F460649

General Info

Members Datasets Scaffolds Average Seq Length
535 326 522 200

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10248701|Ga0111539_102487014
Length 229
Sequence MAAGRFLNLGGHRFFIPLQRTTTMSEVKQIKAVARDRAGKGAARAVRRQGQVPAVIYGAGQSAQAIALDFNQTKQLIFAGHFLTTIFEIDVDGKTVRAIPRDYQLDPVRDFPIHVDFLRLAQGQAIKVVVPVHVVGQEKSPGVKRGGALQIVEHSVELLVPSDAIPDYIEASVDGLNIGDSVHLNDITLPKGAKATSTENMTLVTVVAPTGLTEEDAAPAAAAEGTAAA

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
4 2773857925 Microvirga vignae BR3299 Isolate Unclassified
5 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
6 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
7 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
8 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
9 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
10 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
200 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
201 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
202 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
297 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
305 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
318 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
324 641522639 Methylobacterium sp. 4-46 Isolate Nodule
325 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
326 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.02
Metatranscriptomes 3.55
Isolates 2.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 1.31
Rhizoplane 10.65
Rhizosphere 80.75
Stem 0
Stem Tuber 0
Unclassified 2.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1005917 3300002070 Bacteria 1511
2 JGI24744J21845_10002877 3300002077 Bacteria 3518
3 Ga0006778J45830_1079432 3300003162 Bacteria 826
4 Ga0007429J51699_1076873 3300003579 Bacteria 757
5 Ga0070690_100070710 3300005330 Bacteria 2266
6 Ga0070690_100108953 3300005330 Bacteria 1846
7 Ga0070670_100041769 3300005331 Bacteria 3941
8 Ga0070670_100124344 3300005331 Bacteria 2226
9 Ga0068869_100035515 3300005334 Bacteria 3532
10 Ga0070680_100483928 3300005336 Bacteria 1058
11 Ga0068868_100033994 3300005338 Bacteria 3933
12 Ga0068868_100196884 3300005338 Bacteria 1678
13 Ga0070660_100187988 3300005339 Bacteria 1672
14 Ga0070689_100060355 3300005340 Bacteria 2948
15 Ga0070689_100156434 3300005340 Bacteria 1840
16 Ga0070691_10049601 3300005341 Bacteria 2000
17 Ga0070687_100000967 3300005343 Bacteria 9766
18 Ga0070692_10040201 3300005345 Bacteria 2391
19 Ga0070668_100112002 3300005347 Bacteria 2173
20 Ga0070668_100240052 3300005347 Bacteria 1501
21 Ga0070668_100515784 3300005347 Bacteria 1036
22 Ga0070668_100580654 3300005347 Bacteria 978
23 Ga0070669_100034089 3300005353 Bacteria 3685
24 Ga0070669_100200275 3300005353 Bacteria 1571
25 Ga0070675_100048010 3300005354 Bacteria 3499
26 Ga0070675_100341870 3300005354 Bacteria 1325
27 Ga0070671_100000672 3300005355 Bacteria 24494
28 Ga0070671_100136600 3300005355 Bacteria 2067
29 Ga0070674_100039927 3300005356 Bacteria 3172
30 Ga0070673_100003747 3300005364 Bacteria 9534
31 Ga0070673_100122532 3300005364 Bacteria 2171
32 Ga0070688_100007633 3300005365 Bacteria 5841
33 Ga0070688_100117511 3300005365 Bacteria 1777
34 Ga0070659_100035055 3300005366 Bacteria 3905
35 Ga0070659_100416125 3300005366 Bacteria 1136
36 Ga0070667_100165167 3300005367 Bacteria 1952
37 Ga0070667_100601137 3300005367 Bacteria 1013
38 Ga0070714_100007212 3300005435 Bacteria 8631
39 Ga0070714_100049173 3300005435 Bacteria 3589
40 Ga0070713_100000796 3300005436 Bacteria 20141
41 Ga0070713_100097225 3300005436 Bacteria 2544
42 Ga0070710_10006756 3300005437 Bacteria 5531
43 Ga0070701_10259005 3300005438 Bacteria 1053
44 Ga0070711_100005690 3300005439 Bacteria 7472
45 Ga0070711_100325169 3300005439 Bacteria 1230
46 Ga0070700_100072426 3300005441 Bacteria 2203
47 Ga0070700_100249225 3300005441 Bacteria 1273
48 Ga0070678_100254661 3300005456 Bacteria 1473
49 Ga0070662_100054025 3300005457 Bacteria 2910
50 Ga0068867_100076949 3300005459 Bacteria 2506
51 Ga0070685_10077238 3300005466 Bacteria 1988
52 Ga0070684_100395598 3300005535 Bacteria 1274
53 Ga0070672_100012217 3300005543 Bacteria 6017
54 Ga0070686_100007538 3300005544 Bacteria 6076
55 Ga0070686_100252960 3300005544 Bacteria 1288
56 Ga0070695_100276594 3300005545 Bacteria 1232
57 Ga0070696_100044773 3300005546 Bacteria 3064
58 Ga0070665_100293292 3300005548 Bacteria 1629
59 Ga0070665_100508889 3300005548 Bacteria 1215
60 Ga0070664_100074547 3300005564 Bacteria 2913
61 Ga0068854_100017535 3300005578 Bacteria 4791
62 Ga0068856_100195515 3300005614 Bacteria 2036
63 Ga0070702_101043443 3300005615 Bacteria 650
64 Ga0068864_100050382 3300005618 Bacteria 3584
65 Ga0068864_100151427 3300005618 Bacteria 2101
66 Ga0068864_100222281 3300005618 Bacteria 1743
67 Ga0068861_100278121 3300005719 Bacteria 1440
68 Ga0068851_10056745 3300005834 Bacteria 1998
69 Ga0068870_10001266 3300005840 Bacteria 10142
70 Ga0068870_10408053 3300005840 Bacteria 886
71 Ga0068863_100043980 3300005841 Bacteria 4240
72 Ga0068863_100502034 3300005841 Bacteria 1195
73 Ga0068863_100655177 3300005841 Bacteria 1041
74 Ga0068858_101188587 3300005842 Bacteria 749
75 Ga0068860_100056464 3300005843 Bacteria 3732
76 Ga0068862_100046677 3300005844 Bacteria 3695
77 Ga0081455_10007086 3300005937 Bacteria 11894
78 Ga0081455_10030017 3300005937 Bacteria 4947
79 Ga0081455_10178190 3300005937 Bacteria 1612
80 Ga0081455_10273290 3300005937 Bacteria 1224
81 Ga0081538_10048294 3300005981 Bacteria 2597
82 Ga0081540_1000300 3300005983 Bacteria 51023
83 Ga0081539_10005758 3300005985 Bacteria 12368
84 Ga0070717_10002581 3300006028 Bacteria 12784
85 Ga0070717_10041261 3300006028 Bacteria 3762
86 Ga0070717_10211816 3300006028 Bacteria 1701
87 Ga0075365_10034678 3300006038 Bacteria 3260
88 Ga0075365_10454875 3300006038 Bacteria 904
89 Ga0075363_100021074 3300006048 Bacteria 3277
90 Ga0075364_10006653 3300006051 Bacteria 6811
91 Ga0075364_10079593 3300006051 Bacteria 2165
92 Ga0070715_10000954 3300006163 Bacteria 8074
93 Ga0070716_100007225 3300006173 Bacteria 5462
94 Ga0070712_100000619 3300006175 Bacteria 20858
95 Ga0070712_100007553 3300006175 Bacteria 6795
96 Ga0075362_10017621 3300006177 Bacteria 2945
97 Ga0075362_10113769 3300006177 Bacteria 1276
98 Ga0075367_10219473 3300006178 Bacteria 1190
99 Ga0075367_10232745 3300006178 Bacteria 1154
100 Ga0075367_10305040 3300006178 Bacteria 1002
101 Ga0075369_10130192 3300006186 Bacteria 1143
102 Ga0075366_10080248 3300006195 Bacteria 1948
103 Ga0097621_100070805 3300006237 Bacteria 2880
104 Ga0097621_100174628 3300006237 Bacteria 1854
105 Ga0068871_100007996 3300006358 Bacteria 7588
106 Ga0075428_100249810 3300006844 Bacteria 1912
107 Ga0075428_100410974 3300006844 Bacteria 1450
108 Ga0075428_100436657 3300006844 Bacteria 1402
109 Ga0075428_100539617 3300006844 Bacteria 1247
110 Ga0075430_100102074 3300006846 Bacteria 2394
111 Ga0075430_100594903 3300006846 Bacteria 913
112 Ga0075431_100227138 3300006847 Bacteria 1903
113 Ga0075434_100042069 3300006871 Bacteria 4529
114 Ga0075434_100042444 3300006871 Bacteria 4509
115 Ga0075434_100057530 3300006871 Bacteria 3864
116 Ga0075434_100116947 3300006871 Bacteria 2679
117 Ga0075434_100455985 3300006871 Bacteria 1300
118 Ga0075429_100083869 3300006880 Bacteria 2777
119 Ga0075429_100209297 3300006880 Bacteria 1709
120 Ga0075429_100260893 3300006880 Bacteria 1517
121 Ga0075429_100488389 3300006880 Bacteria 1079
122 Ga0068865_100385279 3300006881 Bacteria 1144
123 Ga0105240_11120164 3300009093 Bacteria 837
124 Ga0111539_10051955 3300009094 Bacteria 4880
125 Ga0111539_10116751 3300009094 Bacteria 3129
126 Ga0111539_10226118 3300009094 Bacteria 2179
127 Ga0111539_10248701 3300009094 Bacteria 2070
128 Ga0111539_10595019 3300009094 Bacteria 1288
129 Ga0105245_10001599 3300009098 Bacteria 20614
130 Ga0105245_10017232 3300009098 Bacteria 6303
131 Ga0105245_11125126 3300009098 Bacteria 832
132 Ga0105247_10054671 3300009101 Bacteria 2463
133 Ga0105247_10094897 3300009101 Bacteria 1899
134 Ga0114129_10035882 3300009147 Bacteria 7002
135 Ga0114129_10054275 3300009147 Bacteria 5619
136 Ga0114129_10208397 3300009147 Bacteria 2644
137 Ga0114129_10318044 3300009147 Bacteria 2070
138 Ga0105243_10152895 3300009148 Bacteria 1981
139 Ga0105248_10023331 3300009177 Bacteria 6873
140 Ga0105248_10079118 3300009177 Bacteria 3695
141 Ga0105248_10226870 3300009177 Bacteria 2102
142 Ga0105237_10222358 3300009545 Bacteria 1888
143 Ga0105237_10955188 3300009545 Bacteria 864
144 Ga0105238_10043918 3300009551 Bacteria 4521
145 Ga0105238_10184594 3300009551 Bacteria 2062
146 Ga0105249_10311956 3300009553 Bacteria 1581
147 Ga0105239_10298624 3300010375 Bacteria 1814
148 Ga0105246_10108322 3300011119 Bacteria 2036
149 Ga0105246_10143356 3300011119 Bacteria 1799
150 Ga0157374_10576799 3300013296 Bacteria 1134
151 Ga0157378_10104630 3300013297 Bacteria 2588
152 Ga0163162_10127939 3300013306 Bacteria 2647
153 Ga0163162_10759904 3300013306 Bacteria 1088
154 Ga0157372_10048129 3300013307 Bacteria 4739
155 Ga0157375_10595237 3300013308 Bacteria 1265
156 Ga0163163_10188448 3300014325 Bacteria 2111
157 Ga0163163_10515328 3300014325 Bacteria 1258
158 Ga0163163_11063764 3300014325 Bacteria 872
159 Ga0157380_10019393 3300014326 Bacteria 5068
160 Ga0157380_10021927 3300014326 Bacteria 4797
161 Ga0182008_10178073 3300014497 Bacteria 1075
162 Ga0157377_10007242 3300014745 Bacteria 5345
163 Ga0157377_10031555 3300014745 Bacteria 2880
164 Ga0157377_10213779 3300014745 Bacteria 1231
165 Ga0157379_10115757 3300014968 Bacteria 2410
166 Ga0157379_10469559 3300014968 Bacteria 1163
167 Ga0157376_10134039 3300014969 Bacteria 2214
168 Ga0157376_10377250 3300014969 Bacteria 1365
169 Ga0182007_10048195 3300015262 Bacteria 1408
170 Ga0163161_10158664 3300017792 Bacteria 1724
171 Ga0213876_10024133 3300021384 Bacteria 3210
172 Ga0228598_1002137 3300024227 Bacteria 4324
173 Ga0207697_10044697 3300025315 Bacteria 1823
174 Ga0207682_10087917 3300025893 Bacteria 1343
175 Ga0207692_10000204 3300025898 Bacteria 19862
176 Ga0207642_10011875 3300025899 Bacteria 3124
177 Ga0207710_10012249 3300025900 Bacteria 3608
178 Ga0207710_10058788 3300025900 Bacteria 1739
179 Ga0207688_10009396 3300025901 Bacteria 5325
180 Ga0207688_10019425 3300025901 Bacteria 3702
181 Ga0207688_10046525 3300025901 Bacteria 2423
182 Ga0207688_10239960 3300025901 Bacteria 1096
183 Ga0207680_10257731 3300025903 Bacteria 1206
184 Ga0207680_10325105 3300025903 Bacteria 1076
185 Ga0207647_10024868 3300025904 Bacteria 3944
186 Ga0207685_10009407 3300025905 Bacteria 2838
187 Ga0207645_10006619 3300025907 Bacteria 8284
188 Ga0207643_10001834 3300025908 Bacteria 11774
189 Ga0207643_10046631 3300025908 Bacteria 2450
190 Ga0207643_10577077 3300025908 Bacteria 723
191 Ga0207684_10435987 3300025910 Bacteria 1125
192 Ga0207654_10032474 3300025911 Bacteria 2885
193 Ga0207695_10368494 3300025913 Bacteria 1323
194 Ga0207671_10154406 3300025914 Bacteria 1775
195 Ga0207693_10010125 3300025915 Bacteria 7658
196 Ga0207693_10025821 3300025915 Bacteria 4653
197 Ga0207663_10000528 3300025916 Bacteria 16743
198 Ga0207662_10002642 3300025918 Bacteria 9042
199 Ga0207662_10032318 3300025918 Bacteria 3045
200 Ga0207649_10191032 3300025920 Bacteria 1440
201 Ga0207649_10345635 3300025920 Bacteria 1099
202 Ga0207681_10108292 3300025923 Bacteria 2017
203 Ga0207681_10115579 3300025923 Bacteria 1959
204 Ga0207681_10223533 3300025923 Bacteria 1458
205 Ga0207694_10036200 3300025924 Bacteria 3787
206 Ga0207650_10012516 3300025925 Bacteria 5856
207 Ga0207650_10133287 3300025925 Bacteria 1946
208 Ga0207659_10005605 3300025926 Bacteria 7625
209 Ga0207659_10434235 3300025926 Bacteria 1103
210 Ga0207659_10518695 3300025926 Bacteria 1010
211 Ga0207687_10055506 3300025927 Bacteria 2776
212 Ga0207687_10191338 3300025927 Bacteria 1593
213 Ga0207700_10214718 3300025928 Bacteria 1628
214 Ga0207700_10551367 3300025928 Bacteria 1023
215 Ga0207664_10001315 3300025929 Bacteria 16379
216 Ga0207644_10028611 3300025931 Bacteria 3860
217 Ga0207690_10194458 3300025932 Bacteria 1536
218 Ga0207706_10008800 3300025933 Bacteria 9293
219 Ga0207706_10394038 3300025933 Bacteria 1201
220 Ga0207686_10183774 3300025934 Bacteria 1484
221 Ga0207709_10009444 3300025935 Bacteria 5367
222 Ga0207709_10422547 3300025935 Bacteria 1024
223 Ga0207709_10797924 3300025935 Bacteria 762
224 Ga0207670_10026014 3300025936 Bacteria 3683
225 Ga0207669_10013794 3300025937 Bacteria 4029
226 Ga0207669_10061202 3300025937 Bacteria 2312
227 Ga0207691_10011401 3300025940 Bacteria 8532
228 Ga0207691_10280124 3300025940 Bacteria 1435
229 Ga0207691_10340284 3300025940 Bacteria 1284
230 Ga0207711_10079300 3300025941 Bacteria 2866
231 Ga0207711_10394621 3300025941 Bacteria 1285
232 Ga0207711_10406384 3300025941 Bacteria 1265
233 Ga0207689_10009322 3300025942 Bacteria 8484
234 Ga0207689_10343978 3300025942 Bacteria 1239
235 Ga0207651_10014393 3300025960 Bacteria 4565
236 Ga0207651_10042126 3300025960 Bacteria 3036
237 Ga0207712_10150926 3300025961 Bacteria 1795
238 Ga0207712_10361329 3300025961 Bacteria 1210
239 Ga0207658_10102588 3300025986 Bacteria 2244
240 Ga0207677_10011951 3300026023 Bacteria 4971
241 Ga0207677_10058079 3300026023 Bacteria 2662
242 Ga0207677_10966858 3300026023 Bacteria 771
243 Ga0207703_10188640 3300026035 Bacteria 1824
244 Ga0207703_10227555 3300026035 Bacteria 1670
245 Ga0207639_10160934 3300026041 Bacteria 1891
246 Ga0207678_10071465 3300026067 Bacteria 2976
247 Ga0207708_10004498 3300026075 Bacteria 10265
248 Ga0207708_10148589 3300026075 Bacteria 1843
249 Ga0207708_10155855 3300026075 Bacteria 1801
250 Ga0207702_10108751 3300026078 Bacteria 2461
251 Ga0207702_10156073 3300026078 Bacteria 2080
252 Ga0207641_10028749 3300026088 Bacteria 4596
253 Ga0207648_10003288 3300026089 Bacteria 16998
254 Ga0207648_10909351 3300026089 Bacteria 822
255 Ga0207676_10023920 3300026095 Bacteria 4514
256 Ga0207676_10751632 3300026095 Bacteria 948
257 Ga0207674_10543705 3300026116 Bacteria 1122
258 Ga0207675_100007677 3300026118 Bacteria 10178
259 Ga0207675_100467308 3300026118 Bacteria 1252
260 Ga0207683_10013207 3300026121 Bacteria 7044
261 Ga0207683_10046707 3300026121 Bacteria 3791
262 Ga0207683_10303141 3300026121 Bacteria 1462
263 Ga0207698_10015844 3300026142 Bacteria 5064
264 Ga0268266_10807676 3300028379 Bacteria 906
265 Ga0268265_10246934 3300028380 Bacteria 1578
266 Ga0268264_10030844 3300028381 Bacteria 4395
267 Ga0268264_10280727 3300028381 Bacteria 1560
268 Ga0265332_10050577 3300031238 Bacteria 1786
269 Ga0265328_10000010 3300031239 Bacteria 163171
270 Ga0265328_10001421 3300031239 Bacteria 11015
271 Ga0265328_10010923 3300031239 Bacteria 3643
272 Ga0265325_10013504 3300031241 Bacteria 4649
273 Ga0265331_10001102 3300031250 Bacteria 20789
274 Ga0265327_10037535 3300031251 Bacteria 2651
275 Ga0265316_10015406 3300031344 Bacteria 6685
276 Ga0307408_100015997 3300031548 Bacteria 5002
277 Ga0307408_100153245 3300031548 Bacteria 1822
278 Ga0265313_10008643 3300031595 Bacteria 6735
279 Ga0265313_10019389 3300031595 Bacteria 3786
280 Ga0307413_10037346 3300031824 Bacteria 2805
281 Ga0307407_10019982 3300031903 Bacteria 3421
282 Ga0307412_10815399 3300031911 Bacteria 811
283 Ga0307414_10045273 3300032004 Bacteria 3012
284 Ga0307411_10015213 3300032005 Bacteria 4314
285 Ga0307415_100043901 3300032126 Bacteria 2985
286 Ga0373926_0051915 3300035083 Bacteria 1481
287 Ga0373944_0082701 3300035089 Bacteria 1063
288 Ga0373952_0066395 3300035092 Bacteria 893
289 Ga0373939_0047508 3300035114 Bacteria 1319
290 Ga0373945_0003434 3300035116 Bacteria 4985
291 Ga0373957_0068494 3300035120 Bacteria 1384
292 Ga0373943_0022910 3300035170 Bacteria 2899
293 Ga0373955_0048835 3300035172 Bacteria 2296
294 Ga0373935_0254805 3300035692 Bacteria 1229
295 Ga0373927_0015276 3300035695 Bacteria 5071
296 Ga0373927_0083737 3300035695 Bacteria 2068
297 Ga0373933_0029565 3300035724 Bacteria 3169
298 Ga0373947_0009074 3300035725 Bacteria 5715
299 Ga0373947_0171219 3300035725 Bacteria 1409
300 Ga0373937_0005630 3300036401 Bacteria 10756
301 Ga0373937_0228568 3300036401 Bacteria 1752
302 Ga0373925_0020794 3300037068 Bacteria 4782
303 Ga0373925_0397790 3300037068 Bacteria 1123
304 Ga0395905_0095778 3300037471 Bacteria 2786
305 Ga0436365_0543732 3300039437 Bacteria 5982
306 Ga0436361_0470625 3300039447 Bacteria 6493
307 Ga0436363_1602549 3300039450 Bacteria 1646
308 Ga0439436_0087425 3300041404 Bacteria 868
309 Ga0439453_0006596 3300041408 Bacteria 1813
310 Ga0439435_0061415 3300042436 Bacteria 1095
311 Ga0439444_0034779 3300042437 Bacteria 963
312 Ga0466972_0034934 3300044658 Bacteria 2461
313 Ga0466957_0120407 3300044842 Bacteria 1673
314 Ga0466960_0090078 3300044901 Bacteria 1562
315 Ga0466967_0251666 3300045976 Bacteria 1688
316 Ga0495617_036188 3300046452 Bacteria 1656
317 Ga0495592_0186359 3300046454 Bacteria 1409
318 Ga0495603_0001783 3300046455 Bacteria 12698
319 Ga0495629_0121765 3300046459 Bacteria 1817
320 Ga0495629_0442885 3300046459 Bacteria 880
321 Ga0495638_0068869 3300046460 Bacteria 2169
322 Ga0495651_0023009 3300046462 Bacteria 4846
323 Ga0495653_0058010 3300046463 Bacteria 2943
324 Ga0495662_0089057 3300046476 Bacteria 1504
325 Ga0495664_0035719 3300046477 Bacteria 2928
326 Ga0495584_0009408 3300046491 Bacteria 5034
327 Ga0495584_0082128 3300046491 Bacteria 1622
328 Ga0495608_0025664 3300046511 Bacteria 4023
329 Ga0495608_0297476 3300046511 Bacteria 1000
330 Ga0495616_0052819 3300046513 Bacteria 2022
331 Ga0495630_0116502 3300046517 Bacteria 2025
332 Ga0495630_0264793 3300046517 Bacteria 1313
333 Ga0495663_0049330 3300046525 Bacteria 1300
334 Ga0495652_0195579 3300046529 Bacteria 1539
335 Ga0495640_0351445 3300046533 Bacteria 910
336 Ga0495587_0105450 3300046536 Bacteria 1621
337 Ga0495598_0187987 3300046537 Bacteria 740
338 Ga0495621_0032015 3300046539 Bacteria 1807
339 Ga0495633_0030278 3300046558 Bacteria 2630
340 Ga0495667_0108618 3300046559 Bacteria 1792
341 Ga0495656_0015253 3300046615 Bacteria 2898
342 Ga0495668_0008338 3300046616 Bacteria 6489
343 Ga0495668_0103220 3300046616 Bacteria 1560
344 Ga0495668_0381688 3300046616 Bacteria 774
345 Ga0495634_0007164 3300046642 Bacteria 8409
346 Ga0495659_0018100 3300046664 Bacteria 2343
347 Ga0495588_0040320 3300046674 Bacteria 2381
348 Ga0495657_0071269 3300046675 Bacteria 2269
349 Ga0495623_0014821 3300046679 Bacteria 5041
350 Ga0495624_0191858 3300046690 Bacteria 1243
351 Ga0495670_0181705 3300046691 Bacteria 1111
352 Ga0495649_0053171 3300046694 Bacteria 2193
353 Ga0495674_0096156 3300047319 Bacteria 2525
354 Ga0495676_0027307 3300047321 Bacteria 4896
355 Ga0495675_0018898 3300047444 Bacteria 4379
356 Ga0495685_101630 3300047447 Bacteria 949
357 Ga0495602_0115716 3300048088 Bacteria 2168
358 Ga0496100_0005367 3300048903 Bacteria 6894
359 Ga0496100_0079391 3300048903 Bacteria 2211
360 Ga0496100_0166578 3300048903 Bacteria 1584
361 Ga0496100_0306497 3300048903 Bacteria 1190
362 Ga0496100_0548471 3300048903 Bacteria 894
363 Ga0496101_0090868 3300048904 Bacteria 2271
364 Ga0496101_0545705 3300048904 Bacteria 916
365 Ga0496102_0009701 3300048905 Bacteria 8277
366 Ga0496102_0022167 3300048905 Bacteria 5626
367 Ga0496102_0231460 3300048905 Bacteria 1742
368 Ga0496103_0006468 3300048906 Bacteria 6988
369 Ga0496104_0000202 3300048907 Bacteria 53215
370 Ga0496104_0000260 3300048907 Bacteria 46567
371 Ga0496104_0004193 3300048907 Bacteria 12521
372 Ga0496104_0008101 3300048907 Bacteria 9323
373 Ga0496104_0103707 3300048907 Bacteria 2725
374 Ga0496104_0131435 3300048907 Bacteria 2404
375 Ga0496104_0298772 3300048907 Bacteria 1522
376 Ga0496105_0000156 3300048908 Bacteria 45175
377 Ga0496105_0019454 3300048908 Bacteria 5476
378 Ga0496105_0019738 3300048908 Bacteria 5438
379 Ga0496105_0064703 3300048908 Bacteria 3017
380 Ga0496105_0069588 3300048908 Bacteria 2908
381 Ga0496106_0011210 3300048909 Bacteria 6633
382 Ga0496106_0693668 3300048909 Bacteria 812
383 Ga0496107_0008161 3300048910 Bacteria 7241
384 Ga0496107_0008292 3300048910 Bacteria 7187
385 Ga0496107_0449831 3300048910 Bacteria 957
386 Ga0496108_0025516 3300048911 Bacteria 4870
387 Ga0496108_0045810 3300048911 Bacteria 3653
388 Ga0496108_0112328 3300048911 Bacteria 2331
389 Ga0496108_0159971 3300048911 Bacteria 1946
390 Ga0496108_0261882 3300048911 Bacteria 1505
391 Ga0496108_0336982 3300048911 Bacteria 1316
392 Ga0496109_0004178 3300048912 Bacteria 12048
393 Ga0496109_0022019 3300048912 Bacteria 5642
394 Ga0496110_0006465 3300048913 Bacteria 9287
395 Ga0496110_0024973 3300048913 Bacteria 5100
396 Ga0496110_0125212 3300048913 Bacteria 2318
397 Ga0496110_1062773 3300048913 Bacteria 717
398 Ga0496111_0009761 3300048914 Bacteria 6415
399 Ga0496111_0387450 3300048914 Bacteria 1033
400 Ga0496112_0009866 3300048915 Bacteria 8630
401 Ga0496112_0027080 3300048915 Bacteria 5525
402 Ga0496112_0114276 3300048915 Bacteria 2670
403 Ga0496112_0196854 3300048915 Bacteria 1975
404 Ga0496112_0305132 3300048915 Bacteria 1537
405 Ga0496113_0003007 3300048916 Bacteria 9986
406 Ga0496113_0032019 3300048916 Bacteria 3819
407 Ga0496113_0050663 3300048916 Bacteria 3096
408 Ga0496114_0029645 3300048917 Bacteria 4499
409 Ga0496114_0037317 3300048917 Bacteria 4018
410 Ga0496115_0014453 3300048918 Bacteria 5975
411 Ga0496115_0028132 3300048918 Bacteria 4403
412 Ga0496115_0041793 3300048918 Bacteria 3650
413 Ga0496115_0571159 3300048918 Bacteria 902
414 Ga0496115_0625048 3300048918 Bacteria 854
415 Ga0496117_0270032 3300048920 Bacteria 917
416 Ga0496119_0002613 3300048922 Bacteria 19538
417 Ga0496126_0226763 3300048929 Bacteria 1567
418 Ga0501306_019225 3300049127 Bacteria 941
419 Ga0501308_009456 3300049128 Bacteria 1065
420 Ga0501309_030687 3300049129 Bacteria 792
421 Ga0501310_018927 3300049130 Bacteria 844
422 Ga0501304_014355 3300049160 Bacteria 733
423 Ga0501305_012167 3300049161 Bacteria 1173
424 Ga0501305_044024 3300049161 Bacteria 733
425 Ga0501311_042001 3300049527 Bacteria 696
426 Ga0501312_014540 3300049528 Bacteria 1107
427 Ga0501313_017286 3300049529 Bacteria 871
428 Ga0501316_008998 3300049532 Bacteria 1113
429 Ga0501317_006992 3300049533 Bacteria 1260
430 Ga0501318_009611 3300049534 Bacteria 1058
431 Ga0501319_003502 3300049535 Bacteria 1053
432 Ga0501321_013766 3300049537 Bacteria 933
433 Ga0501323_013589 3300049539 Bacteria 1008
434 Ga0501325_006804 3300049541 Bacteria 951
435 Ga0501031_0056930 3300049568 Bacteria 2547
436 Ga0501033_0126702 3300049570 Bacteria 1851
437 Ga0501034_0337156 3300049571 Bacteria 1438
438 Ga0501036_0109474 3300049572 Bacteria 2334
439 Ga0501037_0284488 3300049573 Bacteria 1151
440 Ga0501037_0526458 3300049573 Bacteria 800
441 Ga0501038_0704851 3300049574 Bacteria 756
442 Ga0501039_0300831 3300049575 Bacteria 1261
443 Ga0501041_0138214 3300049577 Bacteria 1519
444 Ga0501042_0020983 3300049578 Bacteria 4550
445 Ga0501042_0130139 3300049578 Bacteria 1814
446 Ga0501043_0134187 3300049579 Bacteria 1939
447 Ga0501046_0407051 3300049580 Bacteria 982
448 Ga0501068_0095967 3300049584 Bacteria 1834
449 Ga0501070_0241834 3300049586 Bacteria 1477
450 Ga0501071_0286963 3300049587 Bacteria 1246
451 Ga0501072_0007397 3300049588 Bacteria 8330
452 Ga0501072_0113716 3300049588 Bacteria 2155
453 Ga0501072_0322428 3300049588 Bacteria 1228
454 Ga0501074_0092562 3300049590 Bacteria 2165
455 Ga0501075_0021403 3300049591 Bacteria 4714
456 Ga0501075_0123881 3300049591 Bacteria 1967
457 Ga0501075_0157732 3300049591 Bacteria 1731
458 Ga0501076_0019223 3300049592 Bacteria 5219
459 Ga0501076_0519921 3300049592 Bacteria 981
460 Ga0501077_0007343 3300049593 Bacteria 6796
461 Ga0501238_036606 3300049671 Bacteria 716
462 Ga0501079_0036769 3300049741 Bacteria 3771
463 Ga0501080_0383040 3300049742 Bacteria 1267
464 Ga0501081_0061691 3300049743 Bacteria 2600
465 Ga0501035_0043892 3300049822 Bacteria 4028
466 Ga0501044_0031635 3300049823 Bacteria 5568
467 Ga0501044_0240457 3300049823 Bacteria 1754
468 Ga0501045_0033442 3300049824 Bacteria 3728
469 nmdc:mga03683_153026_c1 3300050489 Bacteria 1041
470 nmdc:mga03683_15601_c1 3300050489 Bacteria 2837
471 nmdc:mga03683_17189_c1 3300050489 Bacteria 2734
472 nmdc:mga03n38_23275_c1 3300050490 Bacteria 2517
473 nmdc:mga03n38_68206_c1 3300050490 Bacteria 1639
474 nmdc:mga00v17_6824_c1 3300050491 Bacteria 6066
475 nmdc:mga0yw44_108607_c1 3300050492 Bacteria 1776
476 nmdc:mga0yw44_195186_c1 3300050492 Bacteria 1336
477 nmdc:mga0yw44_19950_c1 3300050492 Bacteria 3709
478 nmdc:mga0yw44_500568_c1 3300050492 Bacteria 824
479 nmdc:mga0yw44_57532_c1 3300050492 Bacteria 2372
480 nmdc:mga0yw44_63467_c1 3300050492 Bacteria 2271
481 nmdc:mga0yw44_98050_c1 3300050492 Bacteria 1863
482 nmdc:mga0k408_84697_c1 3300050493 Bacteria 1860
483 nmdc:mga06z11_247362_c1 3300050494 Bacteria 1049
484 nmdc:mga05p37_120409_c1 3300050507 Bacteria 3225
485 nmdc:mga05p37_13259_c1 3300050507 Bacteria 9868
486 nmdc:mga05p37_20387_c1 3300050507 Bacteria 8019
487 nmdc:mga05p37_31741_c1 3300050507 Bacteria 6456
488 nmdc:mga05p37_715444_c1 3300050507 Bacteria 1110
489 nmdc:mga05p37_9157_c1 3300050507 Bacteria 11705
490 nmdc:mga09592_232594_c1 3300050508 Bacteria 1597
491 nmdc:mga09592_461865_c1 3300050508 Bacteria 1095
492 nmdc:mga0qj67_260114_c1 3300050509 Bacteria 1408
493 nmdc:mga06r32_119899_c1 3300050510 Bacteria 2594
494 nmdc:mga06r32_157496_c1 3300050510 Bacteria 2253
495 nmdc:mga06r32_164036_c1 3300050510 Bacteria 2205
496 nmdc:mga06r32_232609_c1 3300050510 Bacteria 1831
497 nmdc:mga06r32_287975_c1 3300050510 Bacteria 1629
498 nmdc:mga08y16_18532_c1 3300050511 Bacteria 7333
499 nmdc:mga08y16_20827_c1 3300050511 Bacteria 6922
500 nmdc:mga08y16_316432_c1 3300050511 Bacteria 1607
501 nmdc:mga08y16_841610_c1 3300050511 Bacteria 907
502 nmdc:mga0n895_14122_c1 3300050512 Bacteria 7240
503 nmdc:mga0n895_19141_c1 3300050512 Bacteria 6356
504 nmdc:mga0n895_78686_c1 3300050512 Bacteria 3282
505 Ga0495601_0228465 3300053077 Bacteria 1215
506 Ga0495601_0664244 3300053077 Unclassified 666
507 Ga0495655_0027974 3300053083 Bacteria 1342
508 Ga0495655_0034819 3300053083 Bacteria 1248
509 Ga0495595_0103548 3300053084 Bacteria 1375
510 Ga0495595_0109410 3300053084 Bacteria 1339
511 Ga0495595_0225482 3300053084 Bacteria 935
512 Ga0495619_0054783 3300053085 Bacteria 2640
513 Ga0495619_0102761 3300053085 Bacteria 1946
514 Ga0495619_0469837 3300053085 Bacteria 866
515 Ga0500568_0031574 3300053139 Bacteria 2184
516 Ga0501084_0037282 3300054114 Bacteria 4061
517 Ga0501084_0147018 3300054114 Bacteria 1985
518 Ga0501084_0660095 3300054114 Bacteria 883
519 Ga0501082_0000285 3300060353 Bacteria 44550
520 Ga0501082_0082196 3300060353 Bacteria 2779
521 Ga0501082_0333473 3300060353 Bacteria 1322
522 Ga0530510_0176182 3300061734 Bacteria 1585

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046511 Ga0495608_0297476 Ga0495608_0297476_341_973 169
2 3300048911 Ga0496108_0045810 Ga0496108_0045810_21_653 169
3 3300048915 Ga0496112_0009866 Ga0496112_0009866_7978_8610 169
4 3300050510 nmdc:mga06r32_287975_c1 nmdc:mga06r32_287975_c1_949_1593 169
5 3300053077 Ga0495601_0664244 Ga0495601_0664244_16_654 172
6 3300006038 Ga0075365_10034678 Ga0075365_100346784 181
7 3300050492 nmdc:mga0yw44_63467_c1 nmdc:mga0yw44_63467_c1_445_1179 181
8 3300048920 Ga0496117_0270032 Ga0496117_0270032_314_895 184
9 3300044842 Ga0466957_0120407 Ga0466957_0120407_835_1482 185
10 3300049573 Ga0501037_0526458 Ga0501037_0526458_59_727 185
11 3300049578 Ga0501042_0020983 Ga0501042_0020983_2208_2987 185
12 3300049591 Ga0501075_0021403 Ga0501075_0021403_1817_2596 185
13 3300049824 Ga0501045_0033442 Ga0501045_0033442_732_1511 185
14 3300049541 Ga0501325_006804 Ga0501325_006804_286_864 186
15 3300049568 Ga0501031_0056930 Ga0501031_0056930_83_823 187
16 3300049570 Ga0501033_0126702 Ga0501033_0126702_539_1279 187
17 3300049571 Ga0501034_0337156 Ga0501034_0337156_512_1252 187
18 3300049573 Ga0501037_0284488 Ga0501037_0284488_33_773 187
19 3300049575 Ga0501039_0300831 Ga0501039_0300831_290_1030 187
20 3300049580 Ga0501046_0407051 Ga0501046_0407051_91_831 187
21 3300049586 Ga0501070_0241834 Ga0501070_0241834_418_1158 187
22 3300049822 Ga0501035_0043892 Ga0501035_0043892_209_949 187
23 3300049823 Ga0501044_0240457 Ga0501044_0240457_569_1309 187
24 3300050493 nmdc:mga0k408_84697_c1 nmdc:mga0k408_84697_c1_299_1024 188
25 3300031239 Ga0265328_10010923 Ga0265328_100109235 189
26 3300031250 Ga0265331_10001102 Ga0265331_1000110210 189
27 3300031251 Ga0265327_10037535 Ga0265327_100375352 189
28 3300031344 Ga0265316_10015406 Ga0265316_100154065 189
29 3300046459 Ga0495629_0442885 Ga0495629_0442885_85_756 189
30 3300046533 Ga0495640_0351445 Ga0495640_0351445_138_809 189
31 3300048907 Ga0496104_0000260 Ga0496104_0000260_16986_17624 189
32 3300048907 Ga0496104_0004193 Ga0496104_0004193_11198_11836 189
33 3300048908 Ga0496105_0000156 Ga0496105_0000156_27552_28190 189
34 3300048908 Ga0496105_0064703 Ga0496105_0064703_2107_2745 189
35 3300048911 Ga0496108_0159971 Ga0496108_0159971_1020_1658 189
36 3300048913 Ga0496110_0125212 Ga0496110_0125212_339_977 189
37 3300048915 Ga0496112_0196854 Ga0496112_0196854_422_1060 189
38 3300048916 Ga0496113_0050663 Ga0496113_0050663_784_1422 189
39 3300048917 Ga0496114_0037317 Ga0496114_0037317_783_1421 189
40 3300048918 Ga0496115_0028132 Ga0496115_0028132_1274_1912 189
41 3300048922 Ga0496119_0002613 Ga0496119_0002613_1323_1961 189
42 3300005981 Ga0081538_10048294 Ga0081538_100482941 190
43 3300006048 Ga0075363_100021074 Ga0075363_1000210744 190
44 3300006178 Ga0075367_10232745 Ga0075367_102327452 190
45 3300013306 Ga0163162_10759904 Ga0163162_107599042 190
46 3300031239 Ga0265328_10000010 Ga0265328_1000001062 190
47 3300035692 Ga0373935_0254805 Ga0373935_0254805_286_999 190
48 3300036401 Ga0373937_0005630 Ga0373937_0005630_3541_4254 190
49 3300049532 Ga0501316_008998 Ga0501316_008998_513_1103 190
50 3300049537 Ga0501321_013766 Ga0501321_013766_333_923 190
51 3300050490 nmdc:mga03n38_23275_c1 nmdc:mga03n38_23275_c1_1590_2312 190
52 3300050494 nmdc:mga06z11_247362_c1 nmdc:mga06z11_247362_c1_110_832 190
53 3300031239 Ga0265328_10001421 Ga0265328_100014215 191
54 3300009093 Ga0105240_11120164 Ga0105240_111201641 192
55 3300013307 Ga0157372_10048129 Ga0157372_100481295 192
56 3300025924 Ga0207694_10036200 Ga0207694_100362006 192
57 3300049574 Ga0501038_0704851 Ga0501038_0704851_33_746 192
58 3300010375 Ga0105239_10298624 Ga0105239_102986243 193
59 3300035120 Ga0373957_0068494 Ga0373957_0068494_49_765 193
60 3300048918 Ga0496115_0571159 Ga0496115_0571159_16_735 193
61 3300005840 Ga0068870_10408053 Ga0068870_104080531 194
62 3300006871 Ga0075434_100057530 Ga0075434_1000575305 194
63 3300009094 Ga0111539_10116751 Ga0111539_101167514 194
64 3300025933 Ga0207706_10394038 Ga0207706_103940382 194
65 3300025940 Ga0207691_10340284 Ga0207691_103402842 194
66 3300026075 Ga0207708_10148589 Ga0207708_101485892 194
67 3300026121 Ga0207683_10303141 Ga0207683_103031412 194
68 3300046537 Ga0495598_0187987 Ga0495598_0187987_39_662 194
69 3300050512 nmdc:mga0n895_78686_c1 nmdc:mga0n895_78686_c1_1192_1965 194
70 3300006186 Ga0075369_10130192 Ga0075369_101301921 195
71 3300009545 Ga0105237_10955188 Ga0105237_109551881 195
72 3300025913 Ga0207695_10368494 Ga0207695_103684941 195
73 3300025914 Ga0207671_10154406 Ga0207671_101544061 195
74 3300039450 Ga0436363_1602549 Ga0436363_1602549_624_1397 195
75 3300048929 Ga0496126_0226763 Ga0496126_0226763_833_1468 195
76 iso_pu_bacteria 2508501114 2509077589 195
77 iso_pu_bacteria 2773857925 2774870405 195
78 iso_pu_bacteria 2775506901 2776258569 195
79 iso_pu_bacteria 2835312727 2835315197 195
80 iso_pu_bacteria 2882456835 2882460541 195
81 iso_pu_bacteria 2884298095 2884301005 195
82 iso_pu_bacteria 2894232714 2894233848 195
83 3300005435 Ga0070714_100007212 Ga0070714_1000072128 196
84 3300005436 Ga0070713_100000796 Ga0070713_10000079615 196
85 3300005437 Ga0070710_10006756 Ga0070710_100067561 196
86 3300005439 Ga0070711_100005690 Ga0070711_1000056907 196
87 3300005937 Ga0081455_10007086 Ga0081455_100070865 196
88 3300006028 Ga0070717_10002581 Ga0070717_1000258114 196
89 3300006163 Ga0070715_10000954 Ga0070715_1000095412 196
90 3300006173 Ga0070716_100007225 Ga0070716_1000072258 196
91 3300006175 Ga0070712_100007553 Ga0070712_1000075537 196
92 3300006844 Ga0075428_100249810 Ga0075428_1002498103 196
93 3300006844 Ga0075428_100539617 Ga0075428_1005396171 196
94 3300006871 Ga0075434_100455985 Ga0075434_1004559852 196
95 3300006880 Ga0075429_100209297 Ga0075429_1002092972 196
96 3300006880 Ga0075429_100260893 Ga0075429_1002608931 196
97 3300021384 Ga0213876_10024133 Ga0213876_100241334 196
98 3300025898 Ga0207692_10000204 Ga0207692_1000020413 196
99 3300025916 Ga0207663_10000528 Ga0207663_1000052812 196
100 3300025928 Ga0207700_10551367 Ga0207700_105513671 196
101 3300025929 Ga0207664_10001315 Ga0207664_1000131515 196
102 3300031548 Ga0307408_100153245 Ga0307408_1001532452 196
103 3300031911 Ga0307412_10815399 Ga0307412_108153991 196
104 3300039437 Ga0436365_0543732 Ga0436365_0543732_3640_4365 196
105 3300039447 Ga0436361_0470625 Ga0436361_0470625_4315_4998 196
106 3300046616 Ga0495668_0008338 Ga0495668_0008338_2320_2976 196
107 3300048903 Ga0496100_0166578 Ga0496100_0166578_540_1313 196
108 3300049539 Ga0501323_013589 Ga0501323_013589_334_942 196
109 3300050508 nmdc:mga09592_232594_c1 nmdc:mga09592_232594_c1_161_901 196
110 3300050510 nmdc:mga06r32_119899_c1 nmdc:mga06r32_119899_c1_400_1134 196
111 iso_pu_bacteria 2508501050 2508730570 196
112 iso_pu_bacteria 2545555834 2545677858 196
113 iso_pu_bacteria 3003665799 3003666752 196
114 iso_pu_bacteria 641522639 641642616 196
115 iso_pu_bacteria 643348564 643600527 196
116 iso_pu_bacteria 8002060224 8002060295 196
117 3300006051 Ga0075364_10006653 Ga0075364_100066534 197
118 3300006177 Ga0075362_10017621 Ga0075362_100176213 197
119 3300006195 Ga0075366_10080248 Ga0075366_100802483 197
120 3300006844 Ga0075428_100410974 Ga0075428_1004109742 197
121 3300006880 Ga0075429_100488389 Ga0075429_1004883891 197
122 3300009147 Ga0114129_10318044 Ga0114129_103180443 197
123 3300036401 Ga0373937_0228568 Ga0373937_0228568_784_1536 197
124 3300037471 Ga0395905_0095778 Ga0395905_0095778_117_731 197
125 3300044658 Ga0466972_0034934 Ga0466972_0034934_1090_1695 197
126 3300046642 Ga0495634_0007164 Ga0495634_0007164_3785_4537 197
127 3300049588 Ga0501072_0007397 Ga0501072_0007397_1584_2306 197
128 3300050489 nmdc:mga03683_17189_c1 nmdc:mga03683_17189_c1_810_1523 197
129 3300050490 nmdc:mga03n38_68206_c1 nmdc:mga03n38_68206_c1_775_1488 197
130 3300050491 nmdc:mga00v17_6824_c1 nmdc:mga00v17_6824_c1_4177_4890 197
131 3300050507 nmdc:mga05p37_31741_c1 nmdc:mga05p37_31741_c1_4482_5264 197
132 3300050508 nmdc:mga09592_461865_c1 nmdc:mga09592_461865_c1_72_854 197
133 3300054114 Ga0501084_0037282 Ga0501084_0037282_2669_3391 197
134 3300005336 Ga0070680_100483928 Ga0070680_1004839282 198
135 3300005338 Ga0068868_100196884 Ga0068868_1001968843 198
136 3300005347 Ga0070668_100112002 Ga0070668_1001120022 198
137 3300005355 Ga0070671_100000672 Ga0070671_1000006725 198
138 3300005364 Ga0070673_100003747 Ga0070673_1000037479 198
139 3300005365 Ga0070688_100117511 Ga0070688_1001175113 198
140 3300005366 Ga0070659_100416125 Ga0070659_1004161251 198
141 3300005367 Ga0070667_100165167 Ga0070667_1001651673 198
142 3300005435 Ga0070714_100049173 Ga0070714_1000491731 198
143 3300005544 Ga0070686_100252960 Ga0070686_1002529602 198
144 3300005548 Ga0070665_100293292 Ga0070665_1002932922 198
145 3300005548 Ga0070665_100508889 Ga0070665_1005088892 198
146 3300005564 Ga0070664_100074547 Ga0070664_1000745473 198
147 3300005618 Ga0068864_100050382 Ga0068864_1000503824 198
148 3300005841 Ga0068863_100655177 Ga0068863_1006551772 198
149 3300005983 Ga0081540_1000300 Ga0081540_100030027 198
150 3300005985 Ga0081539_10005758 Ga0081539_100057588 198
151 3300006028 Ga0070717_10041261 Ga0070717_100412613 198
152 3300006237 Ga0097621_100174628 Ga0097621_1001746282 198
153 3300009098 Ga0105245_10001599 Ga0105245_1000159917 198
154 3300009101 Ga0105247_10054671 Ga0105247_100546713 198
155 3300009177 Ga0105248_10023331 Ga0105248_100233318 198
156 3300009177 Ga0105248_10226870 Ga0105248_102268703 198
157 3300009551 Ga0105238_10043918 Ga0105238_100439182 198
158 3300009551 Ga0105238_10184594 Ga0105238_101845942 198
159 3300011119 Ga0105246_10108322 Ga0105246_101083223 198
160 3300013306 Ga0163162_10127939 Ga0163162_101279393 198
161 3300014325 Ga0163163_11063764 Ga0163163_110637641 198
162 3300014497 Ga0182008_10178073 Ga0182008_101780731 198
163 3300014745 Ga0157377_10213779 Ga0157377_102137792 198
164 3300015262 Ga0182007_10048195 Ga0182007_100481951 198
165 3300025315 Ga0207697_10044697 Ga0207697_100446972 198
166 3300025900 Ga0207710_10058788 Ga0207710_100587883 198
167 3300025903 Ga0207680_10325105 Ga0207680_103251051 198
168 3300025908 Ga0207643_10046631 Ga0207643_100466314 198
169 3300025918 Ga0207662_10032318 Ga0207662_100323184 198
170 3300025923 Ga0207681_10223533 Ga0207681_102235331 198
171 3300025937 Ga0207669_10061202 Ga0207669_100612022 198
172 3300025941 Ga0207711_10079300 Ga0207711_100793003 198
173 3300025941 Ga0207711_10394621 Ga0207711_103946211 198
174 3300025960 Ga0207651_10014393 Ga0207651_100143934 198
175 3300025986 Ga0207658_10102588 Ga0207658_101025882 198
176 3300026023 Ga0207677_10058079 Ga0207677_100580793 198
177 3300026023 Ga0207677_10966858 Ga0207677_109668581 198
178 3300026035 Ga0207703_10227555 Ga0207703_102275552 198
179 3300026118 Ga0207675_100467308 Ga0207675_1004673082 198
180 3300026121 Ga0207683_10046707 Ga0207683_100467072 198
181 3300028379 Ga0268266_10807676 Ga0268266_108076761 198
182 3300028381 Ga0268264_10280727 Ga0268264_102807272 198
183 3300031238 Ga0265332_10050577 Ga0265332_100505772 198
184 3300031595 Ga0265313_10008643 Ga0265313_100086432 198
185 3300045976 Ga0466967_0251666 Ga0466967_0251666_746_1366 198
186 3300046460 Ga0495638_0068869 Ga0495638_0068869_352_1050 198
187 3300048905 Ga0496102_0231460 Ga0496102_0231460_69_806 198
188 3300048907 Ga0496104_0000202 Ga0496104_0000202_21478_22215 198
189 3300048907 Ga0496104_0103707 Ga0496104_0103707_28_765 198
190 3300048908 Ga0496105_0019738 Ga0496105_0019738_2053_2790 198
191 3300048910 Ga0496107_0449831 Ga0496107_0449831_62_799 198
192 3300048911 Ga0496108_0112328 Ga0496108_0112328_1269_2009 198
193 3300048911 Ga0496108_0261882 Ga0496108_0261882_569_1306 198
194 3300048913 Ga0496110_1062773 Ga0496110_1062773_53_673 198
195 3300048914 Ga0496111_0387450 Ga0496111_0387450_151_888 198
196 3300048915 Ga0496112_0114276 Ga0496112_0114276_1914_2651 198
197 3300048915 Ga0496112_0305132 Ga0496112_0305132_160_900 198
198 3300048918 Ga0496115_0041793 Ga0496115_0041793_971_1708 198
199 3300048918 Ga0496115_0625048 Ga0496115_0625048_55_792 198
200 3300049588 Ga0501072_0113716 Ga0501072_0113716_1262_1993 198
201 3300049743 Ga0501081_0061691 Ga0501081_0061691_188_919 198
202 3300050511 nmdc:mga08y16_841610_c1 nmdc:mga08y16_841610_c1_152_769 198
203 3300053139 Ga0500568_0031574 Ga0500568_0031574_599_1321 198
204 3300060353 Ga0501082_0000285 Ga0501082_0000285_4888_5610 198
205 3300003162 Ga0006778J45830_1079432 Ga0006778J45830_10794321 199
206 3300003579 Ga0007429J51699_1076873 Ga0007429J51699_10768731 199
207 3300005330 Ga0070690_100108953 Ga0070690_1001089532 199
208 3300005340 Ga0070689_100156434 Ga0070689_1001564342 199
209 3300005347 Ga0070668_100240052 Ga0070668_1002400521 199
210 3300005347 Ga0070668_100515784 Ga0070668_1005157841 199
211 3300005353 Ga0070669_100200275 Ga0070669_1002002751 199
212 3300005354 Ga0070675_100341870 Ga0070675_1003418701 199
213 3300005441 Ga0070700_100072426 Ga0070700_1000724262 199
214 3300005441 Ga0070700_100249225 Ga0070700_1002492252 199
215 3300005615 Ga0070702_101043443 Ga0070702_1010434431 199
216 3300005618 Ga0068864_100222281 Ga0068864_1002222813 199
217 3300005719 Ga0068861_100278121 Ga0068861_1002781212 199
218 3300005841 Ga0068863_100502034 Ga0068863_1005020342 199
219 3300005842 Ga0068858_101188587 Ga0068858_1011885871 199
220 3300005937 Ga0081455_10030017 Ga0081455_100300173 199
221 3300005937 Ga0081455_10178190 Ga0081455_101781902 199
222 3300005937 Ga0081455_10273290 Ga0081455_102732901 199
223 3300006038 Ga0075365_10454875 Ga0075365_104548751 199
224 3300006051 Ga0075364_10079593 Ga0075364_100795933 199
225 3300006175 Ga0070712_100000619 Ga0070712_10000061911 199
226 3300006177 Ga0075362_10113769 Ga0075362_101137692 199
227 3300006844 Ga0075428_100436657 Ga0075428_1004366572 199
228 3300006846 Ga0075430_100102074 Ga0075430_1001020742 199
229 3300006846 Ga0075430_100594903 Ga0075430_1005949031 199
230 3300006880 Ga0075429_100083869 Ga0075429_1000838693 199
231 3300009094 Ga0111539_10226118 Ga0111539_102261182 199
232 3300009094 Ga0111539_10248701 Ga0111539_102487014 199
233 3300009094 Ga0111539_10595019 Ga0111539_105950192 199
234 3300009098 Ga0105245_11125126 Ga0105245_111251261 199
235 3300009147 Ga0114129_10208397 Ga0114129_102083973 199
236 3300009148 Ga0105243_10152895 Ga0105243_101528953 199
237 3300009553 Ga0105249_10311956 Ga0105249_103119562 199
238 3300011119 Ga0105246_10143356 Ga0105246_101433561 199
239 3300014326 Ga0157380_10021927 Ga0157380_100219277 199
240 3300014745 Ga0157377_10031555 Ga0157377_100315554 199
241 3300014968 Ga0157379_10469559 Ga0157379_104695591 199
242 3300025901 Ga0207688_10019425 Ga0207688_100194255 199
243 3300025901 Ga0207688_10046525 Ga0207688_100465253 199
244 3300025903 Ga0207680_10257731 Ga0207680_102577312 199
245 3300025908 Ga0207643_10577077 Ga0207643_105770771 199
246 3300025910 Ga0207684_10435987 Ga0207684_104359872 199
247 3300025915 Ga0207693_10010125 Ga0207693_100101258 199
248 3300025923 Ga0207681_10108292 Ga0207681_101082922 199
249 3300025926 Ga0207659_10434235 Ga0207659_104342352 199
250 3300025926 Ga0207659_10518695 Ga0207659_105186952 199
251 3300025927 Ga0207687_10055506 Ga0207687_100555063 199
252 3300025935 Ga0207709_10422547 Ga0207709_104225471 199
253 3300025935 Ga0207709_10797924 Ga0207709_107979241 199
254 3300025940 Ga0207691_10280124 Ga0207691_102801242 199
255 3300025942 Ga0207689_10343978 Ga0207689_103439781 199
256 3300025961 Ga0207712_10361329 Ga0207712_103613292 199
257 3300026075 Ga0207708_10155855 Ga0207708_101558552 199
258 3300026089 Ga0207648_10909351 Ga0207648_109093511 199
259 3300026095 Ga0207676_10751632 Ga0207676_107516322 199
260 3300031548 Ga0307408_100015997 Ga0307408_1000159974 199
261 3300031824 Ga0307413_10037346 Ga0307413_100373462 199
262 3300031903 Ga0307407_10019982 Ga0307407_100199823 199
263 3300032004 Ga0307414_10045273 Ga0307414_100452733 199
264 3300032005 Ga0307411_10015213 Ga0307411_100152133 199
265 3300032126 Ga0307415_100043901 Ga0307415_1000439013 199
266 3300041404 Ga0439436_0087425 Ga0439436_0087425_103_720 199
267 3300041408 Ga0439453_0006596 Ga0439453_0006596_284_991 199
268 3300042436 Ga0439435_0061415 Ga0439435_0061415_194_901 199
269 3300042437 Ga0439444_0034779 Ga0439444_0034779_49_756 199
270 3300044901 Ga0466960_0090078 Ga0466960_0090078_183_797 199
271 3300046491 Ga0495584_0009408 Ga0495584_0009408_1487_2260 199
272 3300046616 Ga0495668_0381688 Ga0495668_0381688_24_746 199
273 3300048903 Ga0496100_0079391 Ga0496100_0079391_461_1186 199
274 3300048903 Ga0496100_0306497 Ga0496100_0306497_236_973 199
275 3300049127 Ga0501306_019225 Ga0501306_019225_222_839 199
276 3300049128 Ga0501308_009456 Ga0501308_009456_105_722 199
277 3300049129 Ga0501309_030687 Ga0501309_030687_15_635 199
278 3300049130 Ga0501310_018927 Ga0501310_018927_124_738 199
279 3300049160 Ga0501304_014355 Ga0501304_014355_105_722 199
280 3300049161 Ga0501305_012167 Ga0501305_012167_467_1084 199
281 3300049161 Ga0501305_044024 Ga0501305_044024_81_698 199
282 3300049527 Ga0501311_042001 Ga0501311_042001_44_661 199
283 3300049528 Ga0501312_014540 Ga0501312_014540_296_913 199
284 3300049529 Ga0501313_017286 Ga0501313_017286_220_837 199
285 3300049533 Ga0501317_006992 Ga0501317_006992_334_951 199
286 3300049534 Ga0501318_009611 Ga0501318_009611_428_1045 199
287 3300049535 Ga0501319_003502 Ga0501319_003502_105_722 199
288 3300049671 Ga0501238_036606 Ga0501238_036606_86_697 199
289 3300050489 nmdc:mga03683_153026_c1 nmdc:mga03683_153026_c1_75_806 199
290 3300050489 nmdc:mga03683_15601_c1 nmdc:mga03683_15601_c1_177_917 199
291 3300050492 nmdc:mga0yw44_19950_c1 nmdc:mga0yw44_19950_c1_2302_3054 199
292 3300050492 nmdc:mga0yw44_500568_c1 nmdc:mga0yw44_500568_c1_56_676 199
293 3300050492 nmdc:mga0yw44_57532_c1 nmdc:mga0yw44_57532_c1_1566_2297 199
294 3300050492 nmdc:mga0yw44_98050_c1 nmdc:mga0yw44_98050_c1_565_1284 199
295 3300050507 nmdc:mga05p37_715444_c1 nmdc:mga05p37_715444_c1_306_1046 199
296 3300050507 nmdc:mga05p37_9157_c1 nmdc:mga05p37_9157_c1_4332_5093 199
297 3300050509 nmdc:mga0qj67_260114_c1 nmdc:mga0qj67_260114_c1_553_1311 199
298 3300050510 nmdc:mga06r32_157496_c1 nmdc:mga06r32_157496_c1_606_1358 199
299 3300050510 nmdc:mga06r32_164036_c1 nmdc:mga06r32_164036_c1_916_1674 199
300 3300050511 nmdc:mga08y16_316432_c1 nmdc:mga08y16_316432_c1_306_1046 199
301 3300054114 Ga0501084_0660095 Ga0501084_0660095_134_865 199
302 3300002070 JGI24750J21931_1005917 JGI24750J21931_10059173 200
303 3300002077 JGI24744J21845_10002877 JGI24744J21845_100028772 200
304 3300005330 Ga0070690_100070710 Ga0070690_1000707103 200
305 3300005331 Ga0070670_100041769 Ga0070670_1000417693 200
306 3300005331 Ga0070670_100124344 Ga0070670_1001243443 200
307 3300005334 Ga0068869_100035515 Ga0068869_1000355154 200
308 3300005338 Ga0068868_100033994 Ga0068868_1000339944 200
309 3300005339 Ga0070660_100187988 Ga0070660_1001879882 200
310 3300005340 Ga0070689_100060355 Ga0070689_1000603552 200
311 3300005341 Ga0070691_10049601 Ga0070691_100496012 200
312 3300005343 Ga0070687_100000967 Ga0070687_1000009678 200
313 3300005345 Ga0070692_10040201 Ga0070692_100402011 200
314 3300005347 Ga0070668_100580654 Ga0070668_1005806541 200
315 3300005353 Ga0070669_100034089 Ga0070669_1000340892 200
316 3300005354 Ga0070675_100048010 Ga0070675_1000480103 200
317 3300005355 Ga0070671_100136600 Ga0070671_1001366002 200
318 3300005356 Ga0070674_100039927 Ga0070674_1000399271 200
319 3300005364 Ga0070673_100122532 Ga0070673_1001225323 200
320 3300005365 Ga0070688_100007633 Ga0070688_1000076337 200
321 3300005366 Ga0070659_100035055 Ga0070659_1000350553 200
322 3300005367 Ga0070667_100601137 Ga0070667_1006011371 200
323 3300005436 Ga0070713_100097225 Ga0070713_1000972254 200
324 3300005438 Ga0070701_10259005 Ga0070701_102590051 200
325 3300005439 Ga0070711_100325169 Ga0070711_1003251692 200
326 3300005456 Ga0070678_100254661 Ga0070678_1002546612 200
327 3300005457 Ga0070662_100054025 Ga0070662_1000540252 200
328 3300005459 Ga0068867_100076949 Ga0068867_1000769492 200
329 3300005466 Ga0070685_10077238 Ga0070685_100772381 200
330 3300005535 Ga0070684_100395598 Ga0070684_1003955982 200
331 3300005543 Ga0070672_100012217 Ga0070672_1000122177 200
332 3300005544 Ga0070686_100007538 Ga0070686_1000075386 200
333 3300005545 Ga0070695_100276594 Ga0070695_1002765941 200
334 3300005546 Ga0070696_100044773 Ga0070696_1000447734 200
335 3300005578 Ga0068854_100017535 Ga0068854_1000175353 200
336 3300005614 Ga0068856_100195515 Ga0068856_1001955153 200
337 3300005618 Ga0068864_100151427 Ga0068864_1001514272 200
338 3300005834 Ga0068851_10056745 Ga0068851_100567452 200
339 3300005840 Ga0068870_10001266 Ga0068870_100012666 200
340 3300005841 Ga0068863_100043980 Ga0068863_1000439803 200
341 3300005843 Ga0068860_100056464 Ga0068860_1000564642 200
342 3300005844 Ga0068862_100046677 Ga0068862_1000466772 200
343 3300006028 Ga0070717_10211816 Ga0070717_102118162 200
344 3300006178 Ga0075367_10219473 Ga0075367_102194732 200
345 3300006178 Ga0075367_10305040 Ga0075367_103050401 200
346 3300006237 Ga0097621_100070805 Ga0097621_1000708053 200
347 3300006358 Ga0068871_100007996 Ga0068871_1000079962 200
348 3300006847 Ga0075431_100227138 Ga0075431_1002271382 200
349 3300006871 Ga0075434_100042069 Ga0075434_1000420696 200
350 3300006871 Ga0075434_100042444 Ga0075434_1000424442 200
351 3300006871 Ga0075434_100116947 Ga0075434_1001169472 200
352 3300006881 Ga0068865_100385279 Ga0068865_1003852792 200
353 3300009094 Ga0111539_10051955 Ga0111539_100519551 200
354 3300009098 Ga0105245_10017232 Ga0105245_100172326 200
355 3300009101 Ga0105247_10094897 Ga0105247_100948972 200
356 3300009147 Ga0114129_10035882 Ga0114129_100358828 200
357 3300009147 Ga0114129_10054275 Ga0114129_100542756 200
358 3300009177 Ga0105248_10079118 Ga0105248_100791183 200
359 3300009545 Ga0105237_10222358 Ga0105237_102223583 200
360 3300013296 Ga0157374_10576799 Ga0157374_105767991 200
361 3300013297 Ga0157378_10104630 Ga0157378_101046302 200
362 3300013308 Ga0157375_10595237 Ga0157375_105952372 200
363 3300014325 Ga0163163_10188448 Ga0163163_101884483 200
364 3300014325 Ga0163163_10515328 Ga0163163_105153282 200
365 3300014326 Ga0157380_10019393 Ga0157380_100193932 200
366 3300014745 Ga0157377_10007242 Ga0157377_100072426 200
367 3300014968 Ga0157379_10115757 Ga0157379_101157571 200
368 3300014969 Ga0157376_10134039 Ga0157376_101340391 200
369 3300014969 Ga0157376_10377250 Ga0157376_103772502 200
370 3300017792 Ga0163161_10158664 Ga0163161_101586642 200
371 3300024227 Ga0228598_1002137 Ga0228598_10021373 200
372 3300025893 Ga0207682_10087917 Ga0207682_100879172 200
373 3300025899 Ga0207642_10011875 Ga0207642_100118752 200
374 3300025900 Ga0207710_10012249 Ga0207710_100122494 200
375 3300025901 Ga0207688_10009396 Ga0207688_100093961 200
376 3300025901 Ga0207688_10239960 Ga0207688_102399602 200
377 3300025904 Ga0207647_10024868 Ga0207647_100248684 200
378 3300025905 Ga0207685_10009407 Ga0207685_100094071 200
379 3300025907 Ga0207645_10006619 Ga0207645_100066193 200
380 3300025908 Ga0207643_10001834 Ga0207643_100018347 200
381 3300025911 Ga0207654_10032474 Ga0207654_100324743 200
382 3300025915 Ga0207693_10025821 Ga0207693_100258211 200
383 3300025918 Ga0207662_10002642 Ga0207662_100026427 200
384 3300025920 Ga0207649_10191032 Ga0207649_101910322 200
385 3300025920 Ga0207649_10345635 Ga0207649_103456351 200
386 3300025923 Ga0207681_10115579 Ga0207681_101155792 200
387 3300025925 Ga0207650_10012516 Ga0207650_100125167 200
388 3300025925 Ga0207650_10133287 Ga0207650_101332871 200
389 3300025926 Ga0207659_10005605 Ga0207659_100056056 200
390 3300025927 Ga0207687_10191338 Ga0207687_101913382 200
391 3300025928 Ga0207700_10214718 Ga0207700_102147181 200
392 3300025931 Ga0207644_10028611 Ga0207644_100286112 200
393 3300025932 Ga0207690_10194458 Ga0207690_101944582 200
394 3300025933 Ga0207706_10008800 Ga0207706_1000880010 200
395 3300025934 Ga0207686_10183774 Ga0207686_101837742 200
396 3300025935 Ga0207709_10009444 Ga0207709_100094443 200
397 3300025936 Ga0207670_10026014 Ga0207670_100260143 200
398 3300025937 Ga0207669_10013794 Ga0207669_100137942 200
399 3300025940 Ga0207691_10011401 Ga0207691_100114013 200
400 3300025941 Ga0207711_10406384 Ga0207711_104063842 200
401 3300025942 Ga0207689_10009322 Ga0207689_100093227 200
402 3300025960 Ga0207651_10042126 Ga0207651_100421263 200
403 3300025961 Ga0207712_10150926 Ga0207712_101509262 200
404 3300026023 Ga0207677_10011951 Ga0207677_100119516 200
405 3300026035 Ga0207703_10188640 Ga0207703_101886402 200
406 3300026041 Ga0207639_10160934 Ga0207639_101609341 200
407 3300026067 Ga0207678_10071465 Ga0207678_100714653 200
408 3300026075 Ga0207708_10004498 Ga0207708_100044983 200
409 3300026078 Ga0207702_10108751 Ga0207702_101087512 200
410 3300026078 Ga0207702_10156073 Ga0207702_101560732 200
411 3300026088 Ga0207641_10028749 Ga0207641_100287494 200
412 3300026089 Ga0207648_10003288 Ga0207648_1000328810 200
413 3300026095 Ga0207676_10023920 Ga0207676_100239202 200
414 3300026116 Ga0207674_10543705 Ga0207674_105437052 200
415 3300026118 Ga0207675_100007677 Ga0207675_1000076777 200
416 3300026121 Ga0207683_10013207 Ga0207683_100132075 200
417 3300026142 Ga0207698_10015844 Ga0207698_100158443 200
418 3300028380 Ga0268265_10246934 Ga0268265_102469342 200
419 3300028381 Ga0268264_10030844 Ga0268264_100308444 200
420 3300031241 Ga0265325_10013504 Ga0265325_100135044 200
421 3300031595 Ga0265313_10019389 Ga0265313_100193893 200
422 3300035083 Ga0373926_0051915 Ga0373926_0051915_545_1288 200
423 3300035089 Ga0373944_0082701 Ga0373944_0082701_303_1046 200
424 3300035092 Ga0373952_0066395 Ga0373952_0066395_45_770 200
425 3300035114 Ga0373939_0047508 Ga0373939_0047508_164_889 200
426 3300035116 Ga0373945_0003434 Ga0373945_0003434_1182_1907 200
427 3300035170 Ga0373943_0022910 Ga0373943_0022910_1001_1726 200
428 3300035172 Ga0373955_0048835 Ga0373955_0048835_741_1484 200
429 3300035695 Ga0373927_0015276 Ga0373927_0015276_62_787 200
430 3300035695 Ga0373927_0083737 Ga0373927_0083737_554_1297 200
431 3300035724 Ga0373933_0029565 Ga0373933_0029565_1821_2564 200
432 3300035725 Ga0373947_0009074 Ga0373947_0009074_1302_2027 200
433 3300035725 Ga0373947_0171219 Ga0373947_0171219_370_1113 200
434 3300037068 Ga0373925_0020794 Ga0373925_0020794_2010_2735 200
435 3300037068 Ga0373925_0397790 Ga0373925_0397790_136_861 200
436 3300046452 Ga0495617_036188 Ga0495617_036188_58_783 200
437 3300046454 Ga0495592_0186359 Ga0495592_0186359_122_865 200
438 3300046455 Ga0495603_0001783 Ga0495603_0001783_9966_10691 200
439 3300046459 Ga0495629_0121765 Ga0495629_0121765_234_977 200
440 3300046462 Ga0495651_0023009 Ga0495651_0023009_1675_2418 200
441 3300046463 Ga0495653_0058010 Ga0495653_0058010_668_1411 200
442 3300046476 Ga0495662_0089057 Ga0495662_0089057_103_828 200
443 3300046477 Ga0495664_0035719 Ga0495664_0035719_397_1140 200
444 3300046491 Ga0495584_0082128 Ga0495584_0082128_466_1191 200
445 3300046511 Ga0495608_0025664 Ga0495608_0025664_2114_2857 200
446 3300046513 Ga0495616_0052819 Ga0495616_0052819_81_806 200
447 3300046517 Ga0495630_0116502 Ga0495630_0116502_918_1643 200
448 3300046517 Ga0495630_0264793 Ga0495630_0264793_341_1084 200
449 3300046525 Ga0495663_0049330 Ga0495663_0049330_260_979 200
450 3300046529 Ga0495652_0195579 Ga0495652_0195579_282_1025 200
451 3300046536 Ga0495587_0105450 Ga0495587_0105450_176_919 200
452 3300046539 Ga0495621_0032015 Ga0495621_0032015_254_979 200
453 3300046558 Ga0495633_0030278 Ga0495633_0030278_1323_2042 200
454 3300046559 Ga0495667_0108618 Ga0495667_0108618_416_1159 200
455 3300046615 Ga0495656_0015253 Ga0495656_0015253_1606_2325 200
456 3300046616 Ga0495668_0103220 Ga0495668_0103220_358_1077 200
457 3300046664 Ga0495659_0018100 Ga0495659_0018100_201_959 200
458 3300046674 Ga0495588_0040320 Ga0495588_0040320_124_849 200
459 3300046675 Ga0495657_0071269 Ga0495657_0071269_1515_2258 200
460 3300046679 Ga0495623_0014821 Ga0495623_0014821_494_1237 200
461 3300046690 Ga0495624_0191858 Ga0495624_0191858_232_957 200
462 3300046691 Ga0495670_0181705 Ga0495670_0181705_377_1096 200
463 3300046694 Ga0495649_0053171 Ga0495649_0053171_61_780 200
464 3300047319 Ga0495674_0096156 Ga0495674_0096156_533_1258 200
465 3300047321 Ga0495676_0027307 Ga0495676_0027307_2620_3345 200
466 3300047444 Ga0495675_0018898 Ga0495675_0018898_575_1318 200
467 3300047447 Ga0495685_101630 Ga0495685_101630_129_854 200
468 3300048088 Ga0495602_0115716 Ga0495602_0115716_583_1326 200
469 3300048903 Ga0496100_0005367 Ga0496100_0005367_3016_3735 200
470 3300048903 Ga0496100_0548471 Ga0496100_0548471_138_857 200
471 3300048904 Ga0496101_0090868 Ga0496101_0090868_1416_2135 200
472 3300048904 Ga0496101_0545705 Ga0496101_0545705_100_825 200
473 3300048905 Ga0496102_0009701 Ga0496102_0009701_2698_3417 200
474 3300048905 Ga0496102_0022167 Ga0496102_0022167_1887_2612 200
475 3300048906 Ga0496103_0006468 Ga0496103_0006468_2714_3433 200
476 3300048907 Ga0496104_0008101 Ga0496104_0008101_4057_4776 200
477 3300048907 Ga0496104_0131435 Ga0496104_0131435_128_853 200
478 3300048907 Ga0496104_0298772 Ga0496104_0298772_142_861 200
479 3300048908 Ga0496105_0019454 Ga0496105_0019454_129_848 200
480 3300048908 Ga0496105_0069588 Ga0496105_0069588_2008_2733 200
481 3300048909 Ga0496106_0011210 Ga0496106_0011210_5360_6085 200
482 3300048909 Ga0496106_0693668 Ga0496106_0693668_47_766 200
483 3300048910 Ga0496107_0008161 Ga0496107_0008161_3674_4393 200
484 3300048910 Ga0496107_0008292 Ga0496107_0008292_2037_2762 200
485 3300048911 Ga0496108_0025516 Ga0496108_0025516_4029_4748 200
486 3300048911 Ga0496108_0336982 Ga0496108_0336982_36_755 200
487 3300048912 Ga0496109_0004178 Ga0496109_0004178_7910_8635 200
488 3300048912 Ga0496109_0022019 Ga0496109_0022019_3528_4247 200
489 3300048913 Ga0496110_0006465 Ga0496110_0006465_1996_2721 200
490 3300048913 Ga0496110_0024973 Ga0496110_0024973_126_845 200
491 3300048914 Ga0496111_0009761 Ga0496111_0009761_1396_2115 200
492 3300048915 Ga0496112_0027080 Ga0496112_0027080_3539_4258 200
493 3300048916 Ga0496113_0003007 Ga0496113_0003007_4217_4936 200
494 3300048916 Ga0496113_0032019 Ga0496113_0032019_2081_2806 200
495 3300048917 Ga0496114_0029645 Ga0496114_0029645_1192_1917 200
496 3300048918 Ga0496115_0014453 Ga0496115_0014453_5120_5839 200
497 3300049572 Ga0501036_0109474 Ga0501036_0109474_1390_2133 200
498 3300049577 Ga0501041_0138214 Ga0501041_0138214_388_1173 200
499 3300049578 Ga0501042_0130139 Ga0501042_0130139_722_1507 200
500 3300049579 Ga0501043_0134187 Ga0501043_0134187_340_1083 200
501 3300049584 Ga0501068_0095967 Ga0501068_0095967_854_1597 200
502 3300049587 Ga0501071_0286963 Ga0501071_0286963_376_1119 200
503 3300049588 Ga0501072_0322428 Ga0501072_0322428_57_842 200
504 3300049590 Ga0501074_0092562 Ga0501074_0092562_1235_2020 200
505 3300049591 Ga0501075_0123881 Ga0501075_0123881_607_1392 200
506 3300049591 Ga0501075_0157732 Ga0501075_0157732_609_1346 200
507 3300049592 Ga0501076_0019223 Ga0501076_0019223_2307_3092 200
508 3300049592 Ga0501076_0519921 Ga0501076_0519921_115_891 200
509 3300049593 Ga0501077_0007343 Ga0501077_0007343_3101_3886 200
510 3300049741 Ga0501079_0036769 Ga0501079_0036769_2521_3306 200
511 3300049742 Ga0501080_0383040 Ga0501080_0383040_380_1165 200
512 3300049823 Ga0501044_0031635 Ga0501044_0031635_61_804 200
513 3300050492 nmdc:mga0yw44_108607_c1 nmdc:mga0yw44_108607_c1_1044_1763 200
514 3300050492 nmdc:mga0yw44_195186_c1 nmdc:mga0yw44_195186_c1_524_1240 200
515 3300050507 nmdc:mga05p37_120409_c1 nmdc:mga05p37_120409_c1_1893_2681 200
516 3300050507 nmdc:mga05p37_13259_c1 nmdc:mga05p37_13259_c1_3278_4003 200
517 3300050507 nmdc:mga05p37_20387_c1 nmdc:mga05p37_20387_c1_6767_7525 200
518 3300050510 nmdc:mga06r32_232609_c1 nmdc:mga06r32_232609_c1_486_1211 200
519 3300050511 nmdc:mga08y16_18532_c1 nmdc:mga08y16_18532_c1_2977_3741 200
520 3300050511 nmdc:mga08y16_20827_c1 nmdc:mga08y16_20827_c1_5756_6481 200
521 3300050512 nmdc:mga0n895_14122_c1 nmdc:mga0n895_14122_c1_152_940 200
522 3300050512 nmdc:mga0n895_19141_c1 nmdc:mga0n895_19141_c1_3917_4642 200
523 3300053077 Ga0495601_0228465 Ga0495601_0228465_300_1043 200
524 3300053083 Ga0495655_0027974 Ga0495655_0027974_94_819 200
525 3300053083 Ga0495655_0034819 Ga0495655_0034819_178_897 200
526 3300053084 Ga0495595_0103548 Ga0495595_0103548_13_732 200
527 3300053084 Ga0495595_0109410 Ga0495595_0109410_143_868 200
528 3300053084 Ga0495595_0225482 Ga0495595_0225482_165_908 200
529 3300053085 Ga0495619_0054783 Ga0495619_0054783_96_815 200
530 3300053085 Ga0495619_0102761 Ga0495619_0102761_701_1444 200
531 3300053085 Ga0495619_0469837 Ga0495619_0469837_77_799 200
532 3300054114 Ga0501084_0147018 Ga0501084_0147018_702_1487 200
533 3300060353 Ga0501082_0082196 Ga0501082_0082196_1255_2040 200
534 3300060353 Ga0501082_0333473 Ga0501082_0333473_534_1271 200
535 3300061734 Ga0530510_0176182 Ga0530510_0176182_697_1482 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14693

Ribosomal_TL5_C

Ribosomal protein TL5, C-terminal domain

125

210

0.98

PF01386

Ribosomal_L25p

Ribosomal L25p family

30

117

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7unw-assembly1.cif.gz_X pseudomonas aeruginosa 70s ribosome initiation complex bound to if2-gdpcp (structure ii-b) 0.9429 6 187
6ysi-assembly1.cif.gz_R acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.9393 5 97
6dnc-assembly1.cif.gz_Z e.coli rf1 bound to e.coli 70s ribosome in response to uau sense a-site codon 0.9312 6 97
7m4v-assembly1.cif.gz_U a. baumannii ribosome-eravacycline complex: 50s 0.9309 5 97
6ogg-assembly1.cif.gz_v 70s termination complex with rf2 bound to the uga codon. rotated ribosome with rf2 bound (structure iv). 0.9273 4 97
ID Description Score Start End Superfamily
af_Q54VK2_46_139_2.40.240.10 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P 0.9498 7 97 2.40.240.10
af_Q2G0S0_95_176_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9459 98 180 2.170.120.20
af_K7MM89_88_176_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9455 99 186 2.170.120.20
af_F4JPA3_178_267_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9331 103 187 2.170.120.20
af_K7MM89_88_176_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9255 99 186 2.170.120.20
ID Description Score Start End GO Terms
AF-A0A529L0H0-F1-model_v4 50S ribosomal protein L25 0.9795 1 116 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A2P7SE57-F1-model_v4 Large ribosomal subunit protein bL25 (General stress protein CTC) 0.9761 1 188 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A2A4LDJ1-F1-model_v4 Large ribosomal subunit protein bL25 (General stress protein CTC) 0.9714 1 188 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A258XCV2-F1-model_v4 Large ribosomal subunit protein bL25 (General stress protein CTC) 0.9704 1 192 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A2V4VGA5-F1-model_v4 deleted 0.9702 1 187

Feature Viewer

pLDDT pTM Quality
88.92 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map