F460649
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 535 | 326 | 522 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10248701|Ga0111539_102487014 |
| Length | 229 |
| Sequence | MAAGRFLNLGGHRFFIPLQRTTTMSEVKQIKAVARDRAGKGAARAVRRQGQVPAVIYGAGQSAQAIALDFNQTKQLIFAGHFLTTIFEIDVDGKTVRAIPRDYQLDPVRDFPIHVDFLRLAQGQAIKVVVPVHVVGQEKSPGVKRGGALQIVEHSVELLVPSDAIPDYIEASVDGLNIGDSVHLNDITLPKGAKATSTENMTLVTVVAPTGLTEEDAAPAAAAEGTAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 4 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 5 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 6 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 7 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 8 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 9 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 10 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 169 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 182 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 185 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 187 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 198 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 199 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 200 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 201 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 202 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 203 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 204 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 205 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 260 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 298 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 306 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 308 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 309 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 310 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 321 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 324 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 325 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 326 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.02 |
| Metatranscriptomes | 3.55 |
| Isolates | 2.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.23 |
| Nodule | 1.31 |
| Rhizoplane | 10.65 |
| Rhizosphere | 80.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1005917 | 3300002070 | Bacteria | 1511 |
| 2 | JGI24744J21845_10002877 | 3300002077 | Bacteria | 3518 |
| 3 | Ga0006778J45830_1079432 | 3300003162 | Bacteria | 826 |
| 4 | Ga0007429J51699_1076873 | 3300003579 | Bacteria | 757 |
| 5 | Ga0070690_100070710 | 3300005330 | Bacteria | 2266 |
| 6 | Ga0070690_100108953 | 3300005330 | Bacteria | 1846 |
| 7 | Ga0070670_100041769 | 3300005331 | Bacteria | 3941 |
| 8 | Ga0070670_100124344 | 3300005331 | Bacteria | 2226 |
| 9 | Ga0068869_100035515 | 3300005334 | Bacteria | 3532 |
| 10 | Ga0070680_100483928 | 3300005336 | Bacteria | 1058 |
| 11 | Ga0068868_100033994 | 3300005338 | Bacteria | 3933 |
| 12 | Ga0068868_100196884 | 3300005338 | Bacteria | 1678 |
| 13 | Ga0070660_100187988 | 3300005339 | Bacteria | 1672 |
| 14 | Ga0070689_100060355 | 3300005340 | Bacteria | 2948 |
| 15 | Ga0070689_100156434 | 3300005340 | Bacteria | 1840 |
| 16 | Ga0070691_10049601 | 3300005341 | Bacteria | 2000 |
| 17 | Ga0070687_100000967 | 3300005343 | Bacteria | 9766 |
| 18 | Ga0070692_10040201 | 3300005345 | Bacteria | 2391 |
| 19 | Ga0070668_100112002 | 3300005347 | Bacteria | 2173 |
| 20 | Ga0070668_100240052 | 3300005347 | Bacteria | 1501 |
| 21 | Ga0070668_100515784 | 3300005347 | Bacteria | 1036 |
| 22 | Ga0070668_100580654 | 3300005347 | Bacteria | 978 |
| 23 | Ga0070669_100034089 | 3300005353 | Bacteria | 3685 |
| 24 | Ga0070669_100200275 | 3300005353 | Bacteria | 1571 |
| 25 | Ga0070675_100048010 | 3300005354 | Bacteria | 3499 |
| 26 | Ga0070675_100341870 | 3300005354 | Bacteria | 1325 |
| 27 | Ga0070671_100000672 | 3300005355 | Bacteria | 24494 |
| 28 | Ga0070671_100136600 | 3300005355 | Bacteria | 2067 |
| 29 | Ga0070674_100039927 | 3300005356 | Bacteria | 3172 |
| 30 | Ga0070673_100003747 | 3300005364 | Bacteria | 9534 |
| 31 | Ga0070673_100122532 | 3300005364 | Bacteria | 2171 |
| 32 | Ga0070688_100007633 | 3300005365 | Bacteria | 5841 |
| 33 | Ga0070688_100117511 | 3300005365 | Bacteria | 1777 |
| 34 | Ga0070659_100035055 | 3300005366 | Bacteria | 3905 |
| 35 | Ga0070659_100416125 | 3300005366 | Bacteria | 1136 |
| 36 | Ga0070667_100165167 | 3300005367 | Bacteria | 1952 |
| 37 | Ga0070667_100601137 | 3300005367 | Bacteria | 1013 |
| 38 | Ga0070714_100007212 | 3300005435 | Bacteria | 8631 |
| 39 | Ga0070714_100049173 | 3300005435 | Bacteria | 3589 |
| 40 | Ga0070713_100000796 | 3300005436 | Bacteria | 20141 |
| 41 | Ga0070713_100097225 | 3300005436 | Bacteria | 2544 |
| 42 | Ga0070710_10006756 | 3300005437 | Bacteria | 5531 |
| 43 | Ga0070701_10259005 | 3300005438 | Bacteria | 1053 |
| 44 | Ga0070711_100005690 | 3300005439 | Bacteria | 7472 |
| 45 | Ga0070711_100325169 | 3300005439 | Bacteria | 1230 |
| 46 | Ga0070700_100072426 | 3300005441 | Bacteria | 2203 |
| 47 | Ga0070700_100249225 | 3300005441 | Bacteria | 1273 |
| 48 | Ga0070678_100254661 | 3300005456 | Bacteria | 1473 |
| 49 | Ga0070662_100054025 | 3300005457 | Bacteria | 2910 |
| 50 | Ga0068867_100076949 | 3300005459 | Bacteria | 2506 |
| 51 | Ga0070685_10077238 | 3300005466 | Bacteria | 1988 |
| 52 | Ga0070684_100395598 | 3300005535 | Bacteria | 1274 |
| 53 | Ga0070672_100012217 | 3300005543 | Bacteria | 6017 |
| 54 | Ga0070686_100007538 | 3300005544 | Bacteria | 6076 |
| 55 | Ga0070686_100252960 | 3300005544 | Bacteria | 1288 |
| 56 | Ga0070695_100276594 | 3300005545 | Bacteria | 1232 |
| 57 | Ga0070696_100044773 | 3300005546 | Bacteria | 3064 |
| 58 | Ga0070665_100293292 | 3300005548 | Bacteria | 1629 |
| 59 | Ga0070665_100508889 | 3300005548 | Bacteria | 1215 |
| 60 | Ga0070664_100074547 | 3300005564 | Bacteria | 2913 |
| 61 | Ga0068854_100017535 | 3300005578 | Bacteria | 4791 |
| 62 | Ga0068856_100195515 | 3300005614 | Bacteria | 2036 |
| 63 | Ga0070702_101043443 | 3300005615 | Bacteria | 650 |
| 64 | Ga0068864_100050382 | 3300005618 | Bacteria | 3584 |
| 65 | Ga0068864_100151427 | 3300005618 | Bacteria | 2101 |
| 66 | Ga0068864_100222281 | 3300005618 | Bacteria | 1743 |
| 67 | Ga0068861_100278121 | 3300005719 | Bacteria | 1440 |
| 68 | Ga0068851_10056745 | 3300005834 | Bacteria | 1998 |
| 69 | Ga0068870_10001266 | 3300005840 | Bacteria | 10142 |
| 70 | Ga0068870_10408053 | 3300005840 | Bacteria | 886 |
| 71 | Ga0068863_100043980 | 3300005841 | Bacteria | 4240 |
| 72 | Ga0068863_100502034 | 3300005841 | Bacteria | 1195 |
| 73 | Ga0068863_100655177 | 3300005841 | Bacteria | 1041 |
| 74 | Ga0068858_101188587 | 3300005842 | Bacteria | 749 |
| 75 | Ga0068860_100056464 | 3300005843 | Bacteria | 3732 |
| 76 | Ga0068862_100046677 | 3300005844 | Bacteria | 3695 |
| 77 | Ga0081455_10007086 | 3300005937 | Bacteria | 11894 |
| 78 | Ga0081455_10030017 | 3300005937 | Bacteria | 4947 |
| 79 | Ga0081455_10178190 | 3300005937 | Bacteria | 1612 |
| 80 | Ga0081455_10273290 | 3300005937 | Bacteria | 1224 |
| 81 | Ga0081538_10048294 | 3300005981 | Bacteria | 2597 |
| 82 | Ga0081540_1000300 | 3300005983 | Bacteria | 51023 |
| 83 | Ga0081539_10005758 | 3300005985 | Bacteria | 12368 |
| 84 | Ga0070717_10002581 | 3300006028 | Bacteria | 12784 |
| 85 | Ga0070717_10041261 | 3300006028 | Bacteria | 3762 |
| 86 | Ga0070717_10211816 | 3300006028 | Bacteria | 1701 |
| 87 | Ga0075365_10034678 | 3300006038 | Bacteria | 3260 |
| 88 | Ga0075365_10454875 | 3300006038 | Bacteria | 904 |
| 89 | Ga0075363_100021074 | 3300006048 | Bacteria | 3277 |
| 90 | Ga0075364_10006653 | 3300006051 | Bacteria | 6811 |
| 91 | Ga0075364_10079593 | 3300006051 | Bacteria | 2165 |
| 92 | Ga0070715_10000954 | 3300006163 | Bacteria | 8074 |
| 93 | Ga0070716_100007225 | 3300006173 | Bacteria | 5462 |
| 94 | Ga0070712_100000619 | 3300006175 | Bacteria | 20858 |
| 95 | Ga0070712_100007553 | 3300006175 | Bacteria | 6795 |
| 96 | Ga0075362_10017621 | 3300006177 | Bacteria | 2945 |
| 97 | Ga0075362_10113769 | 3300006177 | Bacteria | 1276 |
| 98 | Ga0075367_10219473 | 3300006178 | Bacteria | 1190 |
| 99 | Ga0075367_10232745 | 3300006178 | Bacteria | 1154 |
| 100 | Ga0075367_10305040 | 3300006178 | Bacteria | 1002 |
| 101 | Ga0075369_10130192 | 3300006186 | Bacteria | 1143 |
| 102 | Ga0075366_10080248 | 3300006195 | Bacteria | 1948 |
| 103 | Ga0097621_100070805 | 3300006237 | Bacteria | 2880 |
| 104 | Ga0097621_100174628 | 3300006237 | Bacteria | 1854 |
| 105 | Ga0068871_100007996 | 3300006358 | Bacteria | 7588 |
| 106 | Ga0075428_100249810 | 3300006844 | Bacteria | 1912 |
| 107 | Ga0075428_100410974 | 3300006844 | Bacteria | 1450 |
| 108 | Ga0075428_100436657 | 3300006844 | Bacteria | 1402 |
| 109 | Ga0075428_100539617 | 3300006844 | Bacteria | 1247 |
| 110 | Ga0075430_100102074 | 3300006846 | Bacteria | 2394 |
| 111 | Ga0075430_100594903 | 3300006846 | Bacteria | 913 |
| 112 | Ga0075431_100227138 | 3300006847 | Bacteria | 1903 |
| 113 | Ga0075434_100042069 | 3300006871 | Bacteria | 4529 |
| 114 | Ga0075434_100042444 | 3300006871 | Bacteria | 4509 |
| 115 | Ga0075434_100057530 | 3300006871 | Bacteria | 3864 |
| 116 | Ga0075434_100116947 | 3300006871 | Bacteria | 2679 |
| 117 | Ga0075434_100455985 | 3300006871 | Bacteria | 1300 |
| 118 | Ga0075429_100083869 | 3300006880 | Bacteria | 2777 |
| 119 | Ga0075429_100209297 | 3300006880 | Bacteria | 1709 |
| 120 | Ga0075429_100260893 | 3300006880 | Bacteria | 1517 |
| 121 | Ga0075429_100488389 | 3300006880 | Bacteria | 1079 |
| 122 | Ga0068865_100385279 | 3300006881 | Bacteria | 1144 |
| 123 | Ga0105240_11120164 | 3300009093 | Bacteria | 837 |
| 124 | Ga0111539_10051955 | 3300009094 | Bacteria | 4880 |
| 125 | Ga0111539_10116751 | 3300009094 | Bacteria | 3129 |
| 126 | Ga0111539_10226118 | 3300009094 | Bacteria | 2179 |
| 127 | Ga0111539_10248701 | 3300009094 | Bacteria | 2070 |
| 128 | Ga0111539_10595019 | 3300009094 | Bacteria | 1288 |
| 129 | Ga0105245_10001599 | 3300009098 | Bacteria | 20614 |
| 130 | Ga0105245_10017232 | 3300009098 | Bacteria | 6303 |
| 131 | Ga0105245_11125126 | 3300009098 | Bacteria | 832 |
| 132 | Ga0105247_10054671 | 3300009101 | Bacteria | 2463 |
| 133 | Ga0105247_10094897 | 3300009101 | Bacteria | 1899 |
| 134 | Ga0114129_10035882 | 3300009147 | Bacteria | 7002 |
| 135 | Ga0114129_10054275 | 3300009147 | Bacteria | 5619 |
| 136 | Ga0114129_10208397 | 3300009147 | Bacteria | 2644 |
| 137 | Ga0114129_10318044 | 3300009147 | Bacteria | 2070 |
| 138 | Ga0105243_10152895 | 3300009148 | Bacteria | 1981 |
| 139 | Ga0105248_10023331 | 3300009177 | Bacteria | 6873 |
| 140 | Ga0105248_10079118 | 3300009177 | Bacteria | 3695 |
| 141 | Ga0105248_10226870 | 3300009177 | Bacteria | 2102 |
| 142 | Ga0105237_10222358 | 3300009545 | Bacteria | 1888 |
| 143 | Ga0105237_10955188 | 3300009545 | Bacteria | 864 |
| 144 | Ga0105238_10043918 | 3300009551 | Bacteria | 4521 |
| 145 | Ga0105238_10184594 | 3300009551 | Bacteria | 2062 |
| 146 | Ga0105249_10311956 | 3300009553 | Bacteria | 1581 |
| 147 | Ga0105239_10298624 | 3300010375 | Bacteria | 1814 |
| 148 | Ga0105246_10108322 | 3300011119 | Bacteria | 2036 |
| 149 | Ga0105246_10143356 | 3300011119 | Bacteria | 1799 |
| 150 | Ga0157374_10576799 | 3300013296 | Bacteria | 1134 |
| 151 | Ga0157378_10104630 | 3300013297 | Bacteria | 2588 |
| 152 | Ga0163162_10127939 | 3300013306 | Bacteria | 2647 |
| 153 | Ga0163162_10759904 | 3300013306 | Bacteria | 1088 |
| 154 | Ga0157372_10048129 | 3300013307 | Bacteria | 4739 |
| 155 | Ga0157375_10595237 | 3300013308 | Bacteria | 1265 |
| 156 | Ga0163163_10188448 | 3300014325 | Bacteria | 2111 |
| 157 | Ga0163163_10515328 | 3300014325 | Bacteria | 1258 |
| 158 | Ga0163163_11063764 | 3300014325 | Bacteria | 872 |
| 159 | Ga0157380_10019393 | 3300014326 | Bacteria | 5068 |
| 160 | Ga0157380_10021927 | 3300014326 | Bacteria | 4797 |
| 161 | Ga0182008_10178073 | 3300014497 | Bacteria | 1075 |
| 162 | Ga0157377_10007242 | 3300014745 | Bacteria | 5345 |
| 163 | Ga0157377_10031555 | 3300014745 | Bacteria | 2880 |
| 164 | Ga0157377_10213779 | 3300014745 | Bacteria | 1231 |
| 165 | Ga0157379_10115757 | 3300014968 | Bacteria | 2410 |
| 166 | Ga0157379_10469559 | 3300014968 | Bacteria | 1163 |
| 167 | Ga0157376_10134039 | 3300014969 | Bacteria | 2214 |
| 168 | Ga0157376_10377250 | 3300014969 | Bacteria | 1365 |
| 169 | Ga0182007_10048195 | 3300015262 | Bacteria | 1408 |
| 170 | Ga0163161_10158664 | 3300017792 | Bacteria | 1724 |
| 171 | Ga0213876_10024133 | 3300021384 | Bacteria | 3210 |
| 172 | Ga0228598_1002137 | 3300024227 | Bacteria | 4324 |
| 173 | Ga0207697_10044697 | 3300025315 | Bacteria | 1823 |
| 174 | Ga0207682_10087917 | 3300025893 | Bacteria | 1343 |
| 175 | Ga0207692_10000204 | 3300025898 | Bacteria | 19862 |
| 176 | Ga0207642_10011875 | 3300025899 | Bacteria | 3124 |
| 177 | Ga0207710_10012249 | 3300025900 | Bacteria | 3608 |
| 178 | Ga0207710_10058788 | 3300025900 | Bacteria | 1739 |
| 179 | Ga0207688_10009396 | 3300025901 | Bacteria | 5325 |
| 180 | Ga0207688_10019425 | 3300025901 | Bacteria | 3702 |
| 181 | Ga0207688_10046525 | 3300025901 | Bacteria | 2423 |
| 182 | Ga0207688_10239960 | 3300025901 | Bacteria | 1096 |
| 183 | Ga0207680_10257731 | 3300025903 | Bacteria | 1206 |
| 184 | Ga0207680_10325105 | 3300025903 | Bacteria | 1076 |
| 185 | Ga0207647_10024868 | 3300025904 | Bacteria | 3944 |
| 186 | Ga0207685_10009407 | 3300025905 | Bacteria | 2838 |
| 187 | Ga0207645_10006619 | 3300025907 | Bacteria | 8284 |
| 188 | Ga0207643_10001834 | 3300025908 | Bacteria | 11774 |
| 189 | Ga0207643_10046631 | 3300025908 | Bacteria | 2450 |
| 190 | Ga0207643_10577077 | 3300025908 | Bacteria | 723 |
| 191 | Ga0207684_10435987 | 3300025910 | Bacteria | 1125 |
| 192 | Ga0207654_10032474 | 3300025911 | Bacteria | 2885 |
| 193 | Ga0207695_10368494 | 3300025913 | Bacteria | 1323 |
| 194 | Ga0207671_10154406 | 3300025914 | Bacteria | 1775 |
| 195 | Ga0207693_10010125 | 3300025915 | Bacteria | 7658 |
| 196 | Ga0207693_10025821 | 3300025915 | Bacteria | 4653 |
| 197 | Ga0207663_10000528 | 3300025916 | Bacteria | 16743 |
| 198 | Ga0207662_10002642 | 3300025918 | Bacteria | 9042 |
| 199 | Ga0207662_10032318 | 3300025918 | Bacteria | 3045 |
| 200 | Ga0207649_10191032 | 3300025920 | Bacteria | 1440 |
| 201 | Ga0207649_10345635 | 3300025920 | Bacteria | 1099 |
| 202 | Ga0207681_10108292 | 3300025923 | Bacteria | 2017 |
| 203 | Ga0207681_10115579 | 3300025923 | Bacteria | 1959 |
| 204 | Ga0207681_10223533 | 3300025923 | Bacteria | 1458 |
| 205 | Ga0207694_10036200 | 3300025924 | Bacteria | 3787 |
| 206 | Ga0207650_10012516 | 3300025925 | Bacteria | 5856 |
| 207 | Ga0207650_10133287 | 3300025925 | Bacteria | 1946 |
| 208 | Ga0207659_10005605 | 3300025926 | Bacteria | 7625 |
| 209 | Ga0207659_10434235 | 3300025926 | Bacteria | 1103 |
| 210 | Ga0207659_10518695 | 3300025926 | Bacteria | 1010 |
| 211 | Ga0207687_10055506 | 3300025927 | Bacteria | 2776 |
| 212 | Ga0207687_10191338 | 3300025927 | Bacteria | 1593 |
| 213 | Ga0207700_10214718 | 3300025928 | Bacteria | 1628 |
| 214 | Ga0207700_10551367 | 3300025928 | Bacteria | 1023 |
| 215 | Ga0207664_10001315 | 3300025929 | Bacteria | 16379 |
| 216 | Ga0207644_10028611 | 3300025931 | Bacteria | 3860 |
| 217 | Ga0207690_10194458 | 3300025932 | Bacteria | 1536 |
| 218 | Ga0207706_10008800 | 3300025933 | Bacteria | 9293 |
| 219 | Ga0207706_10394038 | 3300025933 | Bacteria | 1201 |
| 220 | Ga0207686_10183774 | 3300025934 | Bacteria | 1484 |
| 221 | Ga0207709_10009444 | 3300025935 | Bacteria | 5367 |
| 222 | Ga0207709_10422547 | 3300025935 | Bacteria | 1024 |
| 223 | Ga0207709_10797924 | 3300025935 | Bacteria | 762 |
| 224 | Ga0207670_10026014 | 3300025936 | Bacteria | 3683 |
| 225 | Ga0207669_10013794 | 3300025937 | Bacteria | 4029 |
| 226 | Ga0207669_10061202 | 3300025937 | Bacteria | 2312 |
| 227 | Ga0207691_10011401 | 3300025940 | Bacteria | 8532 |
| 228 | Ga0207691_10280124 | 3300025940 | Bacteria | 1435 |
| 229 | Ga0207691_10340284 | 3300025940 | Bacteria | 1284 |
| 230 | Ga0207711_10079300 | 3300025941 | Bacteria | 2866 |
| 231 | Ga0207711_10394621 | 3300025941 | Bacteria | 1285 |
| 232 | Ga0207711_10406384 | 3300025941 | Bacteria | 1265 |
| 233 | Ga0207689_10009322 | 3300025942 | Bacteria | 8484 |
| 234 | Ga0207689_10343978 | 3300025942 | Bacteria | 1239 |
| 235 | Ga0207651_10014393 | 3300025960 | Bacteria | 4565 |
| 236 | Ga0207651_10042126 | 3300025960 | Bacteria | 3036 |
| 237 | Ga0207712_10150926 | 3300025961 | Bacteria | 1795 |
| 238 | Ga0207712_10361329 | 3300025961 | Bacteria | 1210 |
| 239 | Ga0207658_10102588 | 3300025986 | Bacteria | 2244 |
| 240 | Ga0207677_10011951 | 3300026023 | Bacteria | 4971 |
| 241 | Ga0207677_10058079 | 3300026023 | Bacteria | 2662 |
| 242 | Ga0207677_10966858 | 3300026023 | Bacteria | 771 |
| 243 | Ga0207703_10188640 | 3300026035 | Bacteria | 1824 |
| 244 | Ga0207703_10227555 | 3300026035 | Bacteria | 1670 |
| 245 | Ga0207639_10160934 | 3300026041 | Bacteria | 1891 |
| 246 | Ga0207678_10071465 | 3300026067 | Bacteria | 2976 |
| 247 | Ga0207708_10004498 | 3300026075 | Bacteria | 10265 |
| 248 | Ga0207708_10148589 | 3300026075 | Bacteria | 1843 |
| 249 | Ga0207708_10155855 | 3300026075 | Bacteria | 1801 |
| 250 | Ga0207702_10108751 | 3300026078 | Bacteria | 2461 |
| 251 | Ga0207702_10156073 | 3300026078 | Bacteria | 2080 |
| 252 | Ga0207641_10028749 | 3300026088 | Bacteria | 4596 |
| 253 | Ga0207648_10003288 | 3300026089 | Bacteria | 16998 |
| 254 | Ga0207648_10909351 | 3300026089 | Bacteria | 822 |
| 255 | Ga0207676_10023920 | 3300026095 | Bacteria | 4514 |
| 256 | Ga0207676_10751632 | 3300026095 | Bacteria | 948 |
| 257 | Ga0207674_10543705 | 3300026116 | Bacteria | 1122 |
| 258 | Ga0207675_100007677 | 3300026118 | Bacteria | 10178 |
| 259 | Ga0207675_100467308 | 3300026118 | Bacteria | 1252 |
| 260 | Ga0207683_10013207 | 3300026121 | Bacteria | 7044 |
| 261 | Ga0207683_10046707 | 3300026121 | Bacteria | 3791 |
| 262 | Ga0207683_10303141 | 3300026121 | Bacteria | 1462 |
| 263 | Ga0207698_10015844 | 3300026142 | Bacteria | 5064 |
| 264 | Ga0268266_10807676 | 3300028379 | Bacteria | 906 |
| 265 | Ga0268265_10246934 | 3300028380 | Bacteria | 1578 |
| 266 | Ga0268264_10030844 | 3300028381 | Bacteria | 4395 |
| 267 | Ga0268264_10280727 | 3300028381 | Bacteria | 1560 |
| 268 | Ga0265332_10050577 | 3300031238 | Bacteria | 1786 |
| 269 | Ga0265328_10000010 | 3300031239 | Bacteria | 163171 |
| 270 | Ga0265328_10001421 | 3300031239 | Bacteria | 11015 |
| 271 | Ga0265328_10010923 | 3300031239 | Bacteria | 3643 |
| 272 | Ga0265325_10013504 | 3300031241 | Bacteria | 4649 |
| 273 | Ga0265331_10001102 | 3300031250 | Bacteria | 20789 |
| 274 | Ga0265327_10037535 | 3300031251 | Bacteria | 2651 |
| 275 | Ga0265316_10015406 | 3300031344 | Bacteria | 6685 |
| 276 | Ga0307408_100015997 | 3300031548 | Bacteria | 5002 |
| 277 | Ga0307408_100153245 | 3300031548 | Bacteria | 1822 |
| 278 | Ga0265313_10008643 | 3300031595 | Bacteria | 6735 |
| 279 | Ga0265313_10019389 | 3300031595 | Bacteria | 3786 |
| 280 | Ga0307413_10037346 | 3300031824 | Bacteria | 2805 |
| 281 | Ga0307407_10019982 | 3300031903 | Bacteria | 3421 |
| 282 | Ga0307412_10815399 | 3300031911 | Bacteria | 811 |
| 283 | Ga0307414_10045273 | 3300032004 | Bacteria | 3012 |
| 284 | Ga0307411_10015213 | 3300032005 | Bacteria | 4314 |
| 285 | Ga0307415_100043901 | 3300032126 | Bacteria | 2985 |
| 286 | Ga0373926_0051915 | 3300035083 | Bacteria | 1481 |
| 287 | Ga0373944_0082701 | 3300035089 | Bacteria | 1063 |
| 288 | Ga0373952_0066395 | 3300035092 | Bacteria | 893 |
| 289 | Ga0373939_0047508 | 3300035114 | Bacteria | 1319 |
| 290 | Ga0373945_0003434 | 3300035116 | Bacteria | 4985 |
| 291 | Ga0373957_0068494 | 3300035120 | Bacteria | 1384 |
| 292 | Ga0373943_0022910 | 3300035170 | Bacteria | 2899 |
| 293 | Ga0373955_0048835 | 3300035172 | Bacteria | 2296 |
| 294 | Ga0373935_0254805 | 3300035692 | Bacteria | 1229 |
| 295 | Ga0373927_0015276 | 3300035695 | Bacteria | 5071 |
| 296 | Ga0373927_0083737 | 3300035695 | Bacteria | 2068 |
| 297 | Ga0373933_0029565 | 3300035724 | Bacteria | 3169 |
| 298 | Ga0373947_0009074 | 3300035725 | Bacteria | 5715 |
| 299 | Ga0373947_0171219 | 3300035725 | Bacteria | 1409 |
| 300 | Ga0373937_0005630 | 3300036401 | Bacteria | 10756 |
| 301 | Ga0373937_0228568 | 3300036401 | Bacteria | 1752 |
| 302 | Ga0373925_0020794 | 3300037068 | Bacteria | 4782 |
| 303 | Ga0373925_0397790 | 3300037068 | Bacteria | 1123 |
| 304 | Ga0395905_0095778 | 3300037471 | Bacteria | 2786 |
| 305 | Ga0436365_0543732 | 3300039437 | Bacteria | 5982 |
| 306 | Ga0436361_0470625 | 3300039447 | Bacteria | 6493 |
| 307 | Ga0436363_1602549 | 3300039450 | Bacteria | 1646 |
| 308 | Ga0439436_0087425 | 3300041404 | Bacteria | 868 |
| 309 | Ga0439453_0006596 | 3300041408 | Bacteria | 1813 |
| 310 | Ga0439435_0061415 | 3300042436 | Bacteria | 1095 |
| 311 | Ga0439444_0034779 | 3300042437 | Bacteria | 963 |
| 312 | Ga0466972_0034934 | 3300044658 | Bacteria | 2461 |
| 313 | Ga0466957_0120407 | 3300044842 | Bacteria | 1673 |
| 314 | Ga0466960_0090078 | 3300044901 | Bacteria | 1562 |
| 315 | Ga0466967_0251666 | 3300045976 | Bacteria | 1688 |
| 316 | Ga0495617_036188 | 3300046452 | Bacteria | 1656 |
| 317 | Ga0495592_0186359 | 3300046454 | Bacteria | 1409 |
| 318 | Ga0495603_0001783 | 3300046455 | Bacteria | 12698 |
| 319 | Ga0495629_0121765 | 3300046459 | Bacteria | 1817 |
| 320 | Ga0495629_0442885 | 3300046459 | Bacteria | 880 |
| 321 | Ga0495638_0068869 | 3300046460 | Bacteria | 2169 |
| 322 | Ga0495651_0023009 | 3300046462 | Bacteria | 4846 |
| 323 | Ga0495653_0058010 | 3300046463 | Bacteria | 2943 |
| 324 | Ga0495662_0089057 | 3300046476 | Bacteria | 1504 |
| 325 | Ga0495664_0035719 | 3300046477 | Bacteria | 2928 |
| 326 | Ga0495584_0009408 | 3300046491 | Bacteria | 5034 |
| 327 | Ga0495584_0082128 | 3300046491 | Bacteria | 1622 |
| 328 | Ga0495608_0025664 | 3300046511 | Bacteria | 4023 |
| 329 | Ga0495608_0297476 | 3300046511 | Bacteria | 1000 |
| 330 | Ga0495616_0052819 | 3300046513 | Bacteria | 2022 |
| 331 | Ga0495630_0116502 | 3300046517 | Bacteria | 2025 |
| 332 | Ga0495630_0264793 | 3300046517 | Bacteria | 1313 |
| 333 | Ga0495663_0049330 | 3300046525 | Bacteria | 1300 |
| 334 | Ga0495652_0195579 | 3300046529 | Bacteria | 1539 |
| 335 | Ga0495640_0351445 | 3300046533 | Bacteria | 910 |
| 336 | Ga0495587_0105450 | 3300046536 | Bacteria | 1621 |
| 337 | Ga0495598_0187987 | 3300046537 | Bacteria | 740 |
| 338 | Ga0495621_0032015 | 3300046539 | Bacteria | 1807 |
| 339 | Ga0495633_0030278 | 3300046558 | Bacteria | 2630 |
| 340 | Ga0495667_0108618 | 3300046559 | Bacteria | 1792 |
| 341 | Ga0495656_0015253 | 3300046615 | Bacteria | 2898 |
| 342 | Ga0495668_0008338 | 3300046616 | Bacteria | 6489 |
| 343 | Ga0495668_0103220 | 3300046616 | Bacteria | 1560 |
| 344 | Ga0495668_0381688 | 3300046616 | Bacteria | 774 |
| 345 | Ga0495634_0007164 | 3300046642 | Bacteria | 8409 |
| 346 | Ga0495659_0018100 | 3300046664 | Bacteria | 2343 |
| 347 | Ga0495588_0040320 | 3300046674 | Bacteria | 2381 |
| 348 | Ga0495657_0071269 | 3300046675 | Bacteria | 2269 |
| 349 | Ga0495623_0014821 | 3300046679 | Bacteria | 5041 |
| 350 | Ga0495624_0191858 | 3300046690 | Bacteria | 1243 |
| 351 | Ga0495670_0181705 | 3300046691 | Bacteria | 1111 |
| 352 | Ga0495649_0053171 | 3300046694 | Bacteria | 2193 |
| 353 | Ga0495674_0096156 | 3300047319 | Bacteria | 2525 |
| 354 | Ga0495676_0027307 | 3300047321 | Bacteria | 4896 |
| 355 | Ga0495675_0018898 | 3300047444 | Bacteria | 4379 |
| 356 | Ga0495685_101630 | 3300047447 | Bacteria | 949 |
| 357 | Ga0495602_0115716 | 3300048088 | Bacteria | 2168 |
| 358 | Ga0496100_0005367 | 3300048903 | Bacteria | 6894 |
| 359 | Ga0496100_0079391 | 3300048903 | Bacteria | 2211 |
| 360 | Ga0496100_0166578 | 3300048903 | Bacteria | 1584 |
| 361 | Ga0496100_0306497 | 3300048903 | Bacteria | 1190 |
| 362 | Ga0496100_0548471 | 3300048903 | Bacteria | 894 |
| 363 | Ga0496101_0090868 | 3300048904 | Bacteria | 2271 |
| 364 | Ga0496101_0545705 | 3300048904 | Bacteria | 916 |
| 365 | Ga0496102_0009701 | 3300048905 | Bacteria | 8277 |
| 366 | Ga0496102_0022167 | 3300048905 | Bacteria | 5626 |
| 367 | Ga0496102_0231460 | 3300048905 | Bacteria | 1742 |
| 368 | Ga0496103_0006468 | 3300048906 | Bacteria | 6988 |
| 369 | Ga0496104_0000202 | 3300048907 | Bacteria | 53215 |
| 370 | Ga0496104_0000260 | 3300048907 | Bacteria | 46567 |
| 371 | Ga0496104_0004193 | 3300048907 | Bacteria | 12521 |
| 372 | Ga0496104_0008101 | 3300048907 | Bacteria | 9323 |
| 373 | Ga0496104_0103707 | 3300048907 | Bacteria | 2725 |
| 374 | Ga0496104_0131435 | 3300048907 | Bacteria | 2404 |
| 375 | Ga0496104_0298772 | 3300048907 | Bacteria | 1522 |
| 376 | Ga0496105_0000156 | 3300048908 | Bacteria | 45175 |
| 377 | Ga0496105_0019454 | 3300048908 | Bacteria | 5476 |
| 378 | Ga0496105_0019738 | 3300048908 | Bacteria | 5438 |
| 379 | Ga0496105_0064703 | 3300048908 | Bacteria | 3017 |
| 380 | Ga0496105_0069588 | 3300048908 | Bacteria | 2908 |
| 381 | Ga0496106_0011210 | 3300048909 | Bacteria | 6633 |
| 382 | Ga0496106_0693668 | 3300048909 | Bacteria | 812 |
| 383 | Ga0496107_0008161 | 3300048910 | Bacteria | 7241 |
| 384 | Ga0496107_0008292 | 3300048910 | Bacteria | 7187 |
| 385 | Ga0496107_0449831 | 3300048910 | Bacteria | 957 |
| 386 | Ga0496108_0025516 | 3300048911 | Bacteria | 4870 |
| 387 | Ga0496108_0045810 | 3300048911 | Bacteria | 3653 |
| 388 | Ga0496108_0112328 | 3300048911 | Bacteria | 2331 |
| 389 | Ga0496108_0159971 | 3300048911 | Bacteria | 1946 |
| 390 | Ga0496108_0261882 | 3300048911 | Bacteria | 1505 |
| 391 | Ga0496108_0336982 | 3300048911 | Bacteria | 1316 |
| 392 | Ga0496109_0004178 | 3300048912 | Bacteria | 12048 |
| 393 | Ga0496109_0022019 | 3300048912 | Bacteria | 5642 |
| 394 | Ga0496110_0006465 | 3300048913 | Bacteria | 9287 |
| 395 | Ga0496110_0024973 | 3300048913 | Bacteria | 5100 |
| 396 | Ga0496110_0125212 | 3300048913 | Bacteria | 2318 |
| 397 | Ga0496110_1062773 | 3300048913 | Bacteria | 717 |
| 398 | Ga0496111_0009761 | 3300048914 | Bacteria | 6415 |
| 399 | Ga0496111_0387450 | 3300048914 | Bacteria | 1033 |
| 400 | Ga0496112_0009866 | 3300048915 | Bacteria | 8630 |
| 401 | Ga0496112_0027080 | 3300048915 | Bacteria | 5525 |
| 402 | Ga0496112_0114276 | 3300048915 | Bacteria | 2670 |
| 403 | Ga0496112_0196854 | 3300048915 | Bacteria | 1975 |
| 404 | Ga0496112_0305132 | 3300048915 | Bacteria | 1537 |
| 405 | Ga0496113_0003007 | 3300048916 | Bacteria | 9986 |
| 406 | Ga0496113_0032019 | 3300048916 | Bacteria | 3819 |
| 407 | Ga0496113_0050663 | 3300048916 | Bacteria | 3096 |
| 408 | Ga0496114_0029645 | 3300048917 | Bacteria | 4499 |
| 409 | Ga0496114_0037317 | 3300048917 | Bacteria | 4018 |
| 410 | Ga0496115_0014453 | 3300048918 | Bacteria | 5975 |
| 411 | Ga0496115_0028132 | 3300048918 | Bacteria | 4403 |
| 412 | Ga0496115_0041793 | 3300048918 | Bacteria | 3650 |
| 413 | Ga0496115_0571159 | 3300048918 | Bacteria | 902 |
| 414 | Ga0496115_0625048 | 3300048918 | Bacteria | 854 |
| 415 | Ga0496117_0270032 | 3300048920 | Bacteria | 917 |
| 416 | Ga0496119_0002613 | 3300048922 | Bacteria | 19538 |
| 417 | Ga0496126_0226763 | 3300048929 | Bacteria | 1567 |
| 418 | Ga0501306_019225 | 3300049127 | Bacteria | 941 |
| 419 | Ga0501308_009456 | 3300049128 | Bacteria | 1065 |
| 420 | Ga0501309_030687 | 3300049129 | Bacteria | 792 |
| 421 | Ga0501310_018927 | 3300049130 | Bacteria | 844 |
| 422 | Ga0501304_014355 | 3300049160 | Bacteria | 733 |
| 423 | Ga0501305_012167 | 3300049161 | Bacteria | 1173 |
| 424 | Ga0501305_044024 | 3300049161 | Bacteria | 733 |
| 425 | Ga0501311_042001 | 3300049527 | Bacteria | 696 |
| 426 | Ga0501312_014540 | 3300049528 | Bacteria | 1107 |
| 427 | Ga0501313_017286 | 3300049529 | Bacteria | 871 |
| 428 | Ga0501316_008998 | 3300049532 | Bacteria | 1113 |
| 429 | Ga0501317_006992 | 3300049533 | Bacteria | 1260 |
| 430 | Ga0501318_009611 | 3300049534 | Bacteria | 1058 |
| 431 | Ga0501319_003502 | 3300049535 | Bacteria | 1053 |
| 432 | Ga0501321_013766 | 3300049537 | Bacteria | 933 |
| 433 | Ga0501323_013589 | 3300049539 | Bacteria | 1008 |
| 434 | Ga0501325_006804 | 3300049541 | Bacteria | 951 |
| 435 | Ga0501031_0056930 | 3300049568 | Bacteria | 2547 |
| 436 | Ga0501033_0126702 | 3300049570 | Bacteria | 1851 |
| 437 | Ga0501034_0337156 | 3300049571 | Bacteria | 1438 |
| 438 | Ga0501036_0109474 | 3300049572 | Bacteria | 2334 |
| 439 | Ga0501037_0284488 | 3300049573 | Bacteria | 1151 |
| 440 | Ga0501037_0526458 | 3300049573 | Bacteria | 800 |
| 441 | Ga0501038_0704851 | 3300049574 | Bacteria | 756 |
| 442 | Ga0501039_0300831 | 3300049575 | Bacteria | 1261 |
| 443 | Ga0501041_0138214 | 3300049577 | Bacteria | 1519 |
| 444 | Ga0501042_0020983 | 3300049578 | Bacteria | 4550 |
| 445 | Ga0501042_0130139 | 3300049578 | Bacteria | 1814 |
| 446 | Ga0501043_0134187 | 3300049579 | Bacteria | 1939 |
| 447 | Ga0501046_0407051 | 3300049580 | Bacteria | 982 |
| 448 | Ga0501068_0095967 | 3300049584 | Bacteria | 1834 |
| 449 | Ga0501070_0241834 | 3300049586 | Bacteria | 1477 |
| 450 | Ga0501071_0286963 | 3300049587 | Bacteria | 1246 |
| 451 | Ga0501072_0007397 | 3300049588 | Bacteria | 8330 |
| 452 | Ga0501072_0113716 | 3300049588 | Bacteria | 2155 |
| 453 | Ga0501072_0322428 | 3300049588 | Bacteria | 1228 |
| 454 | Ga0501074_0092562 | 3300049590 | Bacteria | 2165 |
| 455 | Ga0501075_0021403 | 3300049591 | Bacteria | 4714 |
| 456 | Ga0501075_0123881 | 3300049591 | Bacteria | 1967 |
| 457 | Ga0501075_0157732 | 3300049591 | Bacteria | 1731 |
| 458 | Ga0501076_0019223 | 3300049592 | Bacteria | 5219 |
| 459 | Ga0501076_0519921 | 3300049592 | Bacteria | 981 |
| 460 | Ga0501077_0007343 | 3300049593 | Bacteria | 6796 |
| 461 | Ga0501238_036606 | 3300049671 | Bacteria | 716 |
| 462 | Ga0501079_0036769 | 3300049741 | Bacteria | 3771 |
| 463 | Ga0501080_0383040 | 3300049742 | Bacteria | 1267 |
| 464 | Ga0501081_0061691 | 3300049743 | Bacteria | 2600 |
| 465 | Ga0501035_0043892 | 3300049822 | Bacteria | 4028 |
| 466 | Ga0501044_0031635 | 3300049823 | Bacteria | 5568 |
| 467 | Ga0501044_0240457 | 3300049823 | Bacteria | 1754 |
| 468 | Ga0501045_0033442 | 3300049824 | Bacteria | 3728 |
| 469 | nmdc:mga03683_153026_c1 | 3300050489 | Bacteria | 1041 |
| 470 | nmdc:mga03683_15601_c1 | 3300050489 | Bacteria | 2837 |
| 471 | nmdc:mga03683_17189_c1 | 3300050489 | Bacteria | 2734 |
| 472 | nmdc:mga03n38_23275_c1 | 3300050490 | Bacteria | 2517 |
| 473 | nmdc:mga03n38_68206_c1 | 3300050490 | Bacteria | 1639 |
| 474 | nmdc:mga00v17_6824_c1 | 3300050491 | Bacteria | 6066 |
| 475 | nmdc:mga0yw44_108607_c1 | 3300050492 | Bacteria | 1776 |
| 476 | nmdc:mga0yw44_195186_c1 | 3300050492 | Bacteria | 1336 |
| 477 | nmdc:mga0yw44_19950_c1 | 3300050492 | Bacteria | 3709 |
| 478 | nmdc:mga0yw44_500568_c1 | 3300050492 | Bacteria | 824 |
| 479 | nmdc:mga0yw44_57532_c1 | 3300050492 | Bacteria | 2372 |
| 480 | nmdc:mga0yw44_63467_c1 | 3300050492 | Bacteria | 2271 |
| 481 | nmdc:mga0yw44_98050_c1 | 3300050492 | Bacteria | 1863 |
| 482 | nmdc:mga0k408_84697_c1 | 3300050493 | Bacteria | 1860 |
| 483 | nmdc:mga06z11_247362_c1 | 3300050494 | Bacteria | 1049 |
| 484 | nmdc:mga05p37_120409_c1 | 3300050507 | Bacteria | 3225 |
| 485 | nmdc:mga05p37_13259_c1 | 3300050507 | Bacteria | 9868 |
| 486 | nmdc:mga05p37_20387_c1 | 3300050507 | Bacteria | 8019 |
| 487 | nmdc:mga05p37_31741_c1 | 3300050507 | Bacteria | 6456 |
| 488 | nmdc:mga05p37_715444_c1 | 3300050507 | Bacteria | 1110 |
| 489 | nmdc:mga05p37_9157_c1 | 3300050507 | Bacteria | 11705 |
| 490 | nmdc:mga09592_232594_c1 | 3300050508 | Bacteria | 1597 |
| 491 | nmdc:mga09592_461865_c1 | 3300050508 | Bacteria | 1095 |
| 492 | nmdc:mga0qj67_260114_c1 | 3300050509 | Bacteria | 1408 |
| 493 | nmdc:mga06r32_119899_c1 | 3300050510 | Bacteria | 2594 |
| 494 | nmdc:mga06r32_157496_c1 | 3300050510 | Bacteria | 2253 |
| 495 | nmdc:mga06r32_164036_c1 | 3300050510 | Bacteria | 2205 |
| 496 | nmdc:mga06r32_232609_c1 | 3300050510 | Bacteria | 1831 |
| 497 | nmdc:mga06r32_287975_c1 | 3300050510 | Bacteria | 1629 |
| 498 | nmdc:mga08y16_18532_c1 | 3300050511 | Bacteria | 7333 |
| 499 | nmdc:mga08y16_20827_c1 | 3300050511 | Bacteria | 6922 |
| 500 | nmdc:mga08y16_316432_c1 | 3300050511 | Bacteria | 1607 |
| 501 | nmdc:mga08y16_841610_c1 | 3300050511 | Bacteria | 907 |
| 502 | nmdc:mga0n895_14122_c1 | 3300050512 | Bacteria | 7240 |
| 503 | nmdc:mga0n895_19141_c1 | 3300050512 | Bacteria | 6356 |
| 504 | nmdc:mga0n895_78686_c1 | 3300050512 | Bacteria | 3282 |
| 505 | Ga0495601_0228465 | 3300053077 | Bacteria | 1215 |
| 506 | Ga0495601_0664244 | 3300053077 | Unclassified | 666 |
| 507 | Ga0495655_0027974 | 3300053083 | Bacteria | 1342 |
| 508 | Ga0495655_0034819 | 3300053083 | Bacteria | 1248 |
| 509 | Ga0495595_0103548 | 3300053084 | Bacteria | 1375 |
| 510 | Ga0495595_0109410 | 3300053084 | Bacteria | 1339 |
| 511 | Ga0495595_0225482 | 3300053084 | Bacteria | 935 |
| 512 | Ga0495619_0054783 | 3300053085 | Bacteria | 2640 |
| 513 | Ga0495619_0102761 | 3300053085 | Bacteria | 1946 |
| 514 | Ga0495619_0469837 | 3300053085 | Bacteria | 866 |
| 515 | Ga0500568_0031574 | 3300053139 | Bacteria | 2184 |
| 516 | Ga0501084_0037282 | 3300054114 | Bacteria | 4061 |
| 517 | Ga0501084_0147018 | 3300054114 | Bacteria | 1985 |
| 518 | Ga0501084_0660095 | 3300054114 | Bacteria | 883 |
| 519 | Ga0501082_0000285 | 3300060353 | Bacteria | 44550 |
| 520 | Ga0501082_0082196 | 3300060353 | Bacteria | 2779 |
| 521 | Ga0501082_0333473 | 3300060353 | Bacteria | 1322 |
| 522 | Ga0530510_0176182 | 3300061734 | Bacteria | 1585 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046511 | Ga0495608_0297476 | Ga0495608_0297476_341_973 | 169 |
| 2 | 3300048911 | Ga0496108_0045810 | Ga0496108_0045810_21_653 | 169 |
| 3 | 3300048915 | Ga0496112_0009866 | Ga0496112_0009866_7978_8610 | 169 |
| 4 | 3300050510 | nmdc:mga06r32_287975_c1 | nmdc:mga06r32_287975_c1_949_1593 | 169 |
| 5 | 3300053077 | Ga0495601_0664244 | Ga0495601_0664244_16_654 | 172 |
| 6 | 3300006038 | Ga0075365_10034678 | Ga0075365_100346784 | 181 |
| 7 | 3300050492 | nmdc:mga0yw44_63467_c1 | nmdc:mga0yw44_63467_c1_445_1179 | 181 |
| 8 | 3300048920 | Ga0496117_0270032 | Ga0496117_0270032_314_895 | 184 |
| 9 | 3300044842 | Ga0466957_0120407 | Ga0466957_0120407_835_1482 | 185 |
| 10 | 3300049573 | Ga0501037_0526458 | Ga0501037_0526458_59_727 | 185 |
| 11 | 3300049578 | Ga0501042_0020983 | Ga0501042_0020983_2208_2987 | 185 |
| 12 | 3300049591 | Ga0501075_0021403 | Ga0501075_0021403_1817_2596 | 185 |
| 13 | 3300049824 | Ga0501045_0033442 | Ga0501045_0033442_732_1511 | 185 |
| 14 | 3300049541 | Ga0501325_006804 | Ga0501325_006804_286_864 | 186 |
| 15 | 3300049568 | Ga0501031_0056930 | Ga0501031_0056930_83_823 | 187 |
| 16 | 3300049570 | Ga0501033_0126702 | Ga0501033_0126702_539_1279 | 187 |
| 17 | 3300049571 | Ga0501034_0337156 | Ga0501034_0337156_512_1252 | 187 |
| 18 | 3300049573 | Ga0501037_0284488 | Ga0501037_0284488_33_773 | 187 |
| 19 | 3300049575 | Ga0501039_0300831 | Ga0501039_0300831_290_1030 | 187 |
| 20 | 3300049580 | Ga0501046_0407051 | Ga0501046_0407051_91_831 | 187 |
| 21 | 3300049586 | Ga0501070_0241834 | Ga0501070_0241834_418_1158 | 187 |
| 22 | 3300049822 | Ga0501035_0043892 | Ga0501035_0043892_209_949 | 187 |
| 23 | 3300049823 | Ga0501044_0240457 | Ga0501044_0240457_569_1309 | 187 |
| 24 | 3300050493 | nmdc:mga0k408_84697_c1 | nmdc:mga0k408_84697_c1_299_1024 | 188 |
| 25 | 3300031239 | Ga0265328_10010923 | Ga0265328_100109235 | 189 |
| 26 | 3300031250 | Ga0265331_10001102 | Ga0265331_1000110210 | 189 |
| 27 | 3300031251 | Ga0265327_10037535 | Ga0265327_100375352 | 189 |
| 28 | 3300031344 | Ga0265316_10015406 | Ga0265316_100154065 | 189 |
| 29 | 3300046459 | Ga0495629_0442885 | Ga0495629_0442885_85_756 | 189 |
| 30 | 3300046533 | Ga0495640_0351445 | Ga0495640_0351445_138_809 | 189 |
| 31 | 3300048907 | Ga0496104_0000260 | Ga0496104_0000260_16986_17624 | 189 |
| 32 | 3300048907 | Ga0496104_0004193 | Ga0496104_0004193_11198_11836 | 189 |
| 33 | 3300048908 | Ga0496105_0000156 | Ga0496105_0000156_27552_28190 | 189 |
| 34 | 3300048908 | Ga0496105_0064703 | Ga0496105_0064703_2107_2745 | 189 |
| 35 | 3300048911 | Ga0496108_0159971 | Ga0496108_0159971_1020_1658 | 189 |
| 36 | 3300048913 | Ga0496110_0125212 | Ga0496110_0125212_339_977 | 189 |
| 37 | 3300048915 | Ga0496112_0196854 | Ga0496112_0196854_422_1060 | 189 |
| 38 | 3300048916 | Ga0496113_0050663 | Ga0496113_0050663_784_1422 | 189 |
| 39 | 3300048917 | Ga0496114_0037317 | Ga0496114_0037317_783_1421 | 189 |
| 40 | 3300048918 | Ga0496115_0028132 | Ga0496115_0028132_1274_1912 | 189 |
| 41 | 3300048922 | Ga0496119_0002613 | Ga0496119_0002613_1323_1961 | 189 |
| 42 | 3300005981 | Ga0081538_10048294 | Ga0081538_100482941 | 190 |
| 43 | 3300006048 | Ga0075363_100021074 | Ga0075363_1000210744 | 190 |
| 44 | 3300006178 | Ga0075367_10232745 | Ga0075367_102327452 | 190 |
| 45 | 3300013306 | Ga0163162_10759904 | Ga0163162_107599042 | 190 |
| 46 | 3300031239 | Ga0265328_10000010 | Ga0265328_1000001062 | 190 |
| 47 | 3300035692 | Ga0373935_0254805 | Ga0373935_0254805_286_999 | 190 |
| 48 | 3300036401 | Ga0373937_0005630 | Ga0373937_0005630_3541_4254 | 190 |
| 49 | 3300049532 | Ga0501316_008998 | Ga0501316_008998_513_1103 | 190 |
| 50 | 3300049537 | Ga0501321_013766 | Ga0501321_013766_333_923 | 190 |
| 51 | 3300050490 | nmdc:mga03n38_23275_c1 | nmdc:mga03n38_23275_c1_1590_2312 | 190 |
| 52 | 3300050494 | nmdc:mga06z11_247362_c1 | nmdc:mga06z11_247362_c1_110_832 | 190 |
| 53 | 3300031239 | Ga0265328_10001421 | Ga0265328_100014215 | 191 |
| 54 | 3300009093 | Ga0105240_11120164 | Ga0105240_111201641 | 192 |
| 55 | 3300013307 | Ga0157372_10048129 | Ga0157372_100481295 | 192 |
| 56 | 3300025924 | Ga0207694_10036200 | Ga0207694_100362006 | 192 |
| 57 | 3300049574 | Ga0501038_0704851 | Ga0501038_0704851_33_746 | 192 |
| 58 | 3300010375 | Ga0105239_10298624 | Ga0105239_102986243 | 193 |
| 59 | 3300035120 | Ga0373957_0068494 | Ga0373957_0068494_49_765 | 193 |
| 60 | 3300048918 | Ga0496115_0571159 | Ga0496115_0571159_16_735 | 193 |
| 61 | 3300005840 | Ga0068870_10408053 | Ga0068870_104080531 | 194 |
| 62 | 3300006871 | Ga0075434_100057530 | Ga0075434_1000575305 | 194 |
| 63 | 3300009094 | Ga0111539_10116751 | Ga0111539_101167514 | 194 |
| 64 | 3300025933 | Ga0207706_10394038 | Ga0207706_103940382 | 194 |
| 65 | 3300025940 | Ga0207691_10340284 | Ga0207691_103402842 | 194 |
| 66 | 3300026075 | Ga0207708_10148589 | Ga0207708_101485892 | 194 |
| 67 | 3300026121 | Ga0207683_10303141 | Ga0207683_103031412 | 194 |
| 68 | 3300046537 | Ga0495598_0187987 | Ga0495598_0187987_39_662 | 194 |
| 69 | 3300050512 | nmdc:mga0n895_78686_c1 | nmdc:mga0n895_78686_c1_1192_1965 | 194 |
| 70 | 3300006186 | Ga0075369_10130192 | Ga0075369_101301921 | 195 |
| 71 | 3300009545 | Ga0105237_10955188 | Ga0105237_109551881 | 195 |
| 72 | 3300025913 | Ga0207695_10368494 | Ga0207695_103684941 | 195 |
| 73 | 3300025914 | Ga0207671_10154406 | Ga0207671_101544061 | 195 |
| 74 | 3300039450 | Ga0436363_1602549 | Ga0436363_1602549_624_1397 | 195 |
| 75 | 3300048929 | Ga0496126_0226763 | Ga0496126_0226763_833_1468 | 195 |
| 76 | iso_pu_bacteria | 2508501114 | 2509077589 | 195 |
| 77 | iso_pu_bacteria | 2773857925 | 2774870405 | 195 |
| 78 | iso_pu_bacteria | 2775506901 | 2776258569 | 195 |
| 79 | iso_pu_bacteria | 2835312727 | 2835315197 | 195 |
| 80 | iso_pu_bacteria | 2882456835 | 2882460541 | 195 |
| 81 | iso_pu_bacteria | 2884298095 | 2884301005 | 195 |
| 82 | iso_pu_bacteria | 2894232714 | 2894233848 | 195 |
| 83 | 3300005435 | Ga0070714_100007212 | Ga0070714_1000072128 | 196 |
| 84 | 3300005436 | Ga0070713_100000796 | Ga0070713_10000079615 | 196 |
| 85 | 3300005437 | Ga0070710_10006756 | Ga0070710_100067561 | 196 |
| 86 | 3300005439 | Ga0070711_100005690 | Ga0070711_1000056907 | 196 |
| 87 | 3300005937 | Ga0081455_10007086 | Ga0081455_100070865 | 196 |
| 88 | 3300006028 | Ga0070717_10002581 | Ga0070717_1000258114 | 196 |
| 89 | 3300006163 | Ga0070715_10000954 | Ga0070715_1000095412 | 196 |
| 90 | 3300006173 | Ga0070716_100007225 | Ga0070716_1000072258 | 196 |
| 91 | 3300006175 | Ga0070712_100007553 | Ga0070712_1000075537 | 196 |
| 92 | 3300006844 | Ga0075428_100249810 | Ga0075428_1002498103 | 196 |
| 93 | 3300006844 | Ga0075428_100539617 | Ga0075428_1005396171 | 196 |
| 94 | 3300006871 | Ga0075434_100455985 | Ga0075434_1004559852 | 196 |
| 95 | 3300006880 | Ga0075429_100209297 | Ga0075429_1002092972 | 196 |
| 96 | 3300006880 | Ga0075429_100260893 | Ga0075429_1002608931 | 196 |
| 97 | 3300021384 | Ga0213876_10024133 | Ga0213876_100241334 | 196 |
| 98 | 3300025898 | Ga0207692_10000204 | Ga0207692_1000020413 | 196 |
| 99 | 3300025916 | Ga0207663_10000528 | Ga0207663_1000052812 | 196 |
| 100 | 3300025928 | Ga0207700_10551367 | Ga0207700_105513671 | 196 |
| 101 | 3300025929 | Ga0207664_10001315 | Ga0207664_1000131515 | 196 |
| 102 | 3300031548 | Ga0307408_100153245 | Ga0307408_1001532452 | 196 |
| 103 | 3300031911 | Ga0307412_10815399 | Ga0307412_108153991 | 196 |
| 104 | 3300039437 | Ga0436365_0543732 | Ga0436365_0543732_3640_4365 | 196 |
| 105 | 3300039447 | Ga0436361_0470625 | Ga0436361_0470625_4315_4998 | 196 |
| 106 | 3300046616 | Ga0495668_0008338 | Ga0495668_0008338_2320_2976 | 196 |
| 107 | 3300048903 | Ga0496100_0166578 | Ga0496100_0166578_540_1313 | 196 |
| 108 | 3300049539 | Ga0501323_013589 | Ga0501323_013589_334_942 | 196 |
| 109 | 3300050508 | nmdc:mga09592_232594_c1 | nmdc:mga09592_232594_c1_161_901 | 196 |
| 110 | 3300050510 | nmdc:mga06r32_119899_c1 | nmdc:mga06r32_119899_c1_400_1134 | 196 |
| 111 | iso_pu_bacteria | 2508501050 | 2508730570 | 196 |
| 112 | iso_pu_bacteria | 2545555834 | 2545677858 | 196 |
| 113 | iso_pu_bacteria | 3003665799 | 3003666752 | 196 |
| 114 | iso_pu_bacteria | 641522639 | 641642616 | 196 |
| 115 | iso_pu_bacteria | 643348564 | 643600527 | 196 |
| 116 | iso_pu_bacteria | 8002060224 | 8002060295 | 196 |
| 117 | 3300006051 | Ga0075364_10006653 | Ga0075364_100066534 | 197 |
| 118 | 3300006177 | Ga0075362_10017621 | Ga0075362_100176213 | 197 |
| 119 | 3300006195 | Ga0075366_10080248 | Ga0075366_100802483 | 197 |
| 120 | 3300006844 | Ga0075428_100410974 | Ga0075428_1004109742 | 197 |
| 121 | 3300006880 | Ga0075429_100488389 | Ga0075429_1004883891 | 197 |
| 122 | 3300009147 | Ga0114129_10318044 | Ga0114129_103180443 | 197 |
| 123 | 3300036401 | Ga0373937_0228568 | Ga0373937_0228568_784_1536 | 197 |
| 124 | 3300037471 | Ga0395905_0095778 | Ga0395905_0095778_117_731 | 197 |
| 125 | 3300044658 | Ga0466972_0034934 | Ga0466972_0034934_1090_1695 | 197 |
| 126 | 3300046642 | Ga0495634_0007164 | Ga0495634_0007164_3785_4537 | 197 |
| 127 | 3300049588 | Ga0501072_0007397 | Ga0501072_0007397_1584_2306 | 197 |
| 128 | 3300050489 | nmdc:mga03683_17189_c1 | nmdc:mga03683_17189_c1_810_1523 | 197 |
| 129 | 3300050490 | nmdc:mga03n38_68206_c1 | nmdc:mga03n38_68206_c1_775_1488 | 197 |
| 130 | 3300050491 | nmdc:mga00v17_6824_c1 | nmdc:mga00v17_6824_c1_4177_4890 | 197 |
| 131 | 3300050507 | nmdc:mga05p37_31741_c1 | nmdc:mga05p37_31741_c1_4482_5264 | 197 |
| 132 | 3300050508 | nmdc:mga09592_461865_c1 | nmdc:mga09592_461865_c1_72_854 | 197 |
| 133 | 3300054114 | Ga0501084_0037282 | Ga0501084_0037282_2669_3391 | 197 |
| 134 | 3300005336 | Ga0070680_100483928 | Ga0070680_1004839282 | 198 |
| 135 | 3300005338 | Ga0068868_100196884 | Ga0068868_1001968843 | 198 |
| 136 | 3300005347 | Ga0070668_100112002 | Ga0070668_1001120022 | 198 |
| 137 | 3300005355 | Ga0070671_100000672 | Ga0070671_1000006725 | 198 |
| 138 | 3300005364 | Ga0070673_100003747 | Ga0070673_1000037479 | 198 |
| 139 | 3300005365 | Ga0070688_100117511 | Ga0070688_1001175113 | 198 |
| 140 | 3300005366 | Ga0070659_100416125 | Ga0070659_1004161251 | 198 |
| 141 | 3300005367 | Ga0070667_100165167 | Ga0070667_1001651673 | 198 |
| 142 | 3300005435 | Ga0070714_100049173 | Ga0070714_1000491731 | 198 |
| 143 | 3300005544 | Ga0070686_100252960 | Ga0070686_1002529602 | 198 |
| 144 | 3300005548 | Ga0070665_100293292 | Ga0070665_1002932922 | 198 |
| 145 | 3300005548 | Ga0070665_100508889 | Ga0070665_1005088892 | 198 |
| 146 | 3300005564 | Ga0070664_100074547 | Ga0070664_1000745473 | 198 |
| 147 | 3300005618 | Ga0068864_100050382 | Ga0068864_1000503824 | 198 |
| 148 | 3300005841 | Ga0068863_100655177 | Ga0068863_1006551772 | 198 |
| 149 | 3300005983 | Ga0081540_1000300 | Ga0081540_100030027 | 198 |
| 150 | 3300005985 | Ga0081539_10005758 | Ga0081539_100057588 | 198 |
| 151 | 3300006028 | Ga0070717_10041261 | Ga0070717_100412613 | 198 |
| 152 | 3300006237 | Ga0097621_100174628 | Ga0097621_1001746282 | 198 |
| 153 | 3300009098 | Ga0105245_10001599 | Ga0105245_1000159917 | 198 |
| 154 | 3300009101 | Ga0105247_10054671 | Ga0105247_100546713 | 198 |
| 155 | 3300009177 | Ga0105248_10023331 | Ga0105248_100233318 | 198 |
| 156 | 3300009177 | Ga0105248_10226870 | Ga0105248_102268703 | 198 |
| 157 | 3300009551 | Ga0105238_10043918 | Ga0105238_100439182 | 198 |
| 158 | 3300009551 | Ga0105238_10184594 | Ga0105238_101845942 | 198 |
| 159 | 3300011119 | Ga0105246_10108322 | Ga0105246_101083223 | 198 |
| 160 | 3300013306 | Ga0163162_10127939 | Ga0163162_101279393 | 198 |
| 161 | 3300014325 | Ga0163163_11063764 | Ga0163163_110637641 | 198 |
| 162 | 3300014497 | Ga0182008_10178073 | Ga0182008_101780731 | 198 |
| 163 | 3300014745 | Ga0157377_10213779 | Ga0157377_102137792 | 198 |
| 164 | 3300015262 | Ga0182007_10048195 | Ga0182007_100481951 | 198 |
| 165 | 3300025315 | Ga0207697_10044697 | Ga0207697_100446972 | 198 |
| 166 | 3300025900 | Ga0207710_10058788 | Ga0207710_100587883 | 198 |
| 167 | 3300025903 | Ga0207680_10325105 | Ga0207680_103251051 | 198 |
| 168 | 3300025908 | Ga0207643_10046631 | Ga0207643_100466314 | 198 |
| 169 | 3300025918 | Ga0207662_10032318 | Ga0207662_100323184 | 198 |
| 170 | 3300025923 | Ga0207681_10223533 | Ga0207681_102235331 | 198 |
| 171 | 3300025937 | Ga0207669_10061202 | Ga0207669_100612022 | 198 |
| 172 | 3300025941 | Ga0207711_10079300 | Ga0207711_100793003 | 198 |
| 173 | 3300025941 | Ga0207711_10394621 | Ga0207711_103946211 | 198 |
| 174 | 3300025960 | Ga0207651_10014393 | Ga0207651_100143934 | 198 |
| 175 | 3300025986 | Ga0207658_10102588 | Ga0207658_101025882 | 198 |
| 176 | 3300026023 | Ga0207677_10058079 | Ga0207677_100580793 | 198 |
| 177 | 3300026023 | Ga0207677_10966858 | Ga0207677_109668581 | 198 |
| 178 | 3300026035 | Ga0207703_10227555 | Ga0207703_102275552 | 198 |
| 179 | 3300026118 | Ga0207675_100467308 | Ga0207675_1004673082 | 198 |
| 180 | 3300026121 | Ga0207683_10046707 | Ga0207683_100467072 | 198 |
| 181 | 3300028379 | Ga0268266_10807676 | Ga0268266_108076761 | 198 |
| 182 | 3300028381 | Ga0268264_10280727 | Ga0268264_102807272 | 198 |
| 183 | 3300031238 | Ga0265332_10050577 | Ga0265332_100505772 | 198 |
| 184 | 3300031595 | Ga0265313_10008643 | Ga0265313_100086432 | 198 |
| 185 | 3300045976 | Ga0466967_0251666 | Ga0466967_0251666_746_1366 | 198 |
| 186 | 3300046460 | Ga0495638_0068869 | Ga0495638_0068869_352_1050 | 198 |
| 187 | 3300048905 | Ga0496102_0231460 | Ga0496102_0231460_69_806 | 198 |
| 188 | 3300048907 | Ga0496104_0000202 | Ga0496104_0000202_21478_22215 | 198 |
| 189 | 3300048907 | Ga0496104_0103707 | Ga0496104_0103707_28_765 | 198 |
| 190 | 3300048908 | Ga0496105_0019738 | Ga0496105_0019738_2053_2790 | 198 |
| 191 | 3300048910 | Ga0496107_0449831 | Ga0496107_0449831_62_799 | 198 |
| 192 | 3300048911 | Ga0496108_0112328 | Ga0496108_0112328_1269_2009 | 198 |
| 193 | 3300048911 | Ga0496108_0261882 | Ga0496108_0261882_569_1306 | 198 |
| 194 | 3300048913 | Ga0496110_1062773 | Ga0496110_1062773_53_673 | 198 |
| 195 | 3300048914 | Ga0496111_0387450 | Ga0496111_0387450_151_888 | 198 |
| 196 | 3300048915 | Ga0496112_0114276 | Ga0496112_0114276_1914_2651 | 198 |
| 197 | 3300048915 | Ga0496112_0305132 | Ga0496112_0305132_160_900 | 198 |
| 198 | 3300048918 | Ga0496115_0041793 | Ga0496115_0041793_971_1708 | 198 |
| 199 | 3300048918 | Ga0496115_0625048 | Ga0496115_0625048_55_792 | 198 |
| 200 | 3300049588 | Ga0501072_0113716 | Ga0501072_0113716_1262_1993 | 198 |
| 201 | 3300049743 | Ga0501081_0061691 | Ga0501081_0061691_188_919 | 198 |
| 202 | 3300050511 | nmdc:mga08y16_841610_c1 | nmdc:mga08y16_841610_c1_152_769 | 198 |
| 203 | 3300053139 | Ga0500568_0031574 | Ga0500568_0031574_599_1321 | 198 |
| 204 | 3300060353 | Ga0501082_0000285 | Ga0501082_0000285_4888_5610 | 198 |
| 205 | 3300003162 | Ga0006778J45830_1079432 | Ga0006778J45830_10794321 | 199 |
| 206 | 3300003579 | Ga0007429J51699_1076873 | Ga0007429J51699_10768731 | 199 |
| 207 | 3300005330 | Ga0070690_100108953 | Ga0070690_1001089532 | 199 |
| 208 | 3300005340 | Ga0070689_100156434 | Ga0070689_1001564342 | 199 |
| 209 | 3300005347 | Ga0070668_100240052 | Ga0070668_1002400521 | 199 |
| 210 | 3300005347 | Ga0070668_100515784 | Ga0070668_1005157841 | 199 |
| 211 | 3300005353 | Ga0070669_100200275 | Ga0070669_1002002751 | 199 |
| 212 | 3300005354 | Ga0070675_100341870 | Ga0070675_1003418701 | 199 |
| 213 | 3300005441 | Ga0070700_100072426 | Ga0070700_1000724262 | 199 |
| 214 | 3300005441 | Ga0070700_100249225 | Ga0070700_1002492252 | 199 |
| 215 | 3300005615 | Ga0070702_101043443 | Ga0070702_1010434431 | 199 |
| 216 | 3300005618 | Ga0068864_100222281 | Ga0068864_1002222813 | 199 |
| 217 | 3300005719 | Ga0068861_100278121 | Ga0068861_1002781212 | 199 |
| 218 | 3300005841 | Ga0068863_100502034 | Ga0068863_1005020342 | 199 |
| 219 | 3300005842 | Ga0068858_101188587 | Ga0068858_1011885871 | 199 |
| 220 | 3300005937 | Ga0081455_10030017 | Ga0081455_100300173 | 199 |
| 221 | 3300005937 | Ga0081455_10178190 | Ga0081455_101781902 | 199 |
| 222 | 3300005937 | Ga0081455_10273290 | Ga0081455_102732901 | 199 |
| 223 | 3300006038 | Ga0075365_10454875 | Ga0075365_104548751 | 199 |
| 224 | 3300006051 | Ga0075364_10079593 | Ga0075364_100795933 | 199 |
| 225 | 3300006175 | Ga0070712_100000619 | Ga0070712_10000061911 | 199 |
| 226 | 3300006177 | Ga0075362_10113769 | Ga0075362_101137692 | 199 |
| 227 | 3300006844 | Ga0075428_100436657 | Ga0075428_1004366572 | 199 |
| 228 | 3300006846 | Ga0075430_100102074 | Ga0075430_1001020742 | 199 |
| 229 | 3300006846 | Ga0075430_100594903 | Ga0075430_1005949031 | 199 |
| 230 | 3300006880 | Ga0075429_100083869 | Ga0075429_1000838693 | 199 |
| 231 | 3300009094 | Ga0111539_10226118 | Ga0111539_102261182 | 199 |
| 232 | 3300009094 | Ga0111539_10248701 | Ga0111539_102487014 | 199 |
| 233 | 3300009094 | Ga0111539_10595019 | Ga0111539_105950192 | 199 |
| 234 | 3300009098 | Ga0105245_11125126 | Ga0105245_111251261 | 199 |
| 235 | 3300009147 | Ga0114129_10208397 | Ga0114129_102083973 | 199 |
| 236 | 3300009148 | Ga0105243_10152895 | Ga0105243_101528953 | 199 |
| 237 | 3300009553 | Ga0105249_10311956 | Ga0105249_103119562 | 199 |
| 238 | 3300011119 | Ga0105246_10143356 | Ga0105246_101433561 | 199 |
| 239 | 3300014326 | Ga0157380_10021927 | Ga0157380_100219277 | 199 |
| 240 | 3300014745 | Ga0157377_10031555 | Ga0157377_100315554 | 199 |
| 241 | 3300014968 | Ga0157379_10469559 | Ga0157379_104695591 | 199 |
| 242 | 3300025901 | Ga0207688_10019425 | Ga0207688_100194255 | 199 |
| 243 | 3300025901 | Ga0207688_10046525 | Ga0207688_100465253 | 199 |
| 244 | 3300025903 | Ga0207680_10257731 | Ga0207680_102577312 | 199 |
| 245 | 3300025908 | Ga0207643_10577077 | Ga0207643_105770771 | 199 |
| 246 | 3300025910 | Ga0207684_10435987 | Ga0207684_104359872 | 199 |
| 247 | 3300025915 | Ga0207693_10010125 | Ga0207693_100101258 | 199 |
| 248 | 3300025923 | Ga0207681_10108292 | Ga0207681_101082922 | 199 |
| 249 | 3300025926 | Ga0207659_10434235 | Ga0207659_104342352 | 199 |
| 250 | 3300025926 | Ga0207659_10518695 | Ga0207659_105186952 | 199 |
| 251 | 3300025927 | Ga0207687_10055506 | Ga0207687_100555063 | 199 |
| 252 | 3300025935 | Ga0207709_10422547 | Ga0207709_104225471 | 199 |
| 253 | 3300025935 | Ga0207709_10797924 | Ga0207709_107979241 | 199 |
| 254 | 3300025940 | Ga0207691_10280124 | Ga0207691_102801242 | 199 |
| 255 | 3300025942 | Ga0207689_10343978 | Ga0207689_103439781 | 199 |
| 256 | 3300025961 | Ga0207712_10361329 | Ga0207712_103613292 | 199 |
| 257 | 3300026075 | Ga0207708_10155855 | Ga0207708_101558552 | 199 |
| 258 | 3300026089 | Ga0207648_10909351 | Ga0207648_109093511 | 199 |
| 259 | 3300026095 | Ga0207676_10751632 | Ga0207676_107516322 | 199 |
| 260 | 3300031548 | Ga0307408_100015997 | Ga0307408_1000159974 | 199 |
| 261 | 3300031824 | Ga0307413_10037346 | Ga0307413_100373462 | 199 |
| 262 | 3300031903 | Ga0307407_10019982 | Ga0307407_100199823 | 199 |
| 263 | 3300032004 | Ga0307414_10045273 | Ga0307414_100452733 | 199 |
| 264 | 3300032005 | Ga0307411_10015213 | Ga0307411_100152133 | 199 |
| 265 | 3300032126 | Ga0307415_100043901 | Ga0307415_1000439013 | 199 |
| 266 | 3300041404 | Ga0439436_0087425 | Ga0439436_0087425_103_720 | 199 |
| 267 | 3300041408 | Ga0439453_0006596 | Ga0439453_0006596_284_991 | 199 |
| 268 | 3300042436 | Ga0439435_0061415 | Ga0439435_0061415_194_901 | 199 |
| 269 | 3300042437 | Ga0439444_0034779 | Ga0439444_0034779_49_756 | 199 |
| 270 | 3300044901 | Ga0466960_0090078 | Ga0466960_0090078_183_797 | 199 |
| 271 | 3300046491 | Ga0495584_0009408 | Ga0495584_0009408_1487_2260 | 199 |
| 272 | 3300046616 | Ga0495668_0381688 | Ga0495668_0381688_24_746 | 199 |
| 273 | 3300048903 | Ga0496100_0079391 | Ga0496100_0079391_461_1186 | 199 |
| 274 | 3300048903 | Ga0496100_0306497 | Ga0496100_0306497_236_973 | 199 |
| 275 | 3300049127 | Ga0501306_019225 | Ga0501306_019225_222_839 | 199 |
| 276 | 3300049128 | Ga0501308_009456 | Ga0501308_009456_105_722 | 199 |
| 277 | 3300049129 | Ga0501309_030687 | Ga0501309_030687_15_635 | 199 |
| 278 | 3300049130 | Ga0501310_018927 | Ga0501310_018927_124_738 | 199 |
| 279 | 3300049160 | Ga0501304_014355 | Ga0501304_014355_105_722 | 199 |
| 280 | 3300049161 | Ga0501305_012167 | Ga0501305_012167_467_1084 | 199 |
| 281 | 3300049161 | Ga0501305_044024 | Ga0501305_044024_81_698 | 199 |
| 282 | 3300049527 | Ga0501311_042001 | Ga0501311_042001_44_661 | 199 |
| 283 | 3300049528 | Ga0501312_014540 | Ga0501312_014540_296_913 | 199 |
| 284 | 3300049529 | Ga0501313_017286 | Ga0501313_017286_220_837 | 199 |
| 285 | 3300049533 | Ga0501317_006992 | Ga0501317_006992_334_951 | 199 |
| 286 | 3300049534 | Ga0501318_009611 | Ga0501318_009611_428_1045 | 199 |
| 287 | 3300049535 | Ga0501319_003502 | Ga0501319_003502_105_722 | 199 |
| 288 | 3300049671 | Ga0501238_036606 | Ga0501238_036606_86_697 | 199 |
| 289 | 3300050489 | nmdc:mga03683_153026_c1 | nmdc:mga03683_153026_c1_75_806 | 199 |
| 290 | 3300050489 | nmdc:mga03683_15601_c1 | nmdc:mga03683_15601_c1_177_917 | 199 |
| 291 | 3300050492 | nmdc:mga0yw44_19950_c1 | nmdc:mga0yw44_19950_c1_2302_3054 | 199 |
| 292 | 3300050492 | nmdc:mga0yw44_500568_c1 | nmdc:mga0yw44_500568_c1_56_676 | 199 |
| 293 | 3300050492 | nmdc:mga0yw44_57532_c1 | nmdc:mga0yw44_57532_c1_1566_2297 | 199 |
| 294 | 3300050492 | nmdc:mga0yw44_98050_c1 | nmdc:mga0yw44_98050_c1_565_1284 | 199 |
| 295 | 3300050507 | nmdc:mga05p37_715444_c1 | nmdc:mga05p37_715444_c1_306_1046 | 199 |
| 296 | 3300050507 | nmdc:mga05p37_9157_c1 | nmdc:mga05p37_9157_c1_4332_5093 | 199 |
| 297 | 3300050509 | nmdc:mga0qj67_260114_c1 | nmdc:mga0qj67_260114_c1_553_1311 | 199 |
| 298 | 3300050510 | nmdc:mga06r32_157496_c1 | nmdc:mga06r32_157496_c1_606_1358 | 199 |
| 299 | 3300050510 | nmdc:mga06r32_164036_c1 | nmdc:mga06r32_164036_c1_916_1674 | 199 |
| 300 | 3300050511 | nmdc:mga08y16_316432_c1 | nmdc:mga08y16_316432_c1_306_1046 | 199 |
| 301 | 3300054114 | Ga0501084_0660095 | Ga0501084_0660095_134_865 | 199 |
| 302 | 3300002070 | JGI24750J21931_1005917 | JGI24750J21931_10059173 | 200 |
| 303 | 3300002077 | JGI24744J21845_10002877 | JGI24744J21845_100028772 | 200 |
| 304 | 3300005330 | Ga0070690_100070710 | Ga0070690_1000707103 | 200 |
| 305 | 3300005331 | Ga0070670_100041769 | Ga0070670_1000417693 | 200 |
| 306 | 3300005331 | Ga0070670_100124344 | Ga0070670_1001243443 | 200 |
| 307 | 3300005334 | Ga0068869_100035515 | Ga0068869_1000355154 | 200 |
| 308 | 3300005338 | Ga0068868_100033994 | Ga0068868_1000339944 | 200 |
| 309 | 3300005339 | Ga0070660_100187988 | Ga0070660_1001879882 | 200 |
| 310 | 3300005340 | Ga0070689_100060355 | Ga0070689_1000603552 | 200 |
| 311 | 3300005341 | Ga0070691_10049601 | Ga0070691_100496012 | 200 |
| 312 | 3300005343 | Ga0070687_100000967 | Ga0070687_1000009678 | 200 |
| 313 | 3300005345 | Ga0070692_10040201 | Ga0070692_100402011 | 200 |
| 314 | 3300005347 | Ga0070668_100580654 | Ga0070668_1005806541 | 200 |
| 315 | 3300005353 | Ga0070669_100034089 | Ga0070669_1000340892 | 200 |
| 316 | 3300005354 | Ga0070675_100048010 | Ga0070675_1000480103 | 200 |
| 317 | 3300005355 | Ga0070671_100136600 | Ga0070671_1001366002 | 200 |
| 318 | 3300005356 | Ga0070674_100039927 | Ga0070674_1000399271 | 200 |
| 319 | 3300005364 | Ga0070673_100122532 | Ga0070673_1001225323 | 200 |
| 320 | 3300005365 | Ga0070688_100007633 | Ga0070688_1000076337 | 200 |
| 321 | 3300005366 | Ga0070659_100035055 | Ga0070659_1000350553 | 200 |
| 322 | 3300005367 | Ga0070667_100601137 | Ga0070667_1006011371 | 200 |
| 323 | 3300005436 | Ga0070713_100097225 | Ga0070713_1000972254 | 200 |
| 324 | 3300005438 | Ga0070701_10259005 | Ga0070701_102590051 | 200 |
| 325 | 3300005439 | Ga0070711_100325169 | Ga0070711_1003251692 | 200 |
| 326 | 3300005456 | Ga0070678_100254661 | Ga0070678_1002546612 | 200 |
| 327 | 3300005457 | Ga0070662_100054025 | Ga0070662_1000540252 | 200 |
| 328 | 3300005459 | Ga0068867_100076949 | Ga0068867_1000769492 | 200 |
| 329 | 3300005466 | Ga0070685_10077238 | Ga0070685_100772381 | 200 |
| 330 | 3300005535 | Ga0070684_100395598 | Ga0070684_1003955982 | 200 |
| 331 | 3300005543 | Ga0070672_100012217 | Ga0070672_1000122177 | 200 |
| 332 | 3300005544 | Ga0070686_100007538 | Ga0070686_1000075386 | 200 |
| 333 | 3300005545 | Ga0070695_100276594 | Ga0070695_1002765941 | 200 |
| 334 | 3300005546 | Ga0070696_100044773 | Ga0070696_1000447734 | 200 |
| 335 | 3300005578 | Ga0068854_100017535 | Ga0068854_1000175353 | 200 |
| 336 | 3300005614 | Ga0068856_100195515 | Ga0068856_1001955153 | 200 |
| 337 | 3300005618 | Ga0068864_100151427 | Ga0068864_1001514272 | 200 |
| 338 | 3300005834 | Ga0068851_10056745 | Ga0068851_100567452 | 200 |
| 339 | 3300005840 | Ga0068870_10001266 | Ga0068870_100012666 | 200 |
| 340 | 3300005841 | Ga0068863_100043980 | Ga0068863_1000439803 | 200 |
| 341 | 3300005843 | Ga0068860_100056464 | Ga0068860_1000564642 | 200 |
| 342 | 3300005844 | Ga0068862_100046677 | Ga0068862_1000466772 | 200 |
| 343 | 3300006028 | Ga0070717_10211816 | Ga0070717_102118162 | 200 |
| 344 | 3300006178 | Ga0075367_10219473 | Ga0075367_102194732 | 200 |
| 345 | 3300006178 | Ga0075367_10305040 | Ga0075367_103050401 | 200 |
| 346 | 3300006237 | Ga0097621_100070805 | Ga0097621_1000708053 | 200 |
| 347 | 3300006358 | Ga0068871_100007996 | Ga0068871_1000079962 | 200 |
| 348 | 3300006847 | Ga0075431_100227138 | Ga0075431_1002271382 | 200 |
| 349 | 3300006871 | Ga0075434_100042069 | Ga0075434_1000420696 | 200 |
| 350 | 3300006871 | Ga0075434_100042444 | Ga0075434_1000424442 | 200 |
| 351 | 3300006871 | Ga0075434_100116947 | Ga0075434_1001169472 | 200 |
| 352 | 3300006881 | Ga0068865_100385279 | Ga0068865_1003852792 | 200 |
| 353 | 3300009094 | Ga0111539_10051955 | Ga0111539_100519551 | 200 |
| 354 | 3300009098 | Ga0105245_10017232 | Ga0105245_100172326 | 200 |
| 355 | 3300009101 | Ga0105247_10094897 | Ga0105247_100948972 | 200 |
| 356 | 3300009147 | Ga0114129_10035882 | Ga0114129_100358828 | 200 |
| 357 | 3300009147 | Ga0114129_10054275 | Ga0114129_100542756 | 200 |
| 358 | 3300009177 | Ga0105248_10079118 | Ga0105248_100791183 | 200 |
| 359 | 3300009545 | Ga0105237_10222358 | Ga0105237_102223583 | 200 |
| 360 | 3300013296 | Ga0157374_10576799 | Ga0157374_105767991 | 200 |
| 361 | 3300013297 | Ga0157378_10104630 | Ga0157378_101046302 | 200 |
| 362 | 3300013308 | Ga0157375_10595237 | Ga0157375_105952372 | 200 |
| 363 | 3300014325 | Ga0163163_10188448 | Ga0163163_101884483 | 200 |
| 364 | 3300014325 | Ga0163163_10515328 | Ga0163163_105153282 | 200 |
| 365 | 3300014326 | Ga0157380_10019393 | Ga0157380_100193932 | 200 |
| 366 | 3300014745 | Ga0157377_10007242 | Ga0157377_100072426 | 200 |
| 367 | 3300014968 | Ga0157379_10115757 | Ga0157379_101157571 | 200 |
| 368 | 3300014969 | Ga0157376_10134039 | Ga0157376_101340391 | 200 |
| 369 | 3300014969 | Ga0157376_10377250 | Ga0157376_103772502 | 200 |
| 370 | 3300017792 | Ga0163161_10158664 | Ga0163161_101586642 | 200 |
| 371 | 3300024227 | Ga0228598_1002137 | Ga0228598_10021373 | 200 |
| 372 | 3300025893 | Ga0207682_10087917 | Ga0207682_100879172 | 200 |
| 373 | 3300025899 | Ga0207642_10011875 | Ga0207642_100118752 | 200 |
| 374 | 3300025900 | Ga0207710_10012249 | Ga0207710_100122494 | 200 |
| 375 | 3300025901 | Ga0207688_10009396 | Ga0207688_100093961 | 200 |
| 376 | 3300025901 | Ga0207688_10239960 | Ga0207688_102399602 | 200 |
| 377 | 3300025904 | Ga0207647_10024868 | Ga0207647_100248684 | 200 |
| 378 | 3300025905 | Ga0207685_10009407 | Ga0207685_100094071 | 200 |
| 379 | 3300025907 | Ga0207645_10006619 | Ga0207645_100066193 | 200 |
| 380 | 3300025908 | Ga0207643_10001834 | Ga0207643_100018347 | 200 |
| 381 | 3300025911 | Ga0207654_10032474 | Ga0207654_100324743 | 200 |
| 382 | 3300025915 | Ga0207693_10025821 | Ga0207693_100258211 | 200 |
| 383 | 3300025918 | Ga0207662_10002642 | Ga0207662_100026427 | 200 |
| 384 | 3300025920 | Ga0207649_10191032 | Ga0207649_101910322 | 200 |
| 385 | 3300025920 | Ga0207649_10345635 | Ga0207649_103456351 | 200 |
| 386 | 3300025923 | Ga0207681_10115579 | Ga0207681_101155792 | 200 |
| 387 | 3300025925 | Ga0207650_10012516 | Ga0207650_100125167 | 200 |
| 388 | 3300025925 | Ga0207650_10133287 | Ga0207650_101332871 | 200 |
| 389 | 3300025926 | Ga0207659_10005605 | Ga0207659_100056056 | 200 |
| 390 | 3300025927 | Ga0207687_10191338 | Ga0207687_101913382 | 200 |
| 391 | 3300025928 | Ga0207700_10214718 | Ga0207700_102147181 | 200 |
| 392 | 3300025931 | Ga0207644_10028611 | Ga0207644_100286112 | 200 |
| 393 | 3300025932 | Ga0207690_10194458 | Ga0207690_101944582 | 200 |
| 394 | 3300025933 | Ga0207706_10008800 | Ga0207706_1000880010 | 200 |
| 395 | 3300025934 | Ga0207686_10183774 | Ga0207686_101837742 | 200 |
| 396 | 3300025935 | Ga0207709_10009444 | Ga0207709_100094443 | 200 |
| 397 | 3300025936 | Ga0207670_10026014 | Ga0207670_100260143 | 200 |
| 398 | 3300025937 | Ga0207669_10013794 | Ga0207669_100137942 | 200 |
| 399 | 3300025940 | Ga0207691_10011401 | Ga0207691_100114013 | 200 |
| 400 | 3300025941 | Ga0207711_10406384 | Ga0207711_104063842 | 200 |
| 401 | 3300025942 | Ga0207689_10009322 | Ga0207689_100093227 | 200 |
| 402 | 3300025960 | Ga0207651_10042126 | Ga0207651_100421263 | 200 |
| 403 | 3300025961 | Ga0207712_10150926 | Ga0207712_101509262 | 200 |
| 404 | 3300026023 | Ga0207677_10011951 | Ga0207677_100119516 | 200 |
| 405 | 3300026035 | Ga0207703_10188640 | Ga0207703_101886402 | 200 |
| 406 | 3300026041 | Ga0207639_10160934 | Ga0207639_101609341 | 200 |
| 407 | 3300026067 | Ga0207678_10071465 | Ga0207678_100714653 | 200 |
| 408 | 3300026075 | Ga0207708_10004498 | Ga0207708_100044983 | 200 |
| 409 | 3300026078 | Ga0207702_10108751 | Ga0207702_101087512 | 200 |
| 410 | 3300026078 | Ga0207702_10156073 | Ga0207702_101560732 | 200 |
| 411 | 3300026088 | Ga0207641_10028749 | Ga0207641_100287494 | 200 |
| 412 | 3300026089 | Ga0207648_10003288 | Ga0207648_1000328810 | 200 |
| 413 | 3300026095 | Ga0207676_10023920 | Ga0207676_100239202 | 200 |
| 414 | 3300026116 | Ga0207674_10543705 | Ga0207674_105437052 | 200 |
| 415 | 3300026118 | Ga0207675_100007677 | Ga0207675_1000076777 | 200 |
| 416 | 3300026121 | Ga0207683_10013207 | Ga0207683_100132075 | 200 |
| 417 | 3300026142 | Ga0207698_10015844 | Ga0207698_100158443 | 200 |
| 418 | 3300028380 | Ga0268265_10246934 | Ga0268265_102469342 | 200 |
| 419 | 3300028381 | Ga0268264_10030844 | Ga0268264_100308444 | 200 |
| 420 | 3300031241 | Ga0265325_10013504 | Ga0265325_100135044 | 200 |
| 421 | 3300031595 | Ga0265313_10019389 | Ga0265313_100193893 | 200 |
| 422 | 3300035083 | Ga0373926_0051915 | Ga0373926_0051915_545_1288 | 200 |
| 423 | 3300035089 | Ga0373944_0082701 | Ga0373944_0082701_303_1046 | 200 |
| 424 | 3300035092 | Ga0373952_0066395 | Ga0373952_0066395_45_770 | 200 |
| 425 | 3300035114 | Ga0373939_0047508 | Ga0373939_0047508_164_889 | 200 |
| 426 | 3300035116 | Ga0373945_0003434 | Ga0373945_0003434_1182_1907 | 200 |
| 427 | 3300035170 | Ga0373943_0022910 | Ga0373943_0022910_1001_1726 | 200 |
| 428 | 3300035172 | Ga0373955_0048835 | Ga0373955_0048835_741_1484 | 200 |
| 429 | 3300035695 | Ga0373927_0015276 | Ga0373927_0015276_62_787 | 200 |
| 430 | 3300035695 | Ga0373927_0083737 | Ga0373927_0083737_554_1297 | 200 |
| 431 | 3300035724 | Ga0373933_0029565 | Ga0373933_0029565_1821_2564 | 200 |
| 432 | 3300035725 | Ga0373947_0009074 | Ga0373947_0009074_1302_2027 | 200 |
| 433 | 3300035725 | Ga0373947_0171219 | Ga0373947_0171219_370_1113 | 200 |
| 434 | 3300037068 | Ga0373925_0020794 | Ga0373925_0020794_2010_2735 | 200 |
| 435 | 3300037068 | Ga0373925_0397790 | Ga0373925_0397790_136_861 | 200 |
| 436 | 3300046452 | Ga0495617_036188 | Ga0495617_036188_58_783 | 200 |
| 437 | 3300046454 | Ga0495592_0186359 | Ga0495592_0186359_122_865 | 200 |
| 438 | 3300046455 | Ga0495603_0001783 | Ga0495603_0001783_9966_10691 | 200 |
| 439 | 3300046459 | Ga0495629_0121765 | Ga0495629_0121765_234_977 | 200 |
| 440 | 3300046462 | Ga0495651_0023009 | Ga0495651_0023009_1675_2418 | 200 |
| 441 | 3300046463 | Ga0495653_0058010 | Ga0495653_0058010_668_1411 | 200 |
| 442 | 3300046476 | Ga0495662_0089057 | Ga0495662_0089057_103_828 | 200 |
| 443 | 3300046477 | Ga0495664_0035719 | Ga0495664_0035719_397_1140 | 200 |
| 444 | 3300046491 | Ga0495584_0082128 | Ga0495584_0082128_466_1191 | 200 |
| 445 | 3300046511 | Ga0495608_0025664 | Ga0495608_0025664_2114_2857 | 200 |
| 446 | 3300046513 | Ga0495616_0052819 | Ga0495616_0052819_81_806 | 200 |
| 447 | 3300046517 | Ga0495630_0116502 | Ga0495630_0116502_918_1643 | 200 |
| 448 | 3300046517 | Ga0495630_0264793 | Ga0495630_0264793_341_1084 | 200 |
| 449 | 3300046525 | Ga0495663_0049330 | Ga0495663_0049330_260_979 | 200 |
| 450 | 3300046529 | Ga0495652_0195579 | Ga0495652_0195579_282_1025 | 200 |
| 451 | 3300046536 | Ga0495587_0105450 | Ga0495587_0105450_176_919 | 200 |
| 452 | 3300046539 | Ga0495621_0032015 | Ga0495621_0032015_254_979 | 200 |
| 453 | 3300046558 | Ga0495633_0030278 | Ga0495633_0030278_1323_2042 | 200 |
| 454 | 3300046559 | Ga0495667_0108618 | Ga0495667_0108618_416_1159 | 200 |
| 455 | 3300046615 | Ga0495656_0015253 | Ga0495656_0015253_1606_2325 | 200 |
| 456 | 3300046616 | Ga0495668_0103220 | Ga0495668_0103220_358_1077 | 200 |
| 457 | 3300046664 | Ga0495659_0018100 | Ga0495659_0018100_201_959 | 200 |
| 458 | 3300046674 | Ga0495588_0040320 | Ga0495588_0040320_124_849 | 200 |
| 459 | 3300046675 | Ga0495657_0071269 | Ga0495657_0071269_1515_2258 | 200 |
| 460 | 3300046679 | Ga0495623_0014821 | Ga0495623_0014821_494_1237 | 200 |
| 461 | 3300046690 | Ga0495624_0191858 | Ga0495624_0191858_232_957 | 200 |
| 462 | 3300046691 | Ga0495670_0181705 | Ga0495670_0181705_377_1096 | 200 |
| 463 | 3300046694 | Ga0495649_0053171 | Ga0495649_0053171_61_780 | 200 |
| 464 | 3300047319 | Ga0495674_0096156 | Ga0495674_0096156_533_1258 | 200 |
| 465 | 3300047321 | Ga0495676_0027307 | Ga0495676_0027307_2620_3345 | 200 |
| 466 | 3300047444 | Ga0495675_0018898 | Ga0495675_0018898_575_1318 | 200 |
| 467 | 3300047447 | Ga0495685_101630 | Ga0495685_101630_129_854 | 200 |
| 468 | 3300048088 | Ga0495602_0115716 | Ga0495602_0115716_583_1326 | 200 |
| 469 | 3300048903 | Ga0496100_0005367 | Ga0496100_0005367_3016_3735 | 200 |
| 470 | 3300048903 | Ga0496100_0548471 | Ga0496100_0548471_138_857 | 200 |
| 471 | 3300048904 | Ga0496101_0090868 | Ga0496101_0090868_1416_2135 | 200 |
| 472 | 3300048904 | Ga0496101_0545705 | Ga0496101_0545705_100_825 | 200 |
| 473 | 3300048905 | Ga0496102_0009701 | Ga0496102_0009701_2698_3417 | 200 |
| 474 | 3300048905 | Ga0496102_0022167 | Ga0496102_0022167_1887_2612 | 200 |
| 475 | 3300048906 | Ga0496103_0006468 | Ga0496103_0006468_2714_3433 | 200 |
| 476 | 3300048907 | Ga0496104_0008101 | Ga0496104_0008101_4057_4776 | 200 |
| 477 | 3300048907 | Ga0496104_0131435 | Ga0496104_0131435_128_853 | 200 |
| 478 | 3300048907 | Ga0496104_0298772 | Ga0496104_0298772_142_861 | 200 |
| 479 | 3300048908 | Ga0496105_0019454 | Ga0496105_0019454_129_848 | 200 |
| 480 | 3300048908 | Ga0496105_0069588 | Ga0496105_0069588_2008_2733 | 200 |
| 481 | 3300048909 | Ga0496106_0011210 | Ga0496106_0011210_5360_6085 | 200 |
| 482 | 3300048909 | Ga0496106_0693668 | Ga0496106_0693668_47_766 | 200 |
| 483 | 3300048910 | Ga0496107_0008161 | Ga0496107_0008161_3674_4393 | 200 |
| 484 | 3300048910 | Ga0496107_0008292 | Ga0496107_0008292_2037_2762 | 200 |
| 485 | 3300048911 | Ga0496108_0025516 | Ga0496108_0025516_4029_4748 | 200 |
| 486 | 3300048911 | Ga0496108_0336982 | Ga0496108_0336982_36_755 | 200 |
| 487 | 3300048912 | Ga0496109_0004178 | Ga0496109_0004178_7910_8635 | 200 |
| 488 | 3300048912 | Ga0496109_0022019 | Ga0496109_0022019_3528_4247 | 200 |
| 489 | 3300048913 | Ga0496110_0006465 | Ga0496110_0006465_1996_2721 | 200 |
| 490 | 3300048913 | Ga0496110_0024973 | Ga0496110_0024973_126_845 | 200 |
| 491 | 3300048914 | Ga0496111_0009761 | Ga0496111_0009761_1396_2115 | 200 |
| 492 | 3300048915 | Ga0496112_0027080 | Ga0496112_0027080_3539_4258 | 200 |
| 493 | 3300048916 | Ga0496113_0003007 | Ga0496113_0003007_4217_4936 | 200 |
| 494 | 3300048916 | Ga0496113_0032019 | Ga0496113_0032019_2081_2806 | 200 |
| 495 | 3300048917 | Ga0496114_0029645 | Ga0496114_0029645_1192_1917 | 200 |
| 496 | 3300048918 | Ga0496115_0014453 | Ga0496115_0014453_5120_5839 | 200 |
| 497 | 3300049572 | Ga0501036_0109474 | Ga0501036_0109474_1390_2133 | 200 |
| 498 | 3300049577 | Ga0501041_0138214 | Ga0501041_0138214_388_1173 | 200 |
| 499 | 3300049578 | Ga0501042_0130139 | Ga0501042_0130139_722_1507 | 200 |
| 500 | 3300049579 | Ga0501043_0134187 | Ga0501043_0134187_340_1083 | 200 |
| 501 | 3300049584 | Ga0501068_0095967 | Ga0501068_0095967_854_1597 | 200 |
| 502 | 3300049587 | Ga0501071_0286963 | Ga0501071_0286963_376_1119 | 200 |
| 503 | 3300049588 | Ga0501072_0322428 | Ga0501072_0322428_57_842 | 200 |
| 504 | 3300049590 | Ga0501074_0092562 | Ga0501074_0092562_1235_2020 | 200 |
| 505 | 3300049591 | Ga0501075_0123881 | Ga0501075_0123881_607_1392 | 200 |
| 506 | 3300049591 | Ga0501075_0157732 | Ga0501075_0157732_609_1346 | 200 |
| 507 | 3300049592 | Ga0501076_0019223 | Ga0501076_0019223_2307_3092 | 200 |
| 508 | 3300049592 | Ga0501076_0519921 | Ga0501076_0519921_115_891 | 200 |
| 509 | 3300049593 | Ga0501077_0007343 | Ga0501077_0007343_3101_3886 | 200 |
| 510 | 3300049741 | Ga0501079_0036769 | Ga0501079_0036769_2521_3306 | 200 |
| 511 | 3300049742 | Ga0501080_0383040 | Ga0501080_0383040_380_1165 | 200 |
| 512 | 3300049823 | Ga0501044_0031635 | Ga0501044_0031635_61_804 | 200 |
| 513 | 3300050492 | nmdc:mga0yw44_108607_c1 | nmdc:mga0yw44_108607_c1_1044_1763 | 200 |
| 514 | 3300050492 | nmdc:mga0yw44_195186_c1 | nmdc:mga0yw44_195186_c1_524_1240 | 200 |
| 515 | 3300050507 | nmdc:mga05p37_120409_c1 | nmdc:mga05p37_120409_c1_1893_2681 | 200 |
| 516 | 3300050507 | nmdc:mga05p37_13259_c1 | nmdc:mga05p37_13259_c1_3278_4003 | 200 |
| 517 | 3300050507 | nmdc:mga05p37_20387_c1 | nmdc:mga05p37_20387_c1_6767_7525 | 200 |
| 518 | 3300050510 | nmdc:mga06r32_232609_c1 | nmdc:mga06r32_232609_c1_486_1211 | 200 |
| 519 | 3300050511 | nmdc:mga08y16_18532_c1 | nmdc:mga08y16_18532_c1_2977_3741 | 200 |
| 520 | 3300050511 | nmdc:mga08y16_20827_c1 | nmdc:mga08y16_20827_c1_5756_6481 | 200 |
| 521 | 3300050512 | nmdc:mga0n895_14122_c1 | nmdc:mga0n895_14122_c1_152_940 | 200 |
| 522 | 3300050512 | nmdc:mga0n895_19141_c1 | nmdc:mga0n895_19141_c1_3917_4642 | 200 |
| 523 | 3300053077 | Ga0495601_0228465 | Ga0495601_0228465_300_1043 | 200 |
| 524 | 3300053083 | Ga0495655_0027974 | Ga0495655_0027974_94_819 | 200 |
| 525 | 3300053083 | Ga0495655_0034819 | Ga0495655_0034819_178_897 | 200 |
| 526 | 3300053084 | Ga0495595_0103548 | Ga0495595_0103548_13_732 | 200 |
| 527 | 3300053084 | Ga0495595_0109410 | Ga0495595_0109410_143_868 | 200 |
| 528 | 3300053084 | Ga0495595_0225482 | Ga0495595_0225482_165_908 | 200 |
| 529 | 3300053085 | Ga0495619_0054783 | Ga0495619_0054783_96_815 | 200 |
| 530 | 3300053085 | Ga0495619_0102761 | Ga0495619_0102761_701_1444 | 200 |
| 531 | 3300053085 | Ga0495619_0469837 | Ga0495619_0469837_77_799 | 200 |
| 532 | 3300054114 | Ga0501084_0147018 | Ga0501084_0147018_702_1487 | 200 |
| 533 | 3300060353 | Ga0501082_0082196 | Ga0501082_0082196_1255_2040 | 200 |
| 534 | 3300060353 | Ga0501082_0333473 | Ga0501082_0333473_534_1271 | 200 |
| 535 | 3300061734 | Ga0530510_0176182 | Ga0530510_0176182_697_1482 | 200 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7unw-assembly1.cif.gz_X | pseudomonas aeruginosa 70s ribosome initiation complex bound to if2-gdpcp (structure ii-b) | 0.9429 | 6 | 187 |
| 6ysi-assembly1.cif.gz_R | acinetobacter baumannii ribosome-tigecycline complex - 50s subunit | 0.9393 | 5 | 97 |
| 6dnc-assembly1.cif.gz_Z | e.coli rf1 bound to e.coli 70s ribosome in response to uau sense a-site codon | 0.9312 | 6 | 97 |
| 7m4v-assembly1.cif.gz_U | a. baumannii ribosome-eravacycline complex: 50s | 0.9309 | 5 | 97 |
| 6ogg-assembly1.cif.gz_v | 70s termination complex with rf2 bound to the uga codon. rotated ribosome with rf2 bound (structure iv). | 0.9273 | 4 | 97 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54VK2_46_139_2.40.240.10 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P | 0.9498 | 7 | 97 | 2.40.240.10 |
| af_Q2G0S0_95_176_2.170.120.20 | Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain | 0.9459 | 98 | 180 | 2.170.120.20 |
| af_K7MM89_88_176_2.170.120.20 | Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain | 0.9455 | 99 | 186 | 2.170.120.20 |
| af_F4JPA3_178_267_2.170.120.20 | Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain | 0.9331 | 103 | 187 | 2.170.120.20 |
| af_K7MM89_88_176_2.170.120.20 | Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain | 0.9255 | 99 | 186 | 2.170.120.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529L0H0-F1-model_v4 | 50S ribosomal protein L25 | 0.9795 | 1 | 116 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A2P7SE57-F1-model_v4 | Large ribosomal subunit protein bL25 (General stress protein CTC) | 0.9761 | 1 | 188 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A2A4LDJ1-F1-model_v4 | Large ribosomal subunit protein bL25 (General stress protein CTC) | 0.9714 | 1 | 188 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A258XCV2-F1-model_v4 | Large ribosomal subunit protein bL25 (General stress protein CTC) | 0.9704 | 1 | 192 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A2V4VGA5-F1-model_v4 | deleted | 0.9702 | 1 | 187 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar