_c1 3300050516 Bacteria 3860
480 Ga0500644_0080232 3300053088 Bacteria 1198
481 Ga0500646_0002464 3300053090 Bacteria 4806
482 Ga0500583_0080861 3300053092 Bacteria 1569
483 Ga0500650_0090921 3300053098 Bacteria 1428
484 Ga0500555_025257 3300053103 Bacteria 1701
485 Ga0500618_000274 3300053125 Bacteria 39526
486 Ga0500642_0079084 3300053130 Bacteria 1507
487 Ga0500655_002240 3300053133 Bacteria 3550
488 Ga0500604_0006324 3300053151 Bacteria 3131
489 Ga0500616_0109679 3300053153 Bacteria 1335
490 Ga0500637_0140920 3300053178 Bacteria 1396
491 Ga0500661_010938 3300055283 Bacteria 1647
492 2521557300 2521172590 Bacteria 5047645
493 2547373474 2547132103 Bacteria 5115736
494 2553005348 2551306416 Bacteria 6152985
495 2574430540 2574179768 Bacteria 4907129
496 2601669875 2600255292 Bacteria 6300551
497 2644027798 2643221603 Bacteria 6147767
498 2738828843 2738541297 Bacteria 6549566
499 2739152639 2738541357 Bacteria 6549408
500 2739194559 2738543003 Bacteria 6549560
501 2739321035 2738543026 Bacteria 6549408
502 2739339276 2738543029 Bacteria 6549249
503 2765568428 2765235838 Bacteria 5445269
504 2808981183 2808606386 Bacteria 4471946
505 2809131764 2808606415 Bacteria 4576710
506 2809151424 2808606419 Bacteria 4576925
507 2839095334 2839094727 Bacteria 5534556
508 2842714764 2842711865 Bacteria 7155354
509 2843694807 2843690924 Bacteria 5169057
510 2846033723 2846033681 Bacteria 4377894
511 2852620905 2852618963 Bacteria 4577824
512 2857551058 2857547612 Bacteria 6179999
513 2857558353 2857553236 Bacteria 6166726
514 2857563323 2857558681 Bacteria 6617694
515 2884814185 2884811622 Bacteria 5552861
516 2884840604 2884836552 Bacteria 5219991
517 2884855861 2884852848 Bacteria 5221161
518 2885085800 2885080285 Bacteria 6355622
519 2891634752 2891633521 Bacteria 4602265
520 2896157214 2896154374 Bacteria 5221518
521 2904427279 2904424332 Bacteria 7633521
522 2904439964 2904439833 Bacteria 5931679
523 2904531091 2904530477 Bacteria 5876334
524 2904587264 2904584206 Bacteria 6028872
525 2904592701 2904589729 Bacteria 6113573
526 2904604516 2904601388 Bacteria 5884906
527 2919050286 2919046199 Bacteria 5567169
528 2919082338 2919079590 Bacteria 5946433
529 2919479855 2919476304 Bacteria 5888696
530 2923515962 2923510766 Bacteria 5926163
531 2928133276 2928130867 Bacteria 5467269
532 2932413364 2932410948 Bacteria 6312192
533 2932417424 2932416698 Bacteria 6315112
534 2998345730 2998344455 Bacteria 4222996
535 639786526 639633007 Bacteria 4376040
536 Ga0075366_10002475
537 JGI25155J39150_1000275
538 JGI25156J39149_1002838
539 JGI25154J39366_1001607
540 rootH2_10024853
541 Ga0055525_1000047
542 Ga0055529_1000125
543 Ga0065165_1019953
544 Ga0065714_10083160
545 Ga0070658_10273733
546 Ga0070682_100438685
547 Ga0070660_100056401
548 Ga0070660_100161031
549 Ga0070660_100606578
550 Ga0070661_100235102
551 Ga0070661_100488205
552 Ga0070668_100278488
553 Ga0070659_100267538
554 Ga0070667_100347981
555 Ga0070714_100003989
556 Ga0070662_100296908
557 Ga0068855_100000037
558 Ga0070664_100594956
559 Ga0068857_100200958
560 Ga0068866_10089364
561 Ga0068858_100165715
562 Ga0081539_10003666
563 Ga0075365_10007553
564 Ga0075365_10041245
565 Ga0075368_10002260
566 Ga0075363_100003613
567 Ga0075364_10005797
568 Ga0070716_100072557
569 Ga0075362_10008887
570 Ga0075367_10002015
571 Ga0075369_10011342
572 Ga0075369_10026560
573 Ga0075366_10111227
574 Ga0075370_10033429
575 Ga0075370_10266106
576 Ga0079104_1003020
577 Ga0105244_10023223
578 Ga0105244_10083964
579 Ga0105240_10190525
580 Ga0105240_10227932
581 Ga0105243_10018177
582 Ga0105237_10122054
583 Ga0105237_11000262
584 Ga0105239_10492733
585 Ga0105246_10579956
586 Ga0157371_10000013
587 Ga0157371_10380919
588 Ga0157370_10001049
589 Ga0157370_10224539
590 Ga0157370_10620573
591 Ga0157374_10181849
592 Ga0157378_10050117
593 Ga0157372_10434256
594 Ga0157372_10491272
595 Ga0182008_10016736
596 Ga0182008_10400130
597 Ga0182006_1000035
598 Ga0182006_1000096
599 Ga0182006_1022210
600 Ga0182007_10000040
601 Ga0182005_1000013
602 Ga0182005_1000025
603 Ga0163161_10048114
604 Ga0163161_10211355
605 Ga0213872_10000020
606 Ga0213872_10019675
607 Ga0209437_108904
608 Ga0209455_1000044
609 Ga0207705_10078474
610 Ga0207657_10091544
611 Ga0207657_10453933
612 Ga0207657_10522609
613 Ga0207649_10100132
614 Ga0207690_10039891
615 Ga0207690_10210151
616 Ga0207706_10474013
617 Ga0207686_10187850
618 Ga0207709_10025077
619 Ga0207679_10040399
620 Ga0207667_10000053
621 Ga0207658_10087973
622 Ga0207703_10277411
623 Ga0207674_10106065
624 Ga0209281_1007059
625 Ga0307511_10001014
626 Ga0316181_1218544
627 Ga0316182_1199092
628 Ga0265328_10000005
629 Ga0265328_10001363
630 Ga0265328_10011926
631 Ga0265331_10000070
632 Ga0265331_10001058
633 Ga0265327_10000156
634 Ga0265327_10000472
635 Ga0265327_10018727
636 Ga0307408_100000294
637 Ga0307507_10059523
638 Ga0395899_0005514
639 Ga0395899_0208194
640 Ga0395899_0227147
641 Ga0395900_0000331
642 Ga0395900_0039845
643 Ga0395900_0116900
644 Ga0395900_0342376
645 Ga0395900_0376926
646 Ga0395900_0424199
647 Ga0395900_0703921
648 Ga0395898_0093570
649 Ga0395898_0339473
650 Ga0395905_0403751
651 Ga0395901_0000097
652 Ga0395901_0028671
653 Ga0395901_0706435
654 Ga0436361_0314818
655 Ga0436361_0498733
656 Ga0436361_0594223
657 Ga0436361_0922237
658 Ga0451804_0636132
659 Ga0439448_0020276
660 Ga0439448_0091997
661 Ga0439455_0111585
662 Ga0439458_0004250
663 Ga0451577_0045277
664 Ga0466969_0006928
665 Ga0466969_0045626
666 Ga0453683_0076793
667 Ga0466965_0067998
668 Ga0453684_0000005
669 Ga0453684_0000163
670 Ga0453684_0000386
671 Ga0466971_0082169
672 Ga0466968_0169739
673 Ga0466957_0317123
674 Ga0466960_0056664
675 Ga0451576_0001961
676 Ga0451576_0058004
677 Ga0451576_0103062
678 Ga0451576_0929813
679 Ga0466958_0348328
680 Ga0466958_0416343
681 Ga0466967_0307423
682 Ga0495617_000004
683 Ga0495617_000009
684 Ga0495617_018168
685 Ga0495617_031790
686 Ga0495627_000008
687 Ga0495627_006670
688 Ga0495627_023646
689 Ga0495603_0052996
690 Ga0495590_0013563
691 Ga0495629_0006506
692 Ga0495638_0137311
693 Ga0495650_0000011
694 Ga0495650_0000494
695 Ga0495650_0000593
696 Ga0495650_0028439
697 Ga0495582_0021333
698 Ga0495605_0000024
699 Ga0495605_0015140
700 Ga0495605_0047984
701 Ga0495605_0066053
702 Ga0495605_0077298
703 Ga0495584_0004700
704 Ga0495584_0018909
705 Ga0495584_0026934
706 Ga0495584_0057393
707 Ga0495584_0149034
708 Ga0495584_0176680
709 Ga0495584_0201995
710 Ga0495585_0017853
711 Ga0495585_0021109
712 Ga0495585_0029443
713 Ga0495585_0032805
714 Ga0495585_0055498
715 Ga0495585_0158847
716 Ga0495594_0011814
717 Ga0495596_0011263
718 Ga0495596_0011276
719 Ga0495596_0032096
720 Ga0495607_0006535
721 Ga0495607_0036400
722 Ga0495607_0038773
723 Ga0495607_0044902
724 Ga0495607_0079132
725 Ga0495607_0158591
726 Ga0495607_0183740
727 Ga0495583_0003595
728 Ga0495583_0014453
729 Ga0495583_0016161
730 Ga0495583_0017569
731 Ga0495583_0019334
732 Ga0495583_0024000
733 Ga0495583_0153247
734 Ga0495583_0158597
735 Ga0495583_0212173
736 Ga0495606_0000927
737 Ga0495606_0043133
738 Ga0495606_0068443
739 Ga0495606_0143644
740 Ga0495606_0215008
741 Ga0495610_0091031
742 Ga0495610_0168228
743 Ga0495610_0211781
744 Ga0495616_0000567
745 Ga0495616_0005459
746 Ga0495616_0016582
747 Ga0495616_0019296
748 Ga0495616_0021514
749 Ga0495616_0027344
750 Ga0495616_0044278
751 Ga0495616_0051240
752 Ga0495616_0063906
753 Ga0495616_0082985
754 Ga0495616_0171617
755 Ga0495616_0190919
756 Ga0495631_0014519
757 Ga0495631_0029309
758 Ga0495631_0050423
759 Ga0495631_0051377
760 Ga0495631_0062609
761 Ga0495631_0099370
762 Ga0495631_0218182
763 Ga0495632_0005838
764 Ga0495632_0022036
765 Ga0495632_0024467
766 Ga0495632_0026745
767 Ga0495632_0033167
768 Ga0495632_0180746
769 Ga0495637_0039723
770 Ga0495643_0000346
771 Ga0495643_0012630
772 Ga0495643_0030060
773 Ga0495643_0062471
774 Ga0495643_0087382
775 Ga0495643_0176092
776 Ga0495644_0005136
777 Ga0495644_0009052
778 Ga0495644_0009840
779 Ga0495644_0053003
780 Ga0495644_0086974
781 Ga0495644_0142217
782 Ga0495648_0000290
783 Ga0495648_0013732
784 Ga0495648_0022393
785 Ga0495648_0031398
786 Ga0495648_0043069
787 Ga0495648_0058665
788 Ga0495663_0048740
789 Ga0495666_0019043
790 Ga0495642_0003195
791 Ga0495642_0011766
792 Ga0495642_0012301
793 Ga0495642_0013208
794 Ga0495642_0104441
795 Ga0495642_0128939
796 Ga0495642_0174828
797 Ga0495654_0025293
798 Ga0495654_0090123
799 Ga0495654_0097401
800 Ga0495654_0099259
801 Ga0495654_0107132
802 Ga0495665_0245868
803 Ga0495665_0400864
804 Ga0495586_0043652
805 Ga0495609_0000030
806 Ga0495609_0010440
807 Ga0495609_0010610
808 Ga0495609_0037046
809 Ga0495609_0056762
810 Ga0495609_0128833
811 Ga0495609_0183994
812 Ga0495597_0014538
813 Ga0495597_0026824
814 Ga0495597_0040274
815 Ga0495597_0058467
816 Ga0495597_0073753
817 Ga0495597_0152101
818 Ga0495597_0153221
819 Ga0495622_0051793
820 Ga0495622_0108602
821 Ga0495633_0000271
822 Ga0495633_0012923
823 Ga0495633_0018039
824 Ga0495633_0019858
825 Ga0495633_0024173
826 Ga0495633_0094112
827 Ga0495633_0176617
828 Ga0495656_0049916
829 Ga0495656_0068480
830 Ga0495656_0199842
831 Ga0495668_0002794
832 Ga0495668_0020751
833 Ga0495668_0022209
834 Ga0495668_0026520
835 Ga0495668_0358502
836 Ga0495668_0466072
837 Ga0495611_0089313
838 Ga0495611_0168561
839 Ga0495625_0072104
840 Ga0495625_0159012
841 Ga0495625_0318682
842 Ga0495625_0335045
843 Ga0495625_0356308
844 Ga0495635_0001055
845 Ga0495661_0003016
846 Ga0495661_0023036
847 Ga0495661_0026310
848 Ga0495661_0053811
849 Ga0495661_0066768
850 Ga0495661_0069649
851 Ga0495661_0089806
852 Ga0495661_0128769
853 Ga0495661_0172670
854 Ga0495588_0000078
855 Ga0495588_0021100
856 Ga0495588_0032117
857 Ga0495588_0056553
858 Ga0495623_0078531
859 Ga0495669_0000057
860 Ga0495669_0000300
861 Ga0495669_0052105
862 Ga0495669_0272872
863 Ga0495613_0052335
864 Ga0495613_0265214
865 Ga0495670_0031651
866 Ga0495670_0037555
867 Ga0495670_0037740
868 Ga0495670_0038742
869 Ga0495670_0039377
870 Ga0495670_0070088
871 Ga0495670_0123074
872 Ga0495670_0344590
873 Ga0495670_0468333
874 Ga0495671_0014453
875 Ga0495671_0045634
876 Ga0495671_0106501
877 Ga0495671_0270608
878 Ga0495649_0016251
879 Ga0495649_0048714
880 Ga0495649_0054619
881 Ga0495589_0000021
882 Ga0495589_0015027
883 Ga0495589_0018583
884 Ga0495589_0026665
885 Ga0495589_0033697
886 Ga0495589_0136801
887 Ga0495660_0018126
888 Ga0495660_0043715
889 Ga0495660_0048746
890 Ga0495660_0052263
891 Ga0495660_0054214
892 Ga0495660_0090284
893 Ga0495660_0100935
894 Ga0495660_0191465
895 Ga0495660_0211579
896 Ga0495581_0024181
897 Ga0495604_0125913
898 Ga0495636_0027149
899 Ga0495636_0192061
900 Ga0495636_0302368
901 Ga0495672_0000031
902 Ga0495672_0019596
903 Ga0495672_0024609
904 Ga0495672_0114201
905 Ga0495676_0037581
906 Ga0495676_0290304
907 Ga0495680_0045790
908 Ga0495683_0012100
909 Ga0495683_0050854
910 Ga0495683_0075523
911 Ga0495687_000407
912 Ga0495687_010545
913 Ga0495687_017002
914 Ga0495687_025311
915 Ga0495675_0023477
916 Ga0495677_0000029
917 Ga0495677_0018533
918 Ga0495677_0025206
919 Ga0495677_0117602
920 Ga0495679_018541
921 Ga0495679_022130
922 Ga0495679_033506
923 Ga0495679_041958
924 Ga0495679_071968
925 Ga0495685_017538
926 Ga0495685_024221
927 Ga0495685_037146
928 Ga0495685_046579
929 Ga0495673_0000026
930 Ga0495673_0218919
931 Ga0495681_0016324
932 Ga0495681_0017670
933 Ga0495681_0020448
934 Ga0495681_0030366
935 Ga0495681_0068128
936 Ga0495681_0129842
937 Ga0495681_0142862
938 Ga0495686_0000738
939 Ga0495686_0125112
940 Ga0495593_0015115
941 Ga0495614_0003050
942 Ga0495615_0065675
943 Ga0495626_0009200
944 Ga0495626_0015845
945 Ga0495626_0016880
946 Ga0495626_0033977
947 Ga0495626_0184133
948 Ga0496100_0063388
949 Ga0496100_0367224
950 Ga0496101_0020529
951 Ga0496101_0071264
952 Ga0496102_0000198
953 Ga0496102_0099041
954 Ga0496102_0132452
955 Ga0496103_0028205
956 Ga0496104_0264325
957 Ga0496105_0107014
958 Ga0496107_0088394
959 Ga0496108_0263227
960 Ga0496108_0392629
961 Ga0496109_0069130
962 Ga0496109_0278255
963 Ga0496110_0017718
964 Ga0496110_0382513
965 Ga0496111_0027877
966 Ga0496111_0155586
967 Ga0496111_0618430
968 Ga0496113_0200467
969 Ga0496113_0211702
970 Ga0496116_0017608
971 Ga0496117_0000045
972 Ga0496118_0000041
973 Ga0496121_0079669
974 Ga0496121_0114323
975 Ga0496122_0032256
976 Ga0496122_0036552
977 Ga0496122_0057424
978 Ga0496123_0028191
979 Ga0496123_0034600
980 Ga0496124_0140028
981 Ga0496124_0145645
982 Ga0496124_0239756
983 Ga0496124_0309645
984 Ga0496124_0565536
985 Ga0496125_0040174
986 Ga0496125_0056065
987 Ga0496125_0135794
988 Ga0496125_0143533
989 Ga0496125_0216187
990 Ga0496126_0116721
991 Ga0495678_000006
992 Ga0495678_000769
993 Ga0495678_017365
994 Ga0495678_019925
995 Ga0495678_021048
996 Ga0495682_0010283
997 Ga0495682_0012989
998 Ga0501047_0208966
999 Ga0501221_028769
1000 Ga0501234_041180
1001 Ga0501269_015776
1002 Ga0501279_024022
1003 Ga0501044_0333125
1004 Ga0501044_0624804
1005 nmdc:mga03683_6153_c1
1006 nmdc:mga03n38_79082_c1
1007 nmdc:mga00v17_10738_c1
1008 nmdc:mga0yw44_1007_c1
1009 nmdc:mga0yw44_30617_c1
1010 nmdc:mga0k408_185636_c1
1011 nmdc:mga06z11_52010_c1
1012 nmdc:mga07m45_196608_c1
1013 nmdc:mga0sz30_55450_c1
1014 nmdc:mga0sz30_8585_c1
1015 Ga0500644_0080232
1016 Ga0500646_0002464
1017 Ga0500583_0080861
1018 Ga0500650_0090921
1019 Ga0500555_025257
1020 Ga0500618_000274
1021 Ga0500642_0079084
1022 Ga0500655_002240
1023 Ga0500604_0006324
1024 Ga0500616_0109679
1025 Ga0500637_0140920
1026 Ga0500661_010938
1027 2521557300
1028 2547373474
1029 2553005348
1030 2574430540
1031 2601669875
1032 2644027798
1033 2738828843
1034 2739152639
1035 2739194559
1036 2739321035
1037 2739339276
1038 2765568428
1039 2808981183
1040 2809131764
1041 2809151424
1042 2839095334
1043 2842714764
1044 2843694807
1045 2846033723
1046 2852620905
1047 2857551058
1048 2857558353
1049 2857563323
1050 2884814185
1051 2884840604
1052 2884855861
1053 2885085800
1054 2891634752
1055 2896157214
1056 2904427279
1057 2904439964
1058 2904531091
1059 2904587264
1060 2904592701
1061 2904604516
1062 2919050286
1063 2919082338
1064 2919479855
1065 2923515962
1066 2928133276
1067 2932413364
1068 2932417424
1069 2998345730
1070 639786526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

38

236

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8esq-assembly1.cif.gz_w ytm1 associated nascent 60s ribosome state 2 0.9295 17 214
6jpl-assembly2.cif.gz_D the x-ray structure of yeast trna methyltransferase trm7-trm734 in complex with s-adenosyl-l-methionine 0.9291 17 214
1ej0-assembly1.cif.gz_A ftsj rna methyltransferase complexed with s-adenosylmethionine, mercury derivative 0.9213 29 211
8etc-assembly1.cif.gz_w fkbp39 associated nascent 60s ribosome state 4 0.9176 17 214
7o9m-assembly1.cif.gz_n human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1 and the malsu module 0.9119 1 210
ID Description Score Start End Superfamily
af_Q5RJT2_23_207_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9389 28 210 3.40.50.150
1ej0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9213 29 211 3.40.50.150
af_O62251_31_214_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9098 28 212 3.40.50.150
af_Q9VDT6_58_249_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9083 28 214 3.40.50.150
af_Q9VEP1_20_211_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9066 28 214 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6A5KUH4-F1-model_v4 deleted 0.9961 26 214
AF-A0A7W5B888-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9931 12 213 GO:0005737
GO:0008650
AF-A0A519PCG8-F1-model_v4 deleted 0.9902 77 214
AF-A0A840L5Y9-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9797 12 214 GO:0005737
GO:0008650
AF-A0A519PCG8-F1-model_v4 deleted 0.9761 77 214

Map