F460646
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 535 | 259 | 1070 | 455 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10033803|Ga0105240_100338036 |
| Length | 491 |
| Sequence | VESETCISPALLLAALVITLLSRKEGFVLIEGIRSGKIAAVLISLILCWPFAQAQNFNDIKPSPQQVEWQDLEFGVLIHFGTNTYLDREWGDGTASPQVFNPTQLDPEQWLRAAKAAGAKYVVLVAKHHDGFCLWPTKQTDYSVKSRPWENGKGDVVKRVSDAAHKLGIKFGIYLSPWDRHEPRYKNSADYDDYYAAELDELTSNYGDLVEFWLDGAGSEGHVYNFPRIIETLRKAQPNTLVFADAALFEYGDIRWAGNEDGKIPYENWNVLDRHGYLRWRPVEADTPLHKEHWFWHPNDEDTLKSVEDLLSTYEQTIGRGGQLMLGLAPDKRGLLPEADVRRLEEFGEAIRQRYSGNLITKEHIANSATDAAFDGDPDTFWSAPAGSHHAILEADFRQPVKIDRTLVMEWLNDGQRVEQFRIEVWDGGRWKSVVAGHAIGHKRIDIFPPVSTSRIRLNILSSSAEAHVREFQVFDASGARITRTVSGQNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 73 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 88 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 97 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 146 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 147 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 150 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 151 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 152 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 153 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 155 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 156 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 157 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 158 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 159 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 160 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 161 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 162 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 163 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 164 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 165 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 166 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 167 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 168 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 169 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 170 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 171 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 172 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 173 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 174 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 175 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 219 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 220 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 221 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 222 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 223 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 224 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 225 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 226 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 227 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 228 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 229 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 230 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 231 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 248 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 249 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 250 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 251 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 252 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 253 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 254 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 255 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 256 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 257 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 258 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 259 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.94 |
| Metatranscriptomes | 0.56 |
| Isolates | 1.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.15 |
| Nodule | 0 |
| Rhizoplane | 2.99 |
| Rhizosphere | 74.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_10033803 | 3300009093 | Bacteria | 6603 |
| 2 | LJNas_1000307 | 3300000546 | Bacteria | 8561 |
| 3 | JGI24739J22299_10001182 | 3300001989 | Bacteria | 9766 |
| 4 | JGI24737J22298_10035923 | 3300001990 | Bacteria | 1532 |
| 5 | JGI24735J21928_10017091 | 3300002067 | Unclassified | 2244 |
| 6 | JGI24735J21928_10020875 | 3300002067 | Bacteria | 2004 |
| 7 | JGI24738J21930_10004670 | 3300002075 | Bacteria | 3335 |
| 8 | JGI25162J39368_1000066 | 3300002737 | Bacteria | 130612 |
| 9 | JGI25162J39368_1000623 | 3300002737 | Bacteria | 25375 |
| 10 | JGI25162J39368_1000876 | 3300002737 | Bacteria | 19713 |
| 11 | JGI25157J39369_1000050 | 3300002741 | Bacteria | 114470 |
| 12 | JGI25157J39369_1000957 | 3300002741 | Bacteria | 13522 |
| 13 | JGI25157J39369_1001576 | 3300002741 | Bacteria | 8062 |
| 14 | JGI25163J39215_1002659 | 3300002771 | Bacteria | 1723 |
| 15 | JGI25164J39214_1000056 | 3300002772 | Bacteria | 114468 |
| 16 | JGI25164J39214_1000061 | 3300002772 | Bacteria | 110617 |
| 17 | JGI25165J46597_1000009 | 3300003214 | Bacteria | 467965 |
| 18 | JGI25165J46597_1000151 | 3300003214 | Bacteria | 114835 |
| 19 | rootH2_10050965 | 3300003320 | Bacteria | 5732 |
| 20 | rootH2_10078932 | 3300003320 | Bacteria | 8417 |
| 21 | Ga0055538_1002563 | 3300003751 | Bacteria | 2607 |
| 22 | Ga0055539_1000614 | 3300003752 | Bacteria | 9678 |
| 23 | Ga0055533_1000913 | 3300003756 | Bacteria | 8841 |
| 24 | Ga0055525_1000856 | 3300003759 | Bacteria | 8910 |
| 25 | Ga0055527_1000271 | 3300003760 | Bacteria | 31313 |
| 26 | Ga0055527_1000273 | 3300003760 | Bacteria | 30913 |
| 27 | Ga0055535_1000045 | 3300003761 | Bacteria | 140688 |
| 28 | Ga0055535_1000466 | 3300003761 | Bacteria | 37034 |
| 29 | Ga0055535_1000567 | 3300003761 | Bacteria | 31313 |
| 30 | Ga0055535_1000574 | 3300003761 | Bacteria | 30913 |
| 31 | Ga0055542_1000010 | 3300003762 | Bacteria | 414813 |
| 32 | Ga0055542_1000079 | 3300003762 | Bacteria | 130623 |
| 33 | Ga0055542_1000591 | 3300003762 | Bacteria | 31313 |
| 34 | Ga0055542_1000597 | 3300003762 | Bacteria | 30913 |
| 35 | Ga0055542_1001011 | 3300003762 | Bacteria | 17923 |
| 36 | Ga0055529_1000122 | 3300003763 | Bacteria | 114462 |
| 37 | Ga0055529_1000140 | 3300003763 | Bacteria | 102393 |
| 38 | Ga0055529_1000556 | 3300003763 | Bacteria | 31313 |
| 39 | Ga0055529_1000815 | 3300003763 | Bacteria | 18794 |
| 40 | Ga0065165_1000186 | 3300005262 | Bacteria | 108712 |
| 41 | Ga0070658_10000007 | 3300005327 | Bacteria | 349444 |
| 42 | Ga0070658_10016591 | 3300005327 | Bacteria | 5894 |
| 43 | Ga0070658_10021565 | 3300005327 | Bacteria | 5162 |
| 44 | Ga0070658_10027051 | 3300005327 | Bacteria | 4605 |
| 45 | Ga0070658_10184919 | 3300005327 | Bacteria | 1754 |
| 46 | Ga0070683_100037549 | 3300005329 | Bacteria | 4434 |
| 47 | Ga0070683_100113830 | 3300005329 | Bacteria | 2553 |
| 48 | Ga0070670_100063050 | 3300005331 | Bacteria | 3181 |
| 49 | Ga0068869_100003330 | 3300005334 | Bacteria | 9817 |
| 50 | Ga0070666_10000008 | 3300005335 | Bacteria | 293415 |
| 51 | Ga0068868_100000995 | 3300005338 | Bacteria | 19323 |
| 52 | Ga0070689_100017194 | 3300005340 | Bacteria | 5307 |
| 53 | Ga0070661_100007534 | 3300005344 | Bacteria | 7509 |
| 54 | Ga0070661_100021595 | 3300005344 | Bacteria | 4599 |
| 55 | Ga0070668_100100073 | 3300005347 | Unclassified | 2296 |
| 56 | Ga0070671_100010112 | 3300005355 | Bacteria | 7578 |
| 57 | Ga0070688_100054144 | 3300005365 | Bacteria | 2512 |
| 58 | Ga0070659_100046459 | 3300005366 | Unclassified | 3403 |
| 59 | Ga0070667_100107765 | 3300005367 | Unclassified | 2413 |
| 60 | Ga0070709_10000389 | 3300005434 | Bacteria | 27031 |
| 61 | Ga0070709_10024544 | 3300005434 | Bacteria | 3550 |
| 62 | Ga0070714_100018479 | 3300005435 | Bacteria | 5663 |
| 63 | Ga0070714_100019180 | 3300005435 | Bacteria | 5567 |
| 64 | Ga0070714_100145569 | 3300005435 | Bacteria | 2131 |
| 65 | Ga0070713_100000240 | 3300005436 | Bacteria | 35997 |
| 66 | Ga0070713_100000860 | 3300005436 | Bacteria | 19441 |
| 67 | Ga0070713_100001393 | 3300005436 | Bacteria | 15490 |
| 68 | Ga0070713_100005337 | 3300005436 | Bacteria | 8772 |
| 69 | Ga0070713_100007637 | 3300005436 | Bacteria | 7611 |
| 70 | Ga0070711_100008179 | 3300005439 | Bacteria | 6396 |
| 71 | Ga0070711_100045408 | 3300005439 | Bacteria | 2988 |
| 72 | Ga0070711_100050361 | 3300005439 | Bacteria | 2856 |
| 73 | Ga0070663_100015653 | 3300005455 | Bacteria | 4904 |
| 74 | Ga0070663_100062808 | 3300005455 | Bacteria | 2679 |
| 75 | Ga0070663_100134224 | 3300005455 | Bacteria | 1883 |
| 76 | Ga0070662_100025419 | 3300005457 | Bacteria | 4089 |
| 77 | Ga0070681_10007232 | 3300005458 | Bacteria | 10832 |
| 78 | Ga0070681_10009811 | 3300005458 | Bacteria | 9429 |
| 79 | Ga0068867_100083052 | 3300005459 | Bacteria | 2418 |
| 80 | Ga0070707_100043551 | 3300005468 | Bacteria | 4295 |
| 81 | Ga0070679_100004474 | 3300005530 | Bacteria | 12906 |
| 82 | Ga0070679_100097174 | 3300005530 | Bacteria | 2933 |
| 83 | Ga0070684_100022318 | 3300005535 | Bacteria | 5277 |
| 84 | Ga0070684_100025054 | 3300005535 | Bacteria | 5010 |
| 85 | Ga0070684_100026400 | 3300005535 | Bacteria | 4892 |
| 86 | Ga0068853_100000020 | 3300005539 | Bacteria | 157450 |
| 87 | Ga0068853_100017887 | 3300005539 | Bacteria | 5856 |
| 88 | Ga0068853_100030721 | 3300005539 | Bacteria | 4539 |
| 89 | Ga0068853_100037155 | 3300005539 | Bacteria | 4143 |
| 90 | Ga0070665_100033023 | 3300005548 | Bacteria | 5207 |
| 91 | Ga0070665_100063345 | 3300005548 | Bacteria | 3707 |
| 92 | Ga0070665_100077635 | 3300005548 | Bacteria | 3327 |
| 93 | Ga0068855_100002105 | 3300005563 | Bacteria | 24635 |
| 94 | Ga0068855_100005395 | 3300005563 | Bacteria | 15596 |
| 95 | Ga0068855_100005499 | 3300005563 | Bacteria | 15460 |
| 96 | Ga0068855_100016759 | 3300005563 | Bacteria | 8812 |
| 97 | Ga0068855_100022030 | 3300005563 | Bacteria | 7639 |
| 98 | Ga0068855_100027044 | 3300005563 | Bacteria | 6863 |
| 99 | Ga0068855_100032809 | 3300005563 | Bacteria | 6199 |
| 100 | Ga0068855_100047771 | 3300005563 | Bacteria | 5055 |
| 101 | Ga0070664_100101771 | 3300005564 | Bacteria | 2499 |
| 102 | Ga0070664_100146668 | 3300005564 | Bacteria | 2081 |
| 103 | Ga0068857_100000189 | 3300005577 | Bacteria | 39655 |
| 104 | Ga0068857_100001376 | 3300005577 | Bacteria | 19181 |
| 105 | Ga0068857_100006723 | 3300005577 | Bacteria | 9886 |
| 106 | Ga0068857_100186220 | 3300005577 | Bacteria | 1890 |
| 107 | Ga0068854_100000112 | 3300005578 | Bacteria | 55846 |
| 108 | Ga0068854_100004478 | 3300005578 | Bacteria | 8812 |
| 109 | Ga0068854_100008457 | 3300005578 | Bacteria | 6618 |
| 110 | Ga0068854_100009911 | 3300005578 | Bacteria | 6164 |
| 111 | Ga0068854_100049730 | 3300005578 | Bacteria | 2996 |
| 112 | Ga0068854_100050015 | 3300005578 | Unclassified | 2989 |
| 113 | Ga0068856_100000179 | 3300005614 | Bacteria | 66149 |
| 114 | Ga0068856_100000323 | 3300005614 | Bacteria | 52568 |
| 115 | Ga0068856_100010763 | 3300005614 | Bacteria | 8883 |
| 116 | Ga0068856_100014695 | 3300005614 | Bacteria | 7556 |
| 117 | Ga0068856_100244498 | 3300005614 | Bacteria | 1809 |
| 118 | Ga0068859_100001235 | 3300005617 | Bacteria | 26117 |
| 119 | Ga0068864_100000129 | 3300005618 | Bacteria | 73206 |
| 120 | Ga0068864_100112909 | 3300005618 | Bacteria | 2422 |
| 121 | Ga0068863_100004744 | 3300005841 | Bacteria | 13400 |
| 122 | Ga0068858_100000272 | 3300005842 | Bacteria | 55575 |
| 123 | Ga0068858_100002550 | 3300005842 | Bacteria | 18376 |
| 124 | Ga0068858_100010102 | 3300005842 | Bacteria | 8961 |
| 125 | Ga0068858_100104791 | 3300005842 | Bacteria | 2639 |
| 126 | Ga0068860_100098222 | 3300005843 | Bacteria | 2793 |
| 127 | Ga0068860_100143097 | 3300005843 | Bacteria | 2299 |
| 128 | Ga0081455_10176541 | 3300005937 | Bacteria | 1621 |
| 129 | Ga0081540_1004420 | 3300005983 | Bacteria | 10725 |
| 130 | Ga0070717_10001325 | 3300006028 | Bacteria | 16967 |
| 131 | Ga0070717_10003643 | 3300006028 | Bacteria | 11048 |
| 132 | Ga0070717_10082016 | 3300006028 | Unclassified | 2709 |
| 133 | Ga0070716_100002097 | 3300006173 | Bacteria | 9150 |
| 134 | Ga0070716_100165402 | 3300006173 | Bacteria | 1438 |
| 135 | Ga0070712_100021376 | 3300006175 | Bacteria | 4250 |
| 136 | Ga0070712_100031295 | 3300006175 | Bacteria | 3583 |
| 137 | Ga0070712_100087564 | 3300006175 | Bacteria | 2272 |
| 138 | Ga0070712_100105388 | 3300006175 | Bacteria | 2094 |
| 139 | Ga0097621_100002345 | 3300006237 | Bacteria | 12976 |
| 140 | Ga0097621_100146124 | 3300006237 | Bacteria | 2024 |
| 141 | Ga0068871_100000476 | 3300006358 | Bacteria | 27506 |
| 142 | Ga0097620_100001235 | 3300006931 | Bacteria | 26117 |
| 143 | Ga0105240_10000884 | 3300009093 | Bacteria | 53814 |
| 144 | Ga0105240_10001842 | 3300009093 | Bacteria | 35528 |
| 145 | Ga0105240_10008820 | 3300009093 | Bacteria | 14362 |
| 146 | Ga0105240_10034423 | 3300009093 | Bacteria | 6533 |
| 147 | Ga0105240_10040519 | 3300009093 | Bacteria | 5956 |
| 148 | Ga0105240_10086873 | 3300009093 | Unclassified | 3830 |
| 149 | Ga0105240_10262823 | 3300009093 | Bacteria | 1990 |
| 150 | Ga0105247_10012902 | 3300009101 | Bacteria | 5012 |
| 151 | Ga0105243_10161142 | 3300009148 | Unclassified | 1934 |
| 152 | Ga0105248_10000003 | 3300009177 | Bacteria | 1019601 |
| 153 | Ga0105248_10001430 | 3300009177 | Bacteria | 26616 |
| 154 | Ga0105248_10036718 | 3300009177 | Bacteria | 5480 |
| 155 | Ga0105248_10187683 | 3300009177 | Bacteria | 2329 |
| 156 | Ga0105237_10000136 | 3300009545 | Bacteria | 103269 |
| 157 | Ga0105237_10037387 | 3300009545 | Bacteria | 4907 |
| 158 | Ga0105237_10044490 | 3300009545 | Bacteria | 4470 |
| 159 | Ga0105237_10209575 | 3300009545 | Bacteria | 1949 |
| 160 | Ga0105238_10003140 | 3300009551 | Bacteria | 16486 |
| 161 | Ga0105238_10032910 | 3300009551 | Bacteria | 5277 |
| 162 | Ga0105238_10039610 | 3300009551 | Bacteria | 4778 |
| 163 | Ga0105238_10058975 | 3300009551 | Bacteria | 3846 |
| 164 | Ga0105238_10210933 | 3300009551 | Unclassified | 1918 |
| 165 | Ga0105239_10000050 | 3300010375 | Bacteria | 173908 |
| 166 | Ga0105239_10003222 | 3300010375 | Bacteria | 20174 |
| 167 | Ga0105239_10011958 | 3300010375 | Bacteria | 9679 |
| 168 | Ga0105239_10182592 | 3300010375 | Bacteria | 2347 |
| 169 | Ga0157319_1000005 | 3300012497 | Bacteria | 372810 |
| 170 | Ga0157314_1000157 | 3300012500 | Bacteria | 7422 |
| 171 | Ga0157373_10056710 | 3300013100 | Bacteria | 2781 |
| 172 | Ga0157370_10007106 | 3300013104 | Bacteria | 12221 |
| 173 | Ga0157370_10024061 | 3300013104 | Bacteria | 6038 |
| 174 | Ga0157370_10099724 | 3300013104 | Bacteria | 2722 |
| 175 | Ga0157369_10008365 | 3300013105 | Bacteria | 11866 |
| 176 | Ga0157369_10009439 | 3300013105 | Bacteria | 11153 |
| 177 | Ga0157369_10046144 | 3300013105 | Bacteria | 4736 |
| 178 | Ga0157369_10068901 | 3300013105 | Bacteria | 3801 |
| 179 | Ga0157369_10084831 | 3300013105 | Bacteria | 3385 |
| 180 | Ga0157369_10106526 | 3300013105 | Bacteria | 2983 |
| 181 | Ga0157369_10108577 | 3300013105 | Bacteria | 2951 |
| 182 | Ga0157369_10177274 | 3300013105 | Unclassified | 2243 |
| 183 | Ga0157369_10367965 | 3300013105 | Bacteria | 1492 |
| 184 | Ga0157374_10000766 | 3300013296 | Bacteria | 28060 |
| 185 | Ga0157374_10004453 | 3300013296 | Bacteria | 11766 |
| 186 | Ga0157378_10000009 | 3300013297 | Bacteria | 161557 |
| 187 | Ga0163162_10000851 | 3300013306 | Bacteria | 28389 |
| 188 | Ga0157372_10000140 | 3300013307 | Bacteria | 79310 |
| 189 | Ga0157372_10001616 | 3300013307 | Bacteria | 24485 |
| 190 | Ga0157372_10001867 | 3300013307 | Bacteria | 22864 |
| 191 | Ga0157372_10002812 | 3300013307 | Bacteria | 18801 |
| 192 | Ga0157372_10005638 | 3300013307 | Bacteria | 13307 |
| 193 | Ga0157372_10082234 | 3300013307 | Bacteria | 3645 |
| 194 | Ga0157372_10131281 | 3300013307 | Bacteria | 2882 |
| 195 | Ga0157372_10182515 | 3300013307 | Unclassified | 2429 |
| 196 | Ga0163163_10002757 | 3300014325 | Bacteria | 14828 |
| 197 | Ga0163163_10291773 | 3300014325 | Bacteria | 1683 |
| 198 | Ga0182008_10002794 | 3300014497 | Bacteria | 10806 |
| 199 | Ga0157376_10003224 | 3300014969 | Bacteria | 11219 |
| 200 | Ga0157376_10068349 | 3300014969 | Bacteria | 3009 |
| 201 | Ga0157376_10153187 | 3300014969 | Bacteria | 2081 |
| 202 | Ga0182006_1001703 | 3300015261 | Bacteria | 12839 |
| 203 | Ga0182007_10012089 | 3300015262 | Bacteria | 3333 |
| 204 | Ga0182005_1003469 | 3300015265 | Bacteria | 5333 |
| 205 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 206 | Ga0209435_102268 | 3300025206 | Bacteria | 2273 |
| 207 | Ga0209784_100013 | 3300025224 | Bacteria | 518664 |
| 208 | Ga0209674_100053 | 3300025226 | Bacteria | 323159 |
| 209 | Ga0209674_100063 | 3300025226 | Bacteria | 275507 |
| 210 | Ga0209674_102281 | 3300025226 | Bacteria | 4217 |
| 211 | Ga0209672_100009 | 3300025228 | Bacteria | 883623 |
| 212 | Ga0209672_100024 | 3300025228 | Bacteria | 367869 |
| 213 | Ga0209672_100107 | 3300025228 | Bacteria | 99267 |
| 214 | Ga0209563_100127 | 3300025230 | Bacteria | 109913 |
| 215 | Ga0207427_100021 | 3300025231 | Bacteria | 494115 |
| 216 | Ga0207427_100030 | 3300025231 | Bacteria | 358045 |
| 217 | Ga0209437_100012 | 3300025233 | Bacteria | 792625 |
| 218 | Ga0209437_100150 | 3300025233 | Bacteria | 157430 |
| 219 | Ga0209437_100416 | 3300025233 | Bacteria | 38751 |
| 220 | Ga0209258_100011 | 3300025242 | Bacteria | 867542 |
| 221 | Ga0209258_100019 | 3300025242 | Bacteria | 566728 |
| 222 | Ga0209258_100047 | 3300025242 | Bacteria | 367869 |
| 223 | Ga0209258_100299 | 3300025242 | Bacteria | 80970 |
| 224 | Ga0209258_101028 | 3300025242 | Bacteria | 12566 |
| 225 | Ga0209646_1000458 | 3300025246 | Bacteria | 21135 |
| 226 | Ga0209646_1000553 | 3300025246 | Bacteria | 15780 |
| 227 | Ga0209026_1000010 | 3300025250 | Bacteria | 511986 |
| 228 | Ga0209026_1000015 | 3300025250 | Bacteria | 395555 |
| 229 | Ga0209026_1000163 | 3300025250 | Bacteria | 102814 |
| 230 | Ga0209026_1005397 | 3300025250 | Bacteria | 3453 |
| 231 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 232 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 233 | Ga0209148_1000013 | 3300025254 | Bacteria | 956684 |
| 234 | Ga0209148_1000054 | 3300025254 | Bacteria | 367869 |
| 235 | Ga0209148_1000205 | 3300025254 | Bacteria | 104659 |
| 236 | Ga0209759_1000023 | 3300025256 | Bacteria | 321695 |
| 237 | Ga0209759_1000622 | 3300025256 | Bacteria | 33847 |
| 238 | Ga0209759_1004122 | 3300025256 | Bacteria | 5547 |
| 239 | Ga0209129_1002144 | 3300025258 | Bacteria | 10012 |
| 240 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 241 | Ga0209233_1000023 | 3300025261 | Bacteria | 738870 |
| 242 | Ga0209455_1000012 | 3300025272 | Bacteria | 867234 |
| 243 | Ga0209455_1000027 | 3300025272 | Bacteria | 566710 |
| 244 | Ga0209455_1000052 | 3300025272 | Bacteria | 367804 |
| 245 | Ga0209455_1000081 | 3300025272 | Bacteria | 263674 |
| 246 | Ga0209257_1014211 | 3300025304 | Bacteria | 3443 |
| 247 | Ga0209257_1015973 | 3300025304 | Bacteria | 3072 |
| 248 | Ga0207697_10072531 | 3300025315 | Bacteria | 1444 |
| 249 | Ga0207692_10111578 | 3300025898 | Unclassified | 1517 |
| 250 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 251 | Ga0207647_10001010 | 3300025904 | Bacteria | 21869 |
| 252 | Ga0207647_10004877 | 3300025904 | Bacteria | 9910 |
| 253 | Ga0207647_10111319 | 3300025904 | Bacteria | 1619 |
| 254 | Ga0207699_10008055 | 3300025906 | Bacteria | 5179 |
| 255 | Ga0207699_10013471 | 3300025906 | Bacteria | 4188 |
| 256 | Ga0207699_10024760 | 3300025906 | Bacteria | 3286 |
| 257 | Ga0207705_10000013 | 3300025909 | Bacteria | 451680 |
| 258 | Ga0207705_10001463 | 3300025909 | Bacteria | 18825 |
| 259 | Ga0207705_10003955 | 3300025909 | Bacteria | 11268 |
| 260 | Ga0207705_10017963 | 3300025909 | Bacteria | 5058 |
| 261 | Ga0207705_10058789 | 3300025909 | Bacteria | 2773 |
| 262 | Ga0207707_10023053 | 3300025912 | Bacteria | 5446 |
| 263 | Ga0207695_10000198 | 3300025913 | Bacteria | 167880 |
| 264 | Ga0207695_10000694 | 3300025913 | Bacteria | 65968 |
| 265 | Ga0207695_10002325 | 3300025913 | Bacteria | 28342 |
| 266 | Ga0207695_10007696 | 3300025913 | Bacteria | 13642 |
| 267 | Ga0207695_10015849 | 3300025913 | Bacteria | 8853 |
| 268 | Ga0207695_10026127 | 3300025913 | Bacteria | 6521 |
| 269 | Ga0207695_10046395 | 3300025913 | Bacteria | 4606 |
| 270 | Ga0207695_10051777 | 3300025913 | Bacteria | 4308 |
| 271 | Ga0207695_10139220 | 3300025913 | Bacteria | 2377 |
| 272 | Ga0207671_10000059 | 3300025914 | Bacteria | 179761 |
| 273 | Ga0207671_10031622 | 3300025914 | Bacteria | 3943 |
| 274 | Ga0207671_10067946 | 3300025914 | Bacteria | 2655 |
| 275 | Ga0207671_10075754 | 3300025914 | Bacteria | 2517 |
| 276 | Ga0207693_10000084 | 3300025915 | Bacteria | 84105 |
| 277 | Ga0207693_10000160 | 3300025915 | Bacteria | 62687 |
| 278 | Ga0207693_10031338 | 3300025915 | Bacteria | 4201 |
| 279 | Ga0207693_10031475 | 3300025915 | Bacteria | 4192 |
| 280 | Ga0207693_10061240 | 3300025915 | Bacteria | 2948 |
| 281 | Ga0207663_10009342 | 3300025916 | Bacteria | 5176 |
| 282 | Ga0207663_10026305 | 3300025916 | Bacteria | 3375 |
| 283 | Ga0207657_10005725 | 3300025919 | Bacteria | 12962 |
| 284 | Ga0207657_10046151 | 3300025919 | Bacteria | 3817 |
| 285 | Ga0207652_10028631 | 3300025921 | Bacteria | 4651 |
| 286 | Ga0207646_10078840 | 3300025922 | Bacteria | 2944 |
| 287 | Ga0207694_10000241 | 3300025924 | Bacteria | 52660 |
| 288 | Ga0207694_10027366 | 3300025924 | Bacteria | 4342 |
| 289 | Ga0207700_10001174 | 3300025928 | Bacteria | 15056 |
| 290 | Ga0207700_10001774 | 3300025928 | Bacteria | 12236 |
| 291 | Ga0207700_10021384 | 3300025928 | Bacteria | 4416 |
| 292 | Ga0207700_10074273 | 3300025928 | Bacteria | 2630 |
| 293 | Ga0207700_10095633 | 3300025928 | Bacteria | 2356 |
| 294 | Ga0207700_10096828 | 3300025928 | Bacteria | 2344 |
| 295 | Ga0207664_10137933 | 3300025929 | Bacteria | 2060 |
| 296 | Ga0207690_10011373 | 3300025932 | Bacteria | 5322 |
| 297 | Ga0207690_10075751 | 3300025932 | Bacteria | 2334 |
| 298 | Ga0207706_10039908 | 3300025933 | Bacteria | 4161 |
| 299 | Ga0207670_10006704 | 3300025936 | Bacteria | 6407 |
| 300 | Ga0207665_10006958 | 3300025939 | Bacteria | 7488 |
| 301 | Ga0207665_10010350 | 3300025939 | Bacteria | 6126 |
| 302 | Ga0207665_10053230 | 3300025939 | Bacteria | 2728 |
| 303 | Ga0207711_10000012 | 3300025941 | Bacteria | 515147 |
| 304 | Ga0207711_10149384 | 3300025941 | Bacteria | 2107 |
| 305 | Ga0207689_10020634 | 3300025942 | Bacteria | 5541 |
| 306 | Ga0207679_10024016 | 3300025945 | Bacteria | 4176 |
| 307 | Ga0207667_10000031 | 3300025949 | Bacteria | 323587 |
| 308 | Ga0207667_10000292 | 3300025949 | Bacteria | 69279 |
| 309 | Ga0207667_10003408 | 3300025949 | Bacteria | 19625 |
| 310 | Ga0207667_10008428 | 3300025949 | Bacteria | 12247 |
| 311 | Ga0207667_10019177 | 3300025949 | Bacteria | 7650 |
| 312 | Ga0207667_10035946 | 3300025949 | Bacteria | 5312 |
| 313 | Ga0207667_10079052 | 3300025949 | Bacteria | 3408 |
| 314 | Ga0207640_10000001 | 3300025981 | Bacteria | 628778 |
| 315 | Ga0207640_10000061 | 3300025981 | Bacteria | 89141 |
| 316 | Ga0207640_10000995 | 3300025981 | Bacteria | 15688 |
| 317 | Ga0207640_10023791 | 3300025981 | Bacteria | 3687 |
| 318 | Ga0207640_10038520 | 3300025981 | Unclassified | 3018 |
| 319 | Ga0207640_10103020 | 3300025981 | Bacteria | 2006 |
| 320 | Ga0207677_10023622 | 3300026023 | Bacteria | 3802 |
| 321 | Ga0207703_10000365 | 3300026035 | Bacteria | 48400 |
| 322 | Ga0207703_10006688 | 3300026035 | Bacteria | 9197 |
| 323 | Ga0207703_10008600 | 3300026035 | Bacteria | 8057 |
| 324 | Ga0207703_10091740 | 3300026035 | Bacteria | 2555 |
| 325 | Ga0207639_10000023 | 3300026041 | Bacteria | 215340 |
| 326 | Ga0207639_10096811 | 3300026041 | Bacteria | 2375 |
| 327 | Ga0207678_10005660 | 3300026067 | Bacteria | 11169 |
| 328 | Ga0207678_10022118 | 3300026067 | Bacteria | 5572 |
| 329 | Ga0207678_10202380 | 3300026067 | Bacteria | 1698 |
| 330 | Ga0207702_10006103 | 3300026078 | Bacteria | 10441 |
| 331 | Ga0207702_10013707 | 3300026078 | Bacteria | 6734 |
| 332 | Ga0207702_10014687 | 3300026078 | Bacteria | 6498 |
| 333 | Ga0207702_10035149 | 3300026078 | Bacteria | 4190 |
| 334 | Ga0207641_10005114 | 3300026088 | Bacteria | 11234 |
| 335 | Ga0207648_10073278 | 3300026089 | Bacteria | 2985 |
| 336 | Ga0207676_10003562 | 3300026095 | Bacteria | 11001 |
| 337 | Ga0207674_10000298 | 3300026116 | Bacteria | 62902 |
| 338 | Ga0207674_10000763 | 3300026116 | Bacteria | 42020 |
| 339 | Ga0207674_10005708 | 3300026116 | Bacteria | 14752 |
| 340 | Ga0207674_10207554 | 3300026116 | Bacteria | 1908 |
| 341 | Ga0207698_10164529 | 3300026142 | Bacteria | 1945 |
| 342 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 343 | Ga0268266_10001623 | 3300028379 | Bacteria | 26151 |
| 344 | Ga0268266_10002599 | 3300028379 | Bacteria | 19128 |
| 345 | Ga0268266_10055850 | 3300028379 | Bacteria | 3395 |
| 346 | Ga0268264_10058948 | 3300028381 | Bacteria | 3216 |
| 347 | Ga0268264_10149612 | 3300028381 | Bacteria | 2092 |
| 348 | Ga0265338_10002332 | 3300028800 | Bacteria | 28677 |
| 349 | Ga0265762_1000396 | 3300030760 | Bacteria | 7484 |
| 350 | Ga0265760_10013641 | 3300031090 | Unclassified | 2327 |
| 351 | Ga0265760_10025781 | 3300031090 | Bacteria | 1718 |
| 352 | Ga0265325_10016019 | 3300031241 | Bacteria | 4196 |
| 353 | Ga0265325_10042880 | 3300031241 | Bacteria | 2363 |
| 354 | Ga0265331_10027239 | 3300031250 | Bacteria | 2867 |
| 355 | Ga0265316_10004157 | 3300031344 | Bacteria | 14464 |
| 356 | Ga0265316_10015042 | 3300031344 | Bacteria | 6782 |
| 357 | Ga0265314_10001468 | 3300031711 | Bacteria | 26265 |
| 358 | Ga0265314_10056419 | 3300031711 | Bacteria | 2704 |
| 359 | Ga0307405_10155385 | 3300031731 | Bacteria | 1614 |
| 360 | Ga0307510_10003576 | 3300033180 | Bacteria | 18154 |
| 361 | Ga0307510_10016607 | 3300033180 | Bacteria | 8688 |
| 362 | Ga0307510_10044183 | 3300033180 | Bacteria | 4830 |
| 363 | Ga0373954_0000981 | 3300035118 | Bacteria | 11232 |
| 364 | Ga0373955_0102416 | 3300035172 | Bacteria | 1645 |
| 365 | Ga0373937_0003120 | 3300036401 | Bacteria | 13861 |
| 366 | Ga0395899_0000195 | 3300037312 | Bacteria | 89015 |
| 367 | Ga0395899_0004130 | 3300037312 | Bacteria | 11425 |
| 368 | Ga0395900_0000018 | 3300037418 | Bacteria | 363472 |
| 369 | Ga0395898_0000530 | 3300037466 | Bacteria | 72663 |
| 370 | Ga0395898_0000533 | 3300037466 | Bacteria | 72575 |
| 371 | Ga0395901_0140952 | 3300038443 | Bacteria | 2534 |
| 372 | Ga0436365_0595167 | 3300039437 | Bacteria | 7133 |
| 373 | Ga0436361_0534850 | 3300039447 | Bacteria | 74664 |
| 374 | Ga0436361_0944579 | 3300039447 | Bacteria | 9762 |
| 375 | Ga0439436_0000006 | 3300041404 | Bacteria | 123245 |
| 376 | Ga0439465_0000030 | 3300041413 | Bacteria | 28642 |
| 377 | Ga0450908_000095 | 3300042184 | Bacteria | 17458 |
| 378 | Ga0466969_0003759 | 3300044656 | Bacteria | 8068 |
| 379 | Ga0466969_0019326 | 3300044656 | Bacteria | 3543 |
| 380 | Ga0466972_0025125 | 3300044658 | Bacteria | 2954 |
| 381 | Ga0466972_0040378 | 3300044658 | Bacteria | 2274 |
| 382 | Ga0466975_0093908 | 3300044661 | Bacteria | 2136 |
| 383 | Ga0466982_0000010 | 3300044672 | Bacteria | 188341 |
| 384 | Ga0466982_0000033 | 3300044672 | Bacteria | 46451 |
| 385 | Ga0466965_0034225 | 3300044683 | Bacteria | 2485 |
| 386 | Ga0466966_0047532 | 3300044684 | Bacteria | 2735 |
| 387 | Ga0466966_0103263 | 3300044684 | Unclassified | 1762 |
| 388 | Ga0466961_0000604 | 3300044693 | Bacteria | 22628 |
| 389 | Ga0466961_0002035 | 3300044693 | Bacteria | 12585 |
| 390 | Ga0466961_0005214 | 3300044693 | Bacteria | 8179 |
| 391 | Ga0466961_0010585 | 3300044693 | Bacteria | 5885 |
| 392 | Ga0466961_0028013 | 3300044693 | Bacteria | 3623 |
| 393 | Ga0466961_0035309 | 3300044693 | Bacteria | 3211 |
| 394 | Ga0466971_0003869 | 3300044719 | Bacteria | 6419 |
| 395 | Ga0466971_0082505 | 3300044719 | Bacteria | 1467 |
| 396 | Ga0466970_0003423 | 3300044765 | Bacteria | 7721 |
| 397 | Ga0466970_0004581 | 3300044765 | Bacteria | 6823 |
| 398 | Ga0466957_0004881 | 3300044842 | Bacteria | 7506 |
| 399 | Ga0466959_0000043 | 3300045049 | Bacteria | 92533 |
| 400 | Ga0466959_0009477 | 3300045049 | Bacteria | 6928 |
| 401 | Ga0466959_0017254 | 3300045049 | Bacteria | 5289 |
| 402 | Ga0466958_0009428 | 3300045836 | Bacteria | 5439 |
| 403 | Ga0466958_0017336 | 3300045836 | Bacteria | 4161 |
| 404 | Ga0466958_0059425 | 3300045836 | Bacteria | 2326 |
| 405 | Ga0495603_0053549 | 3300046455 | Bacteria | 2394 |
| 406 | Ga0495629_0025153 | 3300046459 | Bacteria | 4235 |
| 407 | Ga0495629_0035896 | 3300046459 | Bacteria | 3501 |
| 408 | Ga0495638_0000009 | 3300046460 | Bacteria | 525345 |
| 409 | Ga0495638_0000052 | 3300046460 | Bacteria | 203695 |
| 410 | Ga0495650_0000009 | 3300046471 | Bacteria | 653845 |
| 411 | Ga0495650_0000027 | 3300046471 | Bacteria | 475071 |
| 412 | Ga0495650_0000122 | 3300046471 | Bacteria | 182888 |
| 413 | Ga0495650_0005128 | 3300046471 | Bacteria | 8650 |
| 414 | Ga0495580_0000249 | 3300046472 | Bacteria | 42609 |
| 415 | Ga0495580_0004692 | 3300046472 | Bacteria | 11463 |
| 416 | Ga0495639_0008744 | 3300046475 | Bacteria | 4343 |
| 417 | Ga0495662_0007636 | 3300046476 | Bacteria | 5336 |
| 418 | Ga0495664_0005541 | 3300046477 | Bacteria | 6936 |
| 419 | Ga0495585_0000021 | 3300046492 | Bacteria | 155715 |
| 420 | Ga0495594_0001013 | 3300046499 | Bacteria | 14654 |
| 421 | Ga0495594_0001638 | 3300046499 | Bacteria | 11655 |
| 422 | Ga0495606_0000056 | 3300046507 | Bacteria | 198575 |
| 423 | Ga0495606_0037325 | 3300046507 | Bacteria | 3301 |
| 424 | Ga0495608_0102407 | 3300046511 | Bacteria | 1846 |
| 425 | Ga0495610_0001176 | 3300046512 | Bacteria | 23703 |
| 426 | Ga0495631_0000060 | 3300046518 | Bacteria | 68239 |
| 427 | Ga0495632_0000003 | 3300046519 | Bacteria | 396071 |
| 428 | Ga0495643_0046181 | 3300046522 | Bacteria | 2362 |
| 429 | Ga0495644_0001022 | 3300046523 | Bacteria | 11661 |
| 430 | Ga0495648_0000688 | 3300046524 | Bacteria | 36092 |
| 431 | Ga0495652_0044883 | 3300046529 | Bacteria | 3804 |
| 432 | Ga0495586_0012344 | 3300046535 | Bacteria | 4532 |
| 433 | Ga0495587_0104899 | 3300046536 | Bacteria | 1626 |
| 434 | Ga0495645_0012556 | 3300046543 | Bacteria | 5971 |
| 435 | Ga0495622_0006997 | 3300046557 | Bacteria | 5236 |
| 436 | Ga0495668_0051146 | 3300046616 | Bacteria | 2288 |
| 437 | Ga0495634_0008699 | 3300046642 | Bacteria | 7530 |
| 438 | Ga0495625_0000174 | 3300046660 | Bacteria | 100401 |
| 439 | Ga0495625_0013321 | 3300046660 | Bacteria | 6612 |
| 440 | Ga0495625_0018234 | 3300046660 | Bacteria | 5484 |
| 441 | Ga0495625_0051306 | 3300046660 | Bacteria | 2958 |
| 442 | Ga0495625_0130807 | 3300046660 | Bacteria | 1700 |
| 443 | Ga0495661_0000353 | 3300046665 | Bacteria | 50121 |
| 444 | Ga0495623_0033022 | 3300046679 | Bacteria | 3323 |
| 445 | Ga0495646_0006928 | 3300046680 | Bacteria | 7195 |
| 446 | Ga0495669_0001680 | 3300046684 | Bacteria | 9061 |
| 447 | Ga0495613_0055258 | 3300046689 | Bacteria | 2917 |
| 448 | Ga0495670_0005163 | 3300046691 | Bacteria | 6424 |
| 449 | Ga0495649_0035326 | 3300046694 | Bacteria | 2749 |
| 450 | Ga0495649_0102315 | 3300046694 | Bacteria | 1522 |
| 451 | Ga0495674_0005764 | 3300047319 | Bacteria | 11876 |
| 452 | Ga0495674_0007158 | 3300047319 | Bacteria | 10670 |
| 453 | Ga0495674_0025992 | 3300047319 | Bacteria | 5358 |
| 454 | Ga0495672_0009768 | 3300047320 | Bacteria | 6912 |
| 455 | Ga0495684_0021024 | 3300047471 | Bacteria | 5027 |
| 456 | Ga0495686_0004810 | 3300047472 | Bacteria | 10906 |
| 457 | Ga0495686_0007061 | 3300047472 | Bacteria | 8471 |
| 458 | Ga0495602_0006491 | 3300048088 | Bacteria | 12273 |
| 459 | Ga0496100_0048526 | 3300048903 | Bacteria | 2741 |
| 460 | Ga0496101_0042667 | 3300048904 | Bacteria | 3238 |
| 461 | Ga0496101_0141191 | 3300048904 | Bacteria | 1836 |
| 462 | Ga0496104_0091689 | 3300048907 | Bacteria | 2905 |
| 463 | Ga0496104_0151671 | 3300048907 | Unclassified | 2224 |
| 464 | Ga0496104_0164181 | 3300048907 | Bacteria | 2129 |
| 465 | Ga0496105_0003575 | 3300048908 | Bacteria | 11535 |
| 466 | Ga0496106_0271098 | 3300048909 | Unclassified | 1359 |
| 467 | Ga0496112_0037133 | 3300048915 | Bacteria | 4756 |
| 468 | Ga0496112_0211488 | 3300048915 | Bacteria | 1896 |
| 469 | Ga0496113_0002616 | 3300048916 | Bacteria | 10533 |
| 470 | Ga0496115_0000013 | 3300048918 | Bacteria | 213060 |
| 471 | Ga0496115_0000044 | 3300048918 | Bacteria | 115745 |
| 472 | Ga0496115_0012431 | 3300048918 | Bacteria | 6407 |
| 473 | Ga0496115_0051691 | 3300048918 | Bacteria | 3294 |
| 474 | Ga0496115_0104355 | 3300048918 | Bacteria | 2326 |
| 475 | Ga0496117_0006370 | 3300048920 | Bacteria | 11993 |
| 476 | Ga0496117_0017189 | 3300048920 | Bacteria | 6053 |
| 477 | Ga0496117_0020746 | 3300048920 | Bacteria | 5347 |
| 478 | Ga0496118_0000636 | 3300048921 | Bacteria | 57474 |
| 479 | Ga0496118_0000780 | 3300048921 | Bacteria | 51033 |
| 480 | Ga0496118_0004166 | 3300048921 | Bacteria | 17446 |
| 481 | Ga0496119_0000109 | 3300048922 | Bacteria | 116054 |
| 482 | Ga0496119_0037017 | 3300048922 | Bacteria | 3176 |
| 483 | Ga0496120_0000150 | 3300048923 | Bacteria | 116072 |
| 484 | Ga0496121_0000013 | 3300048924 | Bacteria | 614976 |
| 485 | Ga0496121_0001215 | 3300048924 | Bacteria | 44880 |
| 486 | Ga0496121_0005667 | 3300048924 | Bacteria | 15885 |
| 487 | Ga0496121_0018867 | 3300048924 | Bacteria | 6923 |
| 488 | Ga0496121_0039847 | 3300048924 | Bacteria | 4132 |
| 489 | Ga0496121_0047961 | 3300048924 | Bacteria | 3639 |
| 490 | Ga0496122_0038959 | 3300048925 | Bacteria | 3797 |
| 491 | Ga0496122_0105799 | 3300048925 | Bacteria | 1864 |
| 492 | Ga0496123_0056615 | 3300048926 | Bacteria | 2560 |
| 493 | Ga0496123_0076145 | 3300048926 | Bacteria | 2067 |
| 494 | Ga0496124_0003509 | 3300048927 | Bacteria | 19100 |
| 495 | Ga0496124_0004598 | 3300048927 | Bacteria | 15998 |
| 496 | Ga0496125_0000453 | 3300048928 | Bacteria | 74032 |
| 497 | Ga0496125_0000599 | 3300048928 | Bacteria | 61376 |
| 498 | Ga0496126_0001475 | 3300048929 | Bacteria | 36589 |
| 499 | Ga0496126_0002275 | 3300048929 | Bacteria | 26475 |
| 500 | Ga0496126_0006890 | 3300048929 | Bacteria | 12589 |
| 501 | Ga0496126_0009222 | 3300048929 | Bacteria | 10524 |
| 502 | Ga0496126_0010917 | 3300048929 | Bacteria | 9463 |
| 503 | Ga0495682_0000253 | 3300049460 | Bacteria | 42266 |
| 504 | Ga0495682_0031178 | 3300049460 | Bacteria | 1971 |
| 505 | Ga0501032_0033565 | 3300049569 | Bacteria | 3515 |
| 506 | Ga0501032_0049466 | 3300049569 | Bacteria | 2836 |
| 507 | Ga0501033_0003097 | 3300049570 | Bacteria | 13810 |
| 508 | Ga0501036_0005483 | 3300049572 | Bacteria | 10288 |
| 509 | Ga0501037_0002833 | 3300049573 | Bacteria | 12571 |
| 510 | Ga0501038_0002468 | 3300049574 | Bacteria | 17200 |
| 511 | Ga0501039_0110293 | 3300049575 | Bacteria | 2151 |
| 512 | Ga0501043_0003939 | 3300049579 | Bacteria | 12177 |
| 513 | Ga0501046_0001610 | 3300049580 | Bacteria | 21590 |
| 514 | Ga0501047_0009097 | 3300049581 | Bacteria | 9380 |
| 515 | Ga0501073_0015192 | 3300049589 | Bacteria | 5586 |
| 516 | Ga0501074_0064294 | 3300049590 | Bacteria | 2642 |
| 517 | Ga0501035_0003319 | 3300049822 | Bacteria | 15418 |
| 518 | Ga0501044_0002842 | 3300049823 | Bacteria | 19709 |
| 519 | nmdc:mga08x19_78068_c1 | 3300050514 | Bacteria | 2169 |
| 520 | Ga0495601_0045246 | 3300053077 | Unclassified | 2767 |
| 521 | Ga0495601_0049721 | 3300053077 | Bacteria | 2644 |
| 522 | Ga0500644_0023228 | 3300053088 | Bacteria | 1881 |
| 523 | Ga0500651_0000022 | 3300053093 | Bacteria | 136412 |
| 524 | Ga0500595_000007 | 3300053119 | Bacteria | 289461 |
| 525 | Ga0500595_004569 | 3300053119 | Bacteria | 6178 |
| 526 | Ga0500645_000125 | 3300053730 | Bacteria | 60408 |
| 527 | Ga0466962_0003669 | 3300061719 | Bacteria | 7318 |
| 528 | 2819562553 | 2818991440 | Bacteria | 4774720 |
| 529 | 2842915272 | 2842914999 | Bacteria | 4419378 |
| 530 | 2842921615 | 2842918807 | Bacteria | 4289178 |
| 531 | 2884217272 | 2884215851 | Bacteria | 4554841 |
| 532 | 2904463155 | 2904463128 | Bacteria | 4775606 |
| 533 | 2928963865 | 2928963466 | Bacteria | 5165703 |
| 534 | 2941472429 | 2941471342 | Bacteria | 5018624 |
| 535 | 2953997630 | 2953994433 | Bacteria | 4303959 |
| 536 | Ga0105240_10033803 | |||
| 537 | LJNas_1000307 | |||
| 538 | JGI24739J22299_10001182 | |||
| 539 | JGI24737J22298_10035923 | |||
| 540 | JGI24735J21928_10017091 | |||
| 541 | JGI24735J21928_10020875 | |||
| 542 | JGI24738J21930_10004670 | |||
| 543 | JGI25162J39368_1000066 | |||
| 544 | JGI25162J39368_1000623 | |||
| 545 | JGI25162J39368_1000876 | |||
| 546 | JGI25157J39369_1000050 | |||
| 547 | JGI25157J39369_1000957 | |||
| 548 | JGI25157J39369_1001576 | |||
| 549 | JGI25163J39215_1002659 | |||
| 550 | JGI25164J39214_1000056 | |||
| 551 | JGI25164J39214_1000061 | |||
| 552 | JGI25165J46597_1000009 | |||
| 553 | JGI25165J46597_1000151 | |||
| 554 | rootH2_10050965 | |||
| 555 | rootH2_10078932 | |||
| 556 | Ga0055538_1002563 | |||
| 557 | Ga0055539_1000614 | |||
| 558 | Ga0055533_1000913 | |||
| 559 | Ga0055525_1000856 | |||
| 560 | Ga0055527_1000271 | |||
| 561 | Ga0055527_1000273 | |||
| 562 | Ga0055535_1000045 | |||
| 563 | Ga0055535_1000466 | |||
| 564 | Ga0055535_1000567 | |||
| 565 | Ga0055535_1000574 | |||
| 566 | Ga0055542_1000010 | |||
| 567 | Ga0055542_1000079 | |||
| 568 | Ga0055542_1000591 | |||
| 569 | Ga0055542_1000597 | |||
| 570 | Ga0055542_1001011 | |||
| 571 | Ga0055529_1000122 | |||
| 572 | Ga0055529_1000140 | |||
| 573 | Ga0055529_1000556 | |||
| 574 | Ga0055529_1000815 | |||
| 575 | Ga0065165_1000186 | |||
| 576 | Ga0070658_10000007 | |||
| 577 | Ga0070658_10016591 | |||
| 578 | Ga0070658_10021565 | |||
| 579 | Ga0070658_10027051 | |||
| 580 | Ga0070658_10184919 | |||
| 581 | Ga0070683_100037549 | |||
| 582 | Ga0070683_100113830 | |||
| 583 | Ga0070670_100063050 | |||
| 584 | Ga0068869_100003330 | |||
| 585 | Ga0070666_10000008 | |||
| 586 | Ga0068868_100000995 | |||
| 587 | Ga0070689_100017194 | |||
| 588 | Ga0070661_100007534 | |||
| 589 | Ga0070661_100021595 | |||
| 590 | Ga0070668_100100073 | |||
| 591 | Ga0070671_100010112 | |||
| 592 | Ga0070688_100054144 | |||
| 593 | Ga0070659_100046459 | |||
| 594 | Ga0070667_100107765 | |||
| 595 | Ga0070709_10000389 | |||
| 596 | Ga0070709_10024544 | |||
| 597 | Ga0070714_100018479 | |||
| 598 | Ga0070714_100019180 | |||
| 599 | Ga0070714_100145569 | |||
| 600 | Ga0070713_100000240 | |||
| 601 | Ga0070713_100000860 | |||
| 602 | Ga0070713_100001393 | |||
| 603 | Ga0070713_100005337 | |||
| 604 | Ga0070713_100007637 | |||
| 605 | Ga0070711_100008179 | |||
| 606 | Ga0070711_100045408 | |||
| 607 | Ga0070711_100050361 | |||
| 608 | Ga0070663_100015653 | |||
| 609 | Ga0070663_100062808 | |||
| 610 | Ga0070663_100134224 | |||
| 611 | Ga0070662_100025419 | |||
| 612 | Ga0070681_10007232 | |||
| 613 | Ga0070681_10009811 | |||
| 614 | Ga0068867_100083052 | |||
| 615 | Ga0070707_100043551 | |||
| 616 | Ga0070679_100004474 | |||
| 617 | Ga0070679_100097174 | |||
| 618 | Ga0070684_100022318 | |||
| 619 | Ga0070684_100025054 | |||
| 620 | Ga0070684_100026400 | |||
| 621 | Ga0068853_100000020 | |||
| 622 | Ga0068853_100017887 | |||
| 623 | Ga0068853_100030721 | |||
| 624 | Ga0068853_100037155 | |||
| 625 | Ga0070665_100033023 | |||
| 626 | Ga0070665_100063345 | |||
| 627 | Ga0070665_100077635 | |||
| 628 | Ga0068855_100002105 | |||
| 629 | Ga0068855_100005395 | |||
| 630 | Ga0068855_100005499 | |||
| 631 | Ga0068855_100016759 | |||
| 632 | Ga0068855_100022030 | |||
| 633 | Ga0068855_100027044 | |||
| 634 | Ga0068855_100032809 | |||
| 635 | Ga0068855_100047771 | |||
| 636 | Ga0070664_100101771 | |||
| 637 | Ga0070664_100146668 | |||
| 638 | Ga0068857_100000189 | |||
| 639 | Ga0068857_100001376 | |||
| 640 | Ga0068857_100006723 | |||
| 641 | Ga0068857_100186220 | |||
| 642 | Ga0068854_100000112 | |||
| 643 | Ga0068854_100004478 | |||
| 644 | Ga0068854_100008457 | |||
| 645 | Ga0068854_100009911 | |||
| 646 | Ga0068854_100049730 | |||
| 647 | Ga0068854_100050015 | |||
| 648 | Ga0068856_100000179 | |||
| 649 | Ga0068856_100000323 | |||
| 650 | Ga0068856_100010763 | |||
| 651 | Ga0068856_100014695 | |||
| 652 | Ga0068856_100244498 | |||
| 653 | Ga0068859_100001235 | |||
| 654 | Ga0068864_100000129 | |||
| 655 | Ga0068864_100112909 | |||
| 656 | Ga0068863_100004744 | |||
| 657 | Ga0068858_100000272 | |||
| 658 | Ga0068858_100002550 | |||
| 659 | Ga0068858_100010102 | |||
| 660 | Ga0068858_100104791 | |||
| 661 | Ga0068860_100098222 | |||
| 662 | Ga0068860_100143097 | |||
| 663 | Ga0081455_10176541 | |||
| 664 | Ga0081540_1004420 | |||
| 665 | Ga0070717_10001325 | |||
| 666 | Ga0070717_10003643 | |||
| 667 | Ga0070717_10082016 | |||
| 668 | Ga0070716_100002097 | |||
| 669 | Ga0070716_100165402 | |||
| 670 | Ga0070712_100021376 | |||
| 671 | Ga0070712_100031295 | |||
| 672 | Ga0070712_100087564 | |||
| 673 | Ga0070712_100105388 | |||
| 674 | Ga0097621_100002345 | |||
| 675 | Ga0097621_100146124 | |||
| 676 | Ga0068871_100000476 | |||
| 677 | Ga0097620_100001235 | |||
| 678 | Ga0105240_10000884 | |||
| 679 | Ga0105240_10001842 | |||
| 680 | Ga0105240_10008820 | |||
| 681 | Ga0105240_10034423 | |||
| 682 | Ga0105240_10040519 | |||
| 683 | Ga0105240_10086873 | |||
| 684 | Ga0105240_10262823 | |||
| 685 | Ga0105247_10012902 | |||
| 686 | Ga0105243_10161142 | |||
| 687 | Ga0105248_10000003 | |||
| 688 | Ga0105248_10001430 | |||
| 689 | Ga0105248_10036718 | |||
| 690 | Ga0105248_10187683 | |||
| 691 | Ga0105237_10000136 | |||
| 692 | Ga0105237_10037387 | |||
| 693 | Ga0105237_10044490 | |||
| 694 | Ga0105237_10209575 | |||
| 695 | Ga0105238_10003140 | |||
| 696 | Ga0105238_10032910 | |||
| 697 | Ga0105238_10039610 | |||
| 698 | Ga0105238_10058975 | |||
| 699 | Ga0105238_10210933 | |||
| 700 | Ga0105239_10000050 | |||
| 701 | Ga0105239_10003222 | |||
| 702 | Ga0105239_10011958 | |||
| 703 | Ga0105239_10182592 | |||
| 704 | Ga0157319_1000005 | |||
| 705 | Ga0157314_1000157 | |||
| 706 | Ga0157373_10056710 | |||
| 707 | Ga0157370_10007106 | |||
| 708 | Ga0157370_10024061 | |||
| 709 | Ga0157370_10099724 | |||
| 710 | Ga0157369_10008365 | |||
| 711 | Ga0157369_10009439 | |||
| 712 | Ga0157369_10046144 | |||
| 713 | Ga0157369_10068901 | |||
| 714 | Ga0157369_10084831 | |||
| 715 | Ga0157369_10106526 | |||
| 716 | Ga0157369_10108577 | |||
| 717 | Ga0157369_10177274 | |||
| 718 | Ga0157369_10367965 | |||
| 719 | Ga0157374_10000766 | |||
| 720 | Ga0157374_10004453 | |||
| 721 | Ga0157378_10000009 | |||
| 722 | Ga0163162_10000851 | |||
| 723 | Ga0157372_10000140 | |||
| 724 | Ga0157372_10001616 | |||
| 725 | Ga0157372_10001867 | |||
| 726 | Ga0157372_10002812 | |||
| 727 | Ga0157372_10005638 | |||
| 728 | Ga0157372_10082234 | |||
| 729 | Ga0157372_10131281 | |||
| 730 | Ga0157372_10182515 | |||
| 731 | Ga0163163_10002757 | |||
| 732 | Ga0163163_10291773 | |||
| 733 | Ga0182008_10002794 | |||
| 734 | Ga0157376_10003224 | |||
| 735 | Ga0157376_10068349 | |||
| 736 | Ga0157376_10153187 | |||
| 737 | Ga0182006_1001703 | |||
| 738 | Ga0182007_10012089 | |||
| 739 | Ga0182005_1003469 | |||
| 740 | Ga0183368_1004 | |||
| 741 | Ga0209435_102268 | |||
| 742 | Ga0209784_100013 | |||
| 743 | Ga0209674_100053 | |||
| 744 | Ga0209674_100063 | |||
| 745 | Ga0209674_102281 | |||
| 746 | Ga0209672_100009 | |||
| 747 | Ga0209672_100024 | |||
| 748 | Ga0209672_100107 | |||
| 749 | Ga0209563_100127 | |||
| 750 | Ga0207427_100021 | |||
| 751 | Ga0207427_100030 | |||
| 752 | Ga0209437_100012 | |||
| 753 | Ga0209437_100150 | |||
| 754 | Ga0209437_100416 | |||
| 755 | Ga0209258_100011 | |||
| 756 | Ga0209258_100019 | |||
| 757 | Ga0209258_100047 | |||
| 758 | Ga0209258_100299 | |||
| 759 | Ga0209258_101028 | |||
| 760 | Ga0209646_1000458 | |||
| 761 | Ga0209646_1000553 | |||
| 762 | Ga0209026_1000010 | |||
| 763 | Ga0209026_1000015 | |||
| 764 | Ga0209026_1000163 | |||
| 765 | Ga0209026_1005397 | |||
| 766 | Ga0209148_1000001 | |||
| 767 | Ga0209148_1000005 | |||
| 768 | Ga0209148_1000013 | |||
| 769 | Ga0209148_1000054 | |||
| 770 | Ga0209148_1000205 | |||
| 771 | Ga0209759_1000023 | |||
| 772 | Ga0209759_1000622 | |||
| 773 | Ga0209759_1004122 | |||
| 774 | Ga0209129_1002144 | |||
| 775 | Ga0209233_1000002 | |||
| 776 | Ga0209233_1000023 | |||
| 777 | Ga0209455_1000012 | |||
| 778 | Ga0209455_1000027 | |||
| 779 | Ga0209455_1000052 | |||
| 780 | Ga0209455_1000081 | |||
| 781 | Ga0209257_1014211 | |||
| 782 | Ga0209257_1015973 | |||
| 783 | Ga0207697_10072531 | |||
| 784 | Ga0207692_10111578 | |||
| 785 | Ga0207680_10000005 | |||
| 786 | Ga0207647_10001010 | |||
| 787 | Ga0207647_10004877 | |||
| 788 | Ga0207647_10111319 | |||
| 789 | Ga0207699_10008055 | |||
| 790 | Ga0207699_10013471 | |||
| 791 | Ga0207699_10024760 | |||
| 792 | Ga0207705_10000013 | |||
| 793 | Ga0207705_10001463 | |||
| 794 | Ga0207705_10003955 | |||
| 795 | Ga0207705_10017963 | |||
| 796 | Ga0207705_10058789 | |||
| 797 | Ga0207707_10023053 | |||
| 798 | Ga0207695_10000198 | |||
| 799 | Ga0207695_10000694 | |||
| 800 | Ga0207695_10002325 | |||
| 801 | Ga0207695_10007696 | |||
| 802 | Ga0207695_10015849 | |||
| 803 | Ga0207695_10026127 | |||
| 804 | Ga0207695_10046395 | |||
| 805 | Ga0207695_10051777 | |||
| 806 | Ga0207695_10139220 | |||
| 807 | Ga0207671_10000059 | |||
| 808 | Ga0207671_10031622 | |||
| 809 | Ga0207671_10067946 | |||
| 810 | Ga0207671_10075754 | |||
| 811 | Ga0207693_10000084 | |||
| 812 | Ga0207693_10000160 | |||
| 813 | Ga0207693_10031338 | |||
| 814 | Ga0207693_10031475 | |||
| 815 | Ga0207693_10061240 | |||
| 816 | Ga0207663_10009342 | |||
| 817 | Ga0207663_10026305 | |||
| 818 | Ga0207657_10005725 | |||
| 819 | Ga0207657_10046151 | |||
| 820 | Ga0207652_10028631 | |||
| 821 | Ga0207646_10078840 | |||
| 822 | Ga0207694_10000241 | |||
| 823 | Ga0207694_10027366 | |||
| 824 | Ga0207700_10001174 | |||
| 825 | Ga0207700_10001774 | |||
| 826 | Ga0207700_10021384 | |||
| 827 | Ga0207700_10074273 | |||
| 828 | Ga0207700_10095633 | |||
| 829 | Ga0207700_10096828 | |||
| 830 | Ga0207664_10137933 | |||
| 831 | Ga0207690_10011373 | |||
| 832 | Ga0207690_10075751 | |||
| 833 | Ga0207706_10039908 | |||
| 834 | Ga0207670_10006704 | |||
| 835 | Ga0207665_10006958 | |||
| 836 | Ga0207665_10010350 | |||
| 837 | Ga0207665_10053230 | |||
| 838 | Ga0207711_10000012 | |||
| 839 | Ga0207711_10149384 | |||
| 840 | Ga0207689_10020634 | |||
| 841 | Ga0207679_10024016 | |||
| 842 | Ga0207667_10000031 | |||
| 843 | Ga0207667_10000292 | |||
| 844 | Ga0207667_10003408 | |||
| 845 | Ga0207667_10008428 | |||
| 846 | Ga0207667_10019177 | |||
| 847 | Ga0207667_10035946 | |||
| 848 | Ga0207667_10079052 | |||
| 849 | Ga0207640_10000001 | |||
| 850 | Ga0207640_10000061 | |||
| 851 | Ga0207640_10000995 | |||
| 852 | Ga0207640_10023791 | |||
| 853 | Ga0207640_10038520 | |||
| 854 | Ga0207640_10103020 | |||
| 855 | Ga0207677_10023622 | |||
| 856 | Ga0207703_10000365 | |||
| 857 | Ga0207703_10006688 | |||
| 858 | Ga0207703_10008600 | |||
| 859 | Ga0207703_10091740 | |||
| 860 | Ga0207639_10000023 | |||
| 861 | Ga0207639_10096811 | |||
| 862 | Ga0207678_10005660 | |||
| 863 | Ga0207678_10022118 | |||
| 864 | Ga0207678_10202380 | |||
| 865 | Ga0207702_10006103 | |||
| 866 | Ga0207702_10013707 | |||
| 867 | Ga0207702_10014687 | |||
| 868 | Ga0207702_10035149 | |||
| 869 | Ga0207641_10005114 | |||
| 870 | Ga0207648_10073278 | |||
| 871 | Ga0207676_10003562 | |||
| 872 | Ga0207674_10000298 | |||
| 873 | Ga0207674_10000763 | |||
| 874 | Ga0207674_10005708 | |||
| 875 | Ga0207674_10207554 | |||
| 876 | Ga0207698_10164529 | |||
| 877 | Ga0268266_10000004 | |||
| 878 | Ga0268266_10001623 | |||
| 879 | Ga0268266_10002599 | |||
| 880 | Ga0268266_10055850 | |||
| 881 | Ga0268264_10058948 | |||
| 882 | Ga0268264_10149612 | |||
| 883 | Ga0265338_10002332 | |||
| 884 | Ga0265762_1000396 | |||
| 885 | Ga0265760_10013641 | |||
| 886 | Ga0265760_10025781 | |||
| 887 | Ga0265325_10016019 | |||
| 888 | Ga0265325_10042880 | |||
| 889 | Ga0265331_10027239 | |||
| 890 | Ga0265316_10004157 | |||
| 891 | Ga0265316_10015042 | |||
| 892 | Ga0265314_10001468 | |||
| 893 | Ga0265314_10056419 | |||
| 894 | Ga0307405_10155385 | |||
| 895 | Ga0307510_10003576 | |||
| 896 | Ga0307510_10016607 | |||
| 897 | Ga0307510_10044183 | |||
| 898 | Ga0373954_0000981 | |||
| 899 | Ga0373955_0102416 | |||
| 900 | Ga0373937_0003120 | |||
| 901 | Ga0395899_0000195 | |||
| 902 | Ga0395899_0004130 | |||
| 903 | Ga0395900_0000018 | |||
| 904 | Ga0395898_0000530 | |||
| 905 | Ga0395898_0000533 | |||
| 906 | Ga0395901_0140952 | |||
| 907 | Ga0436365_0595167 | |||
| 908 | Ga0436361_0534850 | |||
| 909 | Ga0436361_0944579 | |||
| 910 | Ga0439436_0000006 | |||
| 911 | Ga0439465_0000030 | |||
| 912 | Ga0450908_000095 | |||
| 913 | Ga0466969_0003759 | |||
| 914 | Ga0466969_0019326 | |||
| 915 | Ga0466972_0025125 | |||
| 916 | Ga0466972_0040378 | |||
| 917 | Ga0466975_0093908 | |||
| 918 | Ga0466982_0000010 | |||
| 919 | Ga0466982_0000033 | |||
| 920 | Ga0466965_0034225 | |||
| 921 | Ga0466966_0047532 | |||
| 922 | Ga0466966_0103263 | |||
| 923 | Ga0466961_0000604 | |||
| 924 | Ga0466961_0002035 | |||
| 925 | Ga0466961_0005214 | |||
| 926 | Ga0466961_0010585 | |||
| 927 | Ga0466961_0028013 | |||
| 928 | Ga0466961_0035309 | |||
| 929 | Ga0466971_0003869 | |||
| 930 | Ga0466971_0082505 | |||
| 931 | Ga0466970_0003423 | |||
| 932 | Ga0466970_0004581 | |||
| 933 | Ga0466957_0004881 | |||
| 934 | Ga0466959_0000043 | |||
| 935 | Ga0466959_0009477 | |||
| 936 | Ga0466959_0017254 | |||
| 937 | Ga0466958_0009428 | |||
| 938 | Ga0466958_0017336 | |||
| 939 | Ga0466958_0059425 | |||
| 940 | Ga0495603_0053549 | |||
| 941 | Ga0495629_0025153 | |||
| 942 | Ga0495629_0035896 | |||
| 943 | Ga0495638_0000009 | |||
| 944 | Ga0495638_0000052 | |||
| 945 | Ga0495650_0000009 | |||
| 946 | Ga0495650_0000027 | |||
| 947 | Ga0495650_0000122 | |||
| 948 | Ga0495650_0005128 | |||
| 949 | Ga0495580_0000249 | |||
| 950 | Ga0495580_0004692 | |||
| 951 | Ga0495639_0008744 | |||
| 952 | Ga0495662_0007636 | |||
| 953 | Ga0495664_0005541 | |||
| 954 | Ga0495585_0000021 | |||
| 955 | Ga0495594_0001013 | |||
| 956 | Ga0495594_0001638 | |||
| 957 | Ga0495606_0000056 | |||
| 958 | Ga0495606_0037325 | |||
| 959 | Ga0495608_0102407 | |||
| 960 | Ga0495610_0001176 | |||
| 961 | Ga0495631_0000060 | |||
| 962 | Ga0495632_0000003 | |||
| 963 | Ga0495643_0046181 | |||
| 964 | Ga0495644_0001022 | |||
| 965 | Ga0495648_0000688 | |||
| 966 | Ga0495652_0044883 | |||
| 967 | Ga0495586_0012344 | |||
| 968 | Ga0495587_0104899 | |||
| 969 | Ga0495645_0012556 | |||
| 970 | Ga0495622_0006997 | |||
| 971 | Ga0495668_0051146 | |||
| 972 | Ga0495634_0008699 | |||
| 973 | Ga0495625_0000174 | |||
| 974 | Ga0495625_0013321 | |||
| 975 | Ga0495625_0018234 | |||
| 976 | Ga0495625_0051306 | |||
| 977 | Ga0495625_0130807 | |||
| 978 | Ga0495661_0000353 | |||
| 979 | Ga0495623_0033022 | |||
| 980 | Ga0495646_0006928 | |||
| 981 | Ga0495669_0001680 | |||
| 982 | Ga0495613_0055258 | |||
| 983 | Ga0495670_0005163 | |||
| 984 | Ga0495649_0035326 | |||
| 985 | Ga0495649_0102315 | |||
| 986 | Ga0495674_0005764 | |||
| 987 | Ga0495674_0007158 | |||
| 988 | Ga0495674_0025992 | |||
| 989 | Ga0495672_0009768 | |||
| 990 | Ga0495684_0021024 | |||
| 991 | Ga0495686_0004810 | |||
| 992 | Ga0495686_0007061 | |||
| 993 | Ga0495602_0006491 | |||
| 994 | Ga0496100_0048526 | |||
| 995 | Ga0496101_0042667 | |||
| 996 | Ga0496101_0141191 | |||
| 997 | Ga0496104_0091689 | |||
| 998 | Ga0496104_0151671 | |||
| 999 | Ga0496104_0164181 | |||
| 1000 | Ga0496105_0003575 | |||
| 1001 | Ga0496106_0271098 | |||
| 1002 | Ga0496112_0037133 | |||
| 1003 | Ga0496112_0211488 | |||
| 1004 | Ga0496113_0002616 | |||
| 1005 | Ga0496115_0000013 | |||
| 1006 | Ga0496115_0000044 | |||
| 1007 | Ga0496115_0012431 | |||
| 1008 | Ga0496115_0051691 | |||
| 1009 | Ga0496115_0104355 | |||
| 1010 | Ga0496117_0006370 | |||
| 1011 | Ga0496117_0017189 | |||
| 1012 | Ga0496117_0020746 | |||
| 1013 | Ga0496118_0000636 | |||
| 1014 | Ga0496118_0000780 | |||
| 1015 | Ga0496118_0004166 | |||
| 1016 | Ga0496119_0000109 | |||
| 1017 | Ga0496119_0037017 | |||
| 1018 | Ga0496120_0000150 | |||
| 1019 | Ga0496121_0000013 | |||
| 1020 | Ga0496121_0001215 | |||
| 1021 | Ga0496121_0005667 | |||
| 1022 | Ga0496121_0018867 | |||
| 1023 | Ga0496121_0039847 | |||
| 1024 | Ga0496121_0047961 | |||
| 1025 | Ga0496122_0038959 | |||
| 1026 | Ga0496122_0105799 | |||
| 1027 | Ga0496123_0056615 | |||
| 1028 | Ga0496123_0076145 | |||
| 1029 | Ga0496124_0003509 | |||
| 1030 | Ga0496124_0004598 | |||
| 1031 | Ga0496125_0000453 | |||
| 1032 | Ga0496125_0000599 | |||
| 1033 | Ga0496126_0001475 | |||
| 1034 | Ga0496126_0002275 | |||
| 1035 | Ga0496126_0006890 | |||
| 1036 | Ga0496126_0009222 | |||
| 1037 | Ga0496126_0010917 | |||
| 1038 | Ga0495682_0000253 | |||
| 1039 | Ga0495682_0031178 | |||
| 1040 | Ga0501032_0033565 | |||
| 1041 | Ga0501032_0049466 | |||
| 1042 | Ga0501033_0003097 | |||
| 1043 | Ga0501036_0005483 | |||
| 1044 | Ga0501037_0002833 | |||
| 1045 | Ga0501038_0002468 | |||
| 1046 | Ga0501039_0110293 | |||
| 1047 | Ga0501043_0003939 | |||
| 1048 | Ga0501046_0001610 | |||
| 1049 | Ga0501047_0009097 | |||
| 1050 | Ga0501073_0015192 | |||
| 1051 | Ga0501074_0064294 | |||
| 1052 | Ga0501035_0003319 | |||
| 1053 | Ga0501044_0002842 | |||
| 1054 | nmdc:mga08x19_78068_c1 | |||
| 1055 | Ga0495601_0045246 | |||
| 1056 | Ga0495601_0049721 | |||
| 1057 | Ga0500644_0023228 | |||
| 1058 | Ga0500651_0000022 | |||
| 1059 | Ga0500595_000007 | |||
| 1060 | Ga0500595_004569 | |||
| 1061 | Ga0500645_000125 | |||
| 1062 | Ga0466962_0003669 | |||
| 1063 | 2819562553 | |||
| 1064 | 2842915272 | |||
| 1065 | 2842921615 | |||
| 1066 | 2884217272 | |||
| 1067 | 2904463155 | |||
| 1068 | 2928963865 | |||
| 1069 | 2941472429 | |||
| 1070 | 2953997630 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4oue-assembly2.cif.gz_B | crystal structure of an a-l-fucosidase gh29 from bacteroides thetaiotaomicron (bt2192) in complex with iptg | 0.9326 | 24 | 443 |
| 3uet-assembly1.cif.gz_B | crystal structure of alpha-1,3/4-fucosidase from bifidobacterium longum subsp. infantis d172a/e217a mutant complexed with lacto-n-fucopentaose ii | 0.9183 | 21 | 443 |
| 8ayr-assembly2.cif.gz_B | sialidases and fucosidases of akkermansia muciniphila are key for rapid growth on colonic mucin and nutrient sharing amongst mucin-associated human gut microbiota | 0.9166 | 25 | 447 |
| 3ues-assembly1.cif.gz_A | crystal structure of alpha-1,3/4-fucosidase from bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin | 0.9135 | 21 | 443 |
| 6org-assembly2.cif.gz_B | crystal structure of spgh29 | 0.9102 | 23 | 443 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ozoB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9464 | 26 | 317 | 3.20.20.80 |
| af_Q7XUR3_35_350_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.929 | 26 | 322 | 3.20.20.80 |
| 3gzaA02 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.9281 | 354 | 443 | 2.60.120.260 |
| af_Q7XUR3_364_478_2.60.120.260 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.8967 | 329 | 443 | 2.60.120.260 |
| 3mo4A01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.8919 | 17 | 317 | 3.20.20.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A855K4S6-F1-model_v4 | Alpha-L-fucosidase | 0.9917 | 53 | 143 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |
| AF-A0A3C1R4S6-F1-model_v4 | deleted | 0.99 | 26 | 143 |
|
| AF-A0A7J7DZ34-F1-model_v4 | alpha-L-fucosidase (EC 3.2.1.51) | 0.9848 | 26 | 121 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |
| AF-J9CAZ2-F1-model_v4 | Glycoside hydrolase, family 29 (EC 3.2.1.51) | 0.9846 | 26 | 131 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |
| AF-K1UJK4-F1-model_v4 | Alpha-L-fucosidase | 0.9845 | 26 | 143 |
GO:0004560
GO:0005764 GO:0006004 GO:0016139 |