F460650

General Info

Members Datasets Scaffolds Average Seq Length
535 355 1070 294

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10006039|Ga0114129_1000603911
Length 331
Sequence VERVHRGLSDGVAGGGAGTSVLLRPPSVPATTAAGAWLRRLTSRAAAPYWQVAPLALVFAFFFLLPLAVTVAVSAWRYNEYSMTPALVGDNYAAVFSGCLTELPSLCLTFKTYLSTLKFCVLAWLLTLVLGFTVAYFLAFHVRSLTGQVVLFLVCTIPFWTSNVIRMISWVPLLGRNGLVNSVLLAAGVRREPFTWLLFSDFSVVLAFVHLYTMFMIVPIFNSMGRIDRALLEAARDAGASGWQTLWNVVVPLSKPGIVIGSIFVVTMVMGDYVTIGVMGGQQIASVGKVIQVQLSYLQFPLAAANAVVLLAAVLVVIATMTRLVDVRKEL

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
75 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
113 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
114 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
162 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
163 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
169 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
170 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
171 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
172 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
173 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
195 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
196 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
197 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
198 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
199 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
200 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
203 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
204 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
205 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
206 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
264 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
265 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
284 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
285 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
286 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
287 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
288 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
289 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
290 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
291 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
292 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
293 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
297 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
298 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
299 2547132374 Acidovorax radicis N35 Isolate Unclassified
300 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
301 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
302 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
303 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
304 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
305 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
306 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
307 2643221570 Acidovorax sp. Root568 Isolate Unclassified
308 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
309 2643221596 Acidovorax sp. Root70 Isolate Unclassified
310 2643221609 Acidovorax sp. Root217 Isolate Unclassified
311 2643221611 Acidovorax sp. Root219 Isolate Unclassified
312 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
313 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
314 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
315 2643221652 Acidovorax sp. Root402 Isolate Unclassified
316 2643221658 Variovorax sp. Root411 Isolate Unclassified
317 2643221672 Variovorax sp. Root434 Isolate Unclassified
318 2643221717 Acidovorax sp. Root267 Isolate Unclassified
319 2738541277 Variovorax sp. GV051 Isolate Unclassified
320 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
321 2738541307 Variovorax sp. GV008 Isolate Unclassified
322 2738543012 Acidovorax sp. CF301 Isolate Unclassified
323 2738543019 Variovorax sp. GV040 Isolate Unclassified
324 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
325 2816332133 Acidovorax radicis 2721A Isolate Unclassified
326 2818991446 Variovorax sp. 1180 Isolate Unclassified
327 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
328 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
329 2842677519 Variovorax sp. R-72495 Isolate Unclassified
330 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
331 2842733646 Variovorax sp. R-72446 Isolate Unclassified
332 2842747753 Variovorax sp. R-72060 Isolate Unclassified
333 2899924645 Variovorax sp. 369 Isolate Unclassified
334 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
335 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
336 2904456579 Variovorax sp. 2002 Isolate Unclassified
337 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
338 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
339 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
340 2928037797 Variovorax sp. 1126 Isolate Unclassified
341 2928044640 Variovorax sp. 1128 Isolate Unclassified
342 2928051484 Variovorax sp. 1133 Isolate Unclassified
343 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
344 2928070936 Variovorax gossypii 1167 Isolate Unclassified
345 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
346 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
347 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
348 2929520902 Variovorax beijingensis 502 Isolate Unclassified
349 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
350 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
351 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
352 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
353 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
354 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
355 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.79
Metatranscriptomes 0.19
Isolates 11.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.53
Nodule 1.5
Rhizoplane 3.55
Rhizosphere 49.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10006039 3300009147 Bacteria 17170
2 JGI24741J21665_1000039 3300001915 Bacteria 30947
3 JGI24740J21852_10006007 3300001979 Bacteria 5078
4 JGI24739J22299_10052753 3300001989 Bacteria 1307
5 JGI25154J39366_1000276 3300002738 Bacteria 31477
6 JGI25158J39367_1003505 3300002739 Bacteria 2419
7 JGI25152J39213_1005183 3300002773 Bacteria 3889
8 JGI25152J39213_1013359 3300002773 Bacteria 1715
9 JGI25150J39212_1005830 3300002774 Bacteria 2595
10 JGI25159J45721_1000215 3300002987 Bacteria 27258
11 JGI25159J45721_1011718 3300002987 Bacteria 2132
12 JGI25151J46595_10006665 3300003187 Bacteria 5759
13 JGI25151J46595_10009103 3300003187 Bacteria 4730
14 JGI25151J46595_10032839 3300003187 Bacteria 2006
15 JGI25153J46596_10004528 3300003215 Bacteria 7476
16 JGI25153J46596_10009787 3300003215 Bacteria 4406
17 JGI25160J50197_1000281 3300003354 Bacteria 37019
18 JGI25161J50226_1000124 3300003374 Bacteria 56436
19 Ga0055539_1000185 3300003752 Bacteria 52003
20 Ga0055533_1000627 3300003756 Bacteria 11924
21 Ga0055532_1000006 3300003758 Bacteria 451244
22 Ga0055525_1000586 3300003759 Bacteria 15795
23 Ga0055535_1000004 3300003761 Bacteria 451244
24 Ga0055535_1000442 3300003761 Bacteria 38340
25 Ga0055542_1000052 3300003762 Bacteria 173583
26 Ga0055542_1001212 3300003762 Bacteria 14509
27 Ga0055529_1000273 3300003763 Bacteria 61443
28 Ga0055526_1002654 3300003771 Bacteria 11944
29 Ga0055524_1000294 3300003775 Bacteria 48038
30 Ga0055524_1009094 3300003775 Bacteria 4073
31 Ga0055534_1006771 3300003784 Bacteria 2834
32 Ga0055528_1032441 3300003790 Bacteria 1333
33 Ga0055530_10004436 3300003791 Bacteria 7215
34 Ga0055530_10006319 3300003791 Bacteria 5323
35 Ga0055530_10007636 3300003791 Bacteria 4509
36 Ga0055540_1000028 3300003792 Bacteria 184864
37 Ga0055540_1003653 3300003792 Bacteria 7328
38 Ga0055540_1008366 3300003792 Bacteria 3733
39 Ga0055531_10000353 3300003794 Bacteria 44922
40 Ga0055531_10003684 3300003794 Bacteria 9648
41 Ga0055531_10005490 3300003794 Bacteria 7416
42 Ga0055531_10007116 3300003794 Bacteria 6176
43 Ga0055543_1004249 3300004625 Bacteria 3952
44 Ga0055543_1030231 3300004625 Bacteria 948
45 Ga0065165_1004200 3300005262 Bacteria 9174
46 Ga0065165_1031614 3300005262 Bacteria 1670
47 Ga0065714_10007979 3300005288 Bacteria 3344
48 Ga0065704_10089200 3300005289 Bacteria 2878
49 Ga0070661_100000336 3300005344 Bacteria 37535
50 Ga0070668_100336938 3300005347 Bacteria 1274
51 Ga0070659_100001051 3300005366 Bacteria 20160
52 Ga0070667_100013586 3300005367 Bacteria 6729
53 Ga0070714_100286265 3300005435 Bacteria 1532
54 Ga0070700_100046168 3300005441 Bacteria 2691
55 Ga0070708_100019655 3300005445 Bacteria 5680
56 Ga0070663_100000344 3300005455 Bacteria 24261
57 Ga0070678_100018931 3300005456 Bacteria 4474
58 Ga0070706_100221576 3300005467 Bacteria 1766
59 Ga0070707_100037083 3300005468 Bacteria 4652
60 Ga0070707_100059281 3300005468 Bacteria 3672
61 Ga0070698_100144580 3300005471 Bacteria 2328
62 Ga0070699_100018199 3300005518 Bacteria 6036
63 Ga0070699_100073802 3300005518 Bacteria 2968
64 Ga0070697_100002587 3300005536 Bacteria 13917
65 Ga0070697_100032673 3300005536 Bacteria 4189
66 Ga0070697_100037601 3300005536 Bacteria 3910
67 Ga0068853_100065424 3300005539 Bacteria 3155
68 Ga0068853_100143512 3300005539 Bacteria 2144
69 Ga0068853_100386453 3300005539 Bacteria 1308
70 Ga0070695_100002753 3300005545 Bacteria 10198
71 Ga0070696_100246985 3300005546 Bacteria 1348
72 Ga0070665_100140158 3300005548 Bacteria 2421
73 Ga0068855_100079187 3300005563 Bacteria 3811
74 Ga0070664_100000122 3300005564 Bacteria 51758
75 Ga0068857_100004573 3300005577 Bacteria 11714
76 Ga0068854_100000121 3300005578 Bacteria 53603
77 Ga0068856_100001426 3300005614 Bacteria 25069
78 Ga0068864_100012311 3300005618 Bacteria 7070
79 Ga0068851_10010340 3300005834 Bacteria 4353
80 Ga0068851_10041918 3300005834 Bacteria 2303
81 Ga0068863_100351847 3300005841 Bacteria 1435
82 Ga0068860_100475068 3300005843 Bacteria 1245
83 Ga0070717_10198690 3300006028 Bacteria 1755
84 Ga0075365_10002292 3300006038 Bacteria 9305
85 Ga0075365_10060213 3300006038 Bacteria 2532
86 Ga0075363_100044603 3300006048 Bacteria 2350
87 Ga0075363_100066392 3300006048 Bacteria 1952
88 Ga0075364_10019297 3300006051 Bacteria 4278
89 Ga0075362_10001196 3300006177 Bacteria 8162
90 Ga0075362_10002954 3300006177 Bacteria 5837
91 Ga0075367_10118248 3300006178 Bacteria 1631
92 Ga0075366_10022219 3300006195 Bacteria 3690
93 Ga0075366_10075370 3300006195 Bacteria 2012
94 Ga0075366_10091864 3300006195 Bacteria 1818
95 Ga0097621_100307088 3300006237 Bacteria 1402
96 Ga0075370_10028299 3300006353 Bacteria 3114
97 Ga0075370_10029632 3300006353 Bacteria 3049
98 Ga0075370_10121230 3300006353 Bacteria 1522
99 Ga0075428_100000569 3300006844 Bacteria 37598
100 Ga0075428_100195271 3300006844 Bacteria 2189
101 Ga0075430_100000021 3300006846 Bacteria 83951
102 Ga0075433_10001898 3300006852 Bacteria 15723
103 Ga0075433_10132364 3300006852 Bacteria 2216
104 Ga0075433_10145148 3300006852 Bacteria 2110
105 Ga0075434_100009483 3300006871 Bacteria 9078
106 Ga0075434_100012102 3300006871 Bacteria 8169
107 Ga0075434_100043132 3300006871 Bacteria 4473
108 Ga0075434_100072346 3300006871 Bacteria 3440
109 Ga0075434_100188811 3300006871 Bacteria 2081
110 Ga0075429_100000375 3300006880 Bacteria 32935
111 Ga0075429_100019209 3300006880 Bacteria 5920
112 Ga0075436_100010774 3300006914 Bacteria 6272
113 Ga0075436_100012353 3300006914 Bacteria 5852
114 Ga0075436_100013296 3300006914 Bacteria 5637
115 Ga0075436_100083046 3300006914 Bacteria 2223
116 Ga0099824_1024096 3300006942 Bacteria 3639
117 Ga0099823_1000002 3300006944 Bacteria 212272
118 Ga0079104_1000194 3300006946 Bacteria 85426
119 Ga0099826_10088238 3300006948 Bacteria 1906
120 Ga0075435_100002109 3300007076 Bacteria 13085
121 Ga0075435_100040132 3300007076 Bacteria 3737
122 Ga0075435_100077737 3300007076 Bacteria 2721
123 Ga0075435_100384092 3300007076 Bacteria 1206
124 Ga0099794_10117711 3300007265 Bacteria 1335
125 Ga0105240_10004318 3300009093 Bacteria 21701
126 Ga0105240_10026585 3300009093 Bacteria 7594
127 Ga0111539_10151395 3300009094 Bacteria 2715
128 Ga0111539_10434409 3300009094 Bacteria 1529
129 Ga0105245_10368294 3300009098 Bacteria 1428
130 Ga0114129_10015140 3300009147 Bacteria 10977
131 Ga0114129_10027881 3300009147 Bacteria 7998
132 Ga0114129_10108933 3300009147 Bacteria 3823
133 Ga0105243_10006651 3300009148 Bacteria 8923
134 Ga0105243_10019822 3300009148 Bacteria 5101
135 Ga0105241_10139257 3300009174 Bacteria 1974
136 Ga0105242_10004317 3300009176 Bacteria 11072
137 Ga0105248_10503525 3300009177 Bacteria 1365
138 Ga0105237_10000080 3300009545 Bacteria 127788
139 Ga0105238_10005068 3300009551 Bacteria 13021
140 Ga0105239_10000116 3300010375 Bacteria 112811
141 Ga0157373_10026092 3300013100 Bacteria 4223
142 Ga0157371_10000072 3300013102 Bacteria 163917
143 Ga0157371_10176776 3300013102 Bacteria 1526
144 Ga0157370_10000031 3300013104 Bacteria 139879
145 Ga0157370_10096261 3300013104 Bacteria 2777
146 Ga0157372_10031683 3300013307 Bacteria 5789
147 Ga0157375_10862116 3300013308 Bacteria 1052
148 Ga0163163_10387795 3300014325 Bacteria 1455
149 Ga0182008_10005470 3300014497 Bacteria 7233
150 Ga0157379_10222801 3300014968 Bacteria 1709
151 Ga0157379_10541060 3300014968 Bacteria 1083
152 Ga0182006_1004474 3300015261 Bacteria 6881
153 Ga0182006_1008178 3300015261 Bacteria 4746
154 Ga0182007_10004417 3300015262 Bacteria 6374
155 Ga0182007_10017871 3300015262 Bacteria 2581
156 Ga0182005_1043028 3300015265 Bacteria 1228
157 Ga0183362_10004 3300015683 Bacteria 569303
158 Ga0163161_10000210 3300017792 Bacteria 53340
159 Ga0163161_10214000 3300017792 Bacteria 1490
160 Ga0154015_1302157 3300020610 Bacteria 6345
161 Ga0213875_10000030 3300021388 Bacteria 178500
162 Ga0209784_100006 3300025224 Bacteria 930704
163 Ga0209784_100616 3300025224 Bacteria 11294
164 Ga0209566_100002 3300025225 Bacteria 2614868
165 Ga0209566_100428 3300025225 Bacteria 31946
166 Ga0209674_100010 3300025226 Bacteria 1038638
167 Ga0209674_100098 3300025226 Bacteria 167037
168 Ga0209672_100364 3300025228 Bacteria 28325
169 Ga0209672_100423 3300025228 Bacteria 24757
170 Ga0209147_100015 3300025229 Bacteria 565073
171 Ga0209147_100433 3300025229 Bacteria 26866
172 Ga0209563_100004 3300025230 Bacteria 1814108
173 Ga0209258_100009 3300025242 Bacteria 996276
174 Ga0209258_100021 3300025242 Bacteria 565073
175 Ga0207425_1000189 3300025245 Bacteria 50055
176 Ga0207425_1000238 3300025245 Bacteria 42734
177 Ga0207425_1004456 3300025245 Bacteria 4196
178 Ga0209646_1000082 3300025246 Bacteria 200645
179 Ga0209026_1001639 3300025250 Bacteria 9523
180 Ga0209677_100007 3300025253 Bacteria 1021332
181 Ga0209677_101888 3300025253 Bacteria 8468
182 Ga0209148_1000007 3300025254 Bacteria 1592273
183 Ga0209148_1000395 3300025254 Bacteria 51537
184 Ga0209759_1001325 3300025256 Bacteria 14542
185 Ga0209759_1001619 3300025256 Bacteria 11998
186 Ga0209129_1000062 3300025258 Bacteria 240655
187 Ga0209129_1000083 3300025258 Bacteria 183270
188 Ga0209129_1002273 3300025258 Bacteria 9590
189 Ga0209565_1001755 3300025263 Bacteria 8841
190 Ga0209455_1000028 3300025272 Bacteria 565073
191 Ga0209673_1000089 3300025273 Bacteria 202240
192 Ga0209673_1003676 3300025273 Bacteria 8843
193 Ga0209673_1006986 3300025273 Bacteria 5318
194 Ga0209673_1019526 3300025273 Bacteria 2430
195 Ga0209673_1020279 3300025273 Bacteria 2359
196 Ga0209130_1000463 3300025284 Bacteria 42235
197 Ga0209130_1000627 3300025284 Bacteria 33309
198 Ga0209130_1003871 3300025284 Bacteria 6029
199 Ga0209675_1000534 3300025291 Bacteria 27862
200 Ga0209675_1004229 3300025291 Bacteria 6475
201 Ga0209675_1029853 3300025291 Bacteria 1308
202 Ga0209676_1000004 3300025292 Bacteria 1138360
203 Ga0209676_1000206 3300025292 Bacteria 132202
204 Ga0209025_1000133 3300025294 Bacteria 195885
205 Ga0209025_1000155 3300025294 Bacteria 169116
206 Ga0209025_1000692 3300025294 Bacteria 57604
207 Ga0209025_1005734 3300025294 Bacteria 9976
208 Ga0209564_1000014 3300025295 Bacteria 621501
209 Ga0209564_1000323 3300025295 Bacteria 93122
210 Ga0209564_1000332 3300025295 Bacteria 91674
211 Ga0209758_1000126 3300025297 Bacteria 189761
212 Ga0209758_1000129 3300025297 Bacteria 185022
213 Ga0209758_1000132 3300025297 Bacteria 183273
214 Ga0209758_1020576 3300025297 Bacteria 3114
215 Ga0209758_1024798 3300025297 Bacteria 2658
216 Ga0209050_1000002 3300025298 Bacteria 1792849
217 Ga0209050_1000118 3300025298 Bacteria 202586
218 Ga0209050_1000282 3300025298 Bacteria 108629
219 Ga0209050_1002923 3300025298 Bacteria 13387
220 Ga0209050_1003576 3300025298 Bacteria 11309
221 Ga0209050_1006981 3300025298 Bacteria 6496
222 Ga0209050_1007456 3300025298 Bacteria 6127
223 Ga0209256_1000015 3300025299 Bacteria 622953
224 Ga0209256_1000375 3300025299 Bacteria 71601
225 Ga0209256_1000385 3300025299 Bacteria 70163
226 Ga0209256_1000659 3300025299 Bacteria 46883
227 Ga0209256_1016632 3300025299 Bacteria 2493
228 Ga0207426_1000323 3300025302 Bacteria 91662
229 Ga0207426_1000424 3300025302 Bacteria 69170
230 Ga0207426_1000517 3300025302 Bacteria 56285
231 Ga0209051_1000002 3300025303 Bacteria 1631846
232 Ga0209051_1000022 3300025303 Bacteria 474879
233 Ga0209051_1000552 3300025303 Bacteria 45581
234 Ga0209051_1000749 3300025303 Bacteria 34903
235 Ga0209051_1002111 3300025303 Bacteria 14867
236 Ga0209051_1003283 3300025303 Bacteria 10725
237 Ga0209051_1019023 3300025303 Bacteria 3014
238 Ga0209257_1000002 3300025304 Bacteria 1767052
239 Ga0209257_1000022 3300025304 Bacteria 765258
240 Ga0209257_1000030 3300025304 Bacteria 689812
241 Ga0209257_1000312 3300025304 Bacteria 102739
242 Ga0209257_1012820 3300025304 Bacteria 3812
243 Ga0207656_10010685 3300025321 Bacteria 3446
244 Ga0207655_1004685 3300025728 Bacteria 9586
245 Ga0207647_10087424 3300025904 Bacteria 1862
246 Ga0207645_10201759 3300025907 Bacteria 1309
247 Ga0207684_10001486 3300025910 Bacteria 25217
248 Ga0207684_10004735 3300025910 Bacteria 12758
249 Ga0207695_10002251 3300025913 Bacteria 28914
250 Ga0207695_10004216 3300025913 Bacteria 19757
251 Ga0207671_10003680 3300025914 Bacteria 15115
252 Ga0207657_10108038 3300025919 Bacteria 2300
253 Ga0207649_10000449 3300025920 Bacteria 29607
254 Ga0207646_10011702 3300025922 Bacteria 8483
255 Ga0207646_10036294 3300025922 Bacteria 4449
256 Ga0207646_10136131 3300025922 Bacteria 2212
257 Ga0207681_10005500 3300025923 Bacteria 7777
258 Ga0207694_10006723 3300025924 Bacteria 8736
259 Ga0207694_10334026 3300025924 Bacteria 1252
260 Ga0207664_10043153 3300025929 Bacteria 3525
261 Ga0207644_10382399 3300025931 Bacteria 1148
262 Ga0207690_10005650 3300025932 Bacteria 7390
263 Ga0207686_10013399 3300025934 Bacteria 4536
264 Ga0207709_10007351 3300025935 Bacteria 6138
265 Ga0207711_10049904 3300025941 Bacteria 3582
266 Ga0207689_10137081 3300025942 Bacteria 2015
267 Ga0207679_10000007 3300025945 Bacteria 460140
268 Ga0207640_10000107 3300025981 Bacteria 63143
269 Ga0207658_10007588 3300025986 Bacteria 7391
270 Ga0207639_10306751 3300026041 Bacteria 1405
271 Ga0207678_10000207 3300026067 Bacteria 51939
272 Ga0207708_10071768 3300026075 Bacteria 2653
273 Ga0207702_10000260 3300026078 Bacteria 61036
274 Ga0207674_10088393 3300026116 Bacteria 3092
275 Ga0207674_10108997 3300026116 Bacteria 2745
276 Ga0207683_10037660 3300026121 Bacteria 4213
277 Ga0209281_1000083 3300027111 Bacteria 255034
278 Ga0209389_1000340 3300027296 Bacteria 28501
279 Ga0209371_1000003 3300027312 Bacteria 1122971
280 Ga0209588_1021831 3300027671 Bacteria 2013
281 Ga0268266_10083474 3300028379 Bacteria 2789
282 Ga0307517_10004249 3300028786 Bacteria 22093
283 Ga0307515_10000468 3300028794 Bacteria 96483
284 Ga0307515_10000996 3300028794 Bacteria 64755
285 Ga0307515_10016105 3300028794 Bacteria 13712
286 Ga0307515_10023690 3300028794 Bacteria 10740
287 Ga0307515_10033855 3300028794 Bacteria 8395
288 Ga0307515_10083379 3300028794 Bacteria 4120
289 Ga0307515_10157508 3300028794 Bacteria 2335
290 Ga0307515_10168734 3300028794 Bacteria 2193
291 Ga0268256_1000004 3300030500 Bacteria 1122967
292 Ga0307512_10091169 3300030522 Bacteria 2121
293 Ga0314311_1004344 3300030733 Bacteria 3205
294 Ga0316178_1040733 3300030735 Bacteria 3008
295 Ga0316183_1025593 3300030742 Bacteria 2035
296 Ga0316182_1127356 3300030745 Bacteria 2412
297 Ga0265328_10003064 3300031239 Bacteria 7458
298 Ga0265327_10000143 3300031251 Bacteria 156870
299 Ga0265327_10002325 3300031251 Bacteria 20322
300 Ga0307513_10009782 3300031456 Bacteria 12111
301 Ga0307513_10010816 3300031456 Bacteria 11398
302 Ga0307513_10038458 3300031456 Bacteria 5312
303 Ga0307513_10154013 3300031456 Bacteria 2201
304 Ga0307513_10325626 3300031456 Bacteria 1293
305 Ga0307509_10006186 3300031507 Bacteria 16221
306 Ga0307509_10013803 3300031507 Bacteria 9532
307 Ga0307509_10047956 3300031507 Bacteria 4591
308 Ga0307509_10204277 3300031507 Bacteria 1808
309 Ga0307509_10263176 3300031507 Bacteria 1498
310 Ga0307408_100025084 3300031548 Bacteria 4079
311 Ga0307408_100407240 3300031548 Bacteria 1169
312 Ga0307508_10137279 3300031616 Bacteria 2048
313 Ga0307514_10012067 3300031649 Bacteria 7193
314 Ga0307514_10066287 3300031649 Bacteria 2731
315 Ga0307516_10013210 3300031730 Bacteria 8818
316 Ga0307516_10264207 3300031730 Bacteria 1410
317 Ga0307405_10057896 3300031731 Bacteria 2436
318 Ga0307406_10006155 3300031901 Bacteria 6600
319 Ga0307416_100051416 3300032002 Bacteria 3291
320 Ga0307416_100554160 3300032002 Bacteria 1223
321 Ga0307510_10001484 3300033180 Bacteria 25882
322 Ga0307510_10029737 3300033180 Bacteria 6210
323 Ga0307510_10133499 3300033180 Bacteria 2147
324 Ga0307510_10156716 3300033180 Bacteria 1883
325 Ga0373937_0069374 3300036401 Bacteria 3250
326 Ga0395899_0090468 3300037312 Bacteria 2219
327 Ga0395900_0009997 3300037418 Bacteria 9708
328 Ga0395900_0078567 3300037418 Bacteria 3390
329 Ga0395898_0016690 3300037466 Bacteria 7505
330 Ga0395905_0000181 3300037471 Bacteria 100569
331 Ga0436364_0048713 3300037853 Bacteria 1314
332 Ga0436364_0164703 3300037853 Bacteria 3471
333 Ga0395901_0018012 3300038443 Bacteria 7209
334 Ga0436365_0361666 3300039437 Bacteria 1881
335 Ga0439436_0017633 3300041404 Bacteria 2136
336 Ga0439439_0004879 3300041406 Bacteria 3040
337 Ga0451800_0435002 3300041459 Bacteria 1529
338 Ga0451802_1617884 3300041460 Bacteria 1621
339 Ga0451804_0553819 3300041463 Bacteria 1124
340 Ga0451807_0833619 3300041486 Bacteria 1547
341 Ga0451855_1366561 3300041511 Bacteria 1196
342 Ga0439449_0017485 3300042007 Bacteria 2693
343 Ga0439457_027196 3300042014 Bacteria 1266
344 Ga0450919_003166 3300042121 Bacteria 2090
345 Ga0450898_028713 3300042134 Bacteria 1012
346 Ga0450906_023953 3300042145 Bacteria 1086
347 Ga0439446_0018184 3300042156 Bacteria 1967
348 Ga0439434_0013319 3300042435 Bacteria 2441
349 Ga0450918_000218 3300042531 Bacteria 13121
350 Ga0466969_0033048 3300044656 Bacteria 2629
351 Ga0466978_0127421 3300044671 Bacteria 1568
352 Ga0453683_0005531 3300044673 Bacteria 8807
353 Ga0466965_0033846 3300044683 Bacteria 2498
354 Ga0466961_0000242 3300044693 Bacteria 36694
355 Ga0466964_0006208 3300044706 Bacteria 4453
356 Ga0453684_0021150 3300044712 Bacteria 9746
357 Ga0466968_0085874 3300044735 Bacteria 1388
358 Ga0466970_0002465 3300044765 Bacteria 8949
359 Ga0466960_0034748 3300044901 Bacteria 2352
360 Ga0466959_0016492 3300045049 Bacteria 5398
361 Ga0451576_0039332 3300045051 Bacteria 5005
362 Ga0451576_0041514 3300045051 Bacteria 4863
363 Ga0466967_0006234 3300045976 Bacteria 8408
364 Ga0495592_0000495 3300046454 Bacteria 28713
365 Ga0495638_0133199 3300046460 Bacteria 1458
366 Ga0495639_0003270 3300046475 Bacteria 7037
367 Ga0495610_0062947 3300046512 Bacteria 1758
368 Ga0495616_0000899 3300046513 Bacteria 21469
369 Ga0495632_0017745 3300046519 Bacteria 3922
370 Ga0495637_0007675 3300046520 Bacteria 5335
371 Ga0495643_0113569 3300046522 Bacteria 1375
372 Ga0495666_0066709 3300046526 Bacteria 1715
373 Ga0495654_0002885 3300046530 Bacteria 10786
374 Ga0495625_0000057 3300046660 Bacteria 181623
375 Ga0495599_0130581 3300046678 Bacteria 1560
376 Ga0495624_0082086 3300046690 Bacteria 1995
377 Ga0495672_0108136 3300047320 Bacteria 1496
378 Ga0495676_0061247 3300047321 Bacteria 2944
379 Ga0495676_0233218 3300047321 Bacteria 1263
380 Ga0495685_035318 3300047447 Bacteria 1718
381 Ga0495593_0006885 3300047673 Bacteria 6658
382 Ga0495614_0014202 3300048089 Bacteria 3490
383 Ga0496101_0044140 3300048904 Bacteria 3189
384 Ga0496102_0012945 3300048905 Bacteria 7224
385 Ga0496102_0045310 3300048905 Bacteria 3993
386 Ga0496102_0474739 3300048905 Bacteria 1172
387 Ga0496103_0037782 3300048906 Bacteria 2960
388 Ga0496104_0002642 3300048907 Bacteria 15420
389 Ga0496106_0481355 3300048909 Bacteria 997
390 Ga0496108_0073364 3300048911 Bacteria 2889
391 Ga0496109_0036306 3300048912 Bacteria 4448
392 Ga0496110_0020858 3300048913 Bacteria 5536
393 Ga0496111_0056807 3300048914 Bacteria 2832
394 Ga0496122_0000039 3300048925 Bacteria 295352
395 Ga0496122_0144007 3300048925 Bacteria 1485
396 Ga0496123_0000026 3300048926 Bacteria 318040
397 Ga0496124_0000126 3300048927 Bacteria 159539
398 Ga0496124_0011786 3300048927 Bacteria 8713
399 Ga0496125_0029741 3300048928 Bacteria 4902
400 Ga0496125_0079785 3300048928 Bacteria 2508
401 Ga0496125_0164908 3300048928 Bacteria 1499
402 Ga0501034_0049824 3300049571 Bacteria 4225
403 Ga0501034_0093665 3300049571 Bacteria 3001
404 Ga0501034_0153637 3300049571 Bacteria 2277
405 Ga0501037_0064679 3300049573 Bacteria 2665
406 Ga0501039_0393811 3300049575 Bacteria 1088
407 Ga0501043_0026628 3300049579 Bacteria 4537
408 Ga0501043_0159304 3300049579 Bacteria 1764
409 Ga0501047_0078127 3300049581 Bacteria 3183
410 Ga0501067_0003970 3300049583 Bacteria 8162
411 Ga0501070_0129165 3300049586 Bacteria 2088
412 Ga0501072_0551821 3300049588 Bacteria 910
413 Ga0501073_0026363 3300049589 Bacteria 4165
414 Ga0501076_0155878 3300049592 Bacteria 1859
415 Ga0501077_0085280 3300049593 Bacteria 2002
416 Ga0501249_013664 3300049679 Bacteria 1727
417 Ga0501225_0005204 3300049705 Bacteria 3829
418 Ga0501080_0177944 3300049742 Bacteria 1959
419 Ga0501083_0013652 3300049744 Bacteria 5679
420 Ga0501035_0015893 3300049822 Bacteria 6945
421 Ga0501035_0082715 3300049822 Bacteria 2833
422 Ga0501044_0056675 3300049823 Bacteria 4023
423 Ga0501044_0149309 3300049823 Bacteria 2320
424 nmdc:mga03683_394_c1 3300050489 Bacteria 9398
425 nmdc:mga0yw44_23307_c1 3300050492 Bacteria 3486
426 nmdc:mga0k408_12966_c1 3300050493 Bacteria 4204
427 nmdc:mga0k408_50518_c2 3300050493 Bacteria 1581
428 nmdc:mga0k408_9068_c1 3300050493 Bacteria 4574
429 nmdc:mga06z11_4490_c1 3300050494 Bacteria 5493
430 nmdc:mga07m45_119790_c1 3300050496 Bacteria 1520
431 nmdc:mga07m45_31081_c1 3300050496 Bacteria 2959
432 nmdc:mga05p37_2330_c1 3300050507 Bacteria 22105
433 nmdc:mga05p37_3465_c1 3300050507 Bacteria 18430
434 nmdc:mga05p37_3512_c1 3300050507 Bacteria 18320
435 nmdc:mga05p37_4649_c1 3300050507 Bacteria 16049
436 nmdc:mga09592_13107_c1 3300050508 Bacteria 6765
437 nmdc:mga09592_18143_c1 3300050508 Bacteria 5771
438 nmdc:mga0qj67_689_c1 3300050509 Bacteria 23022
439 nmdc:mga06r32_1730_c1 3300050510 Bacteria 19651
440 nmdc:mga06r32_79371_c1 3300050510 Bacteria 3193
441 nmdc:mga0n895_2591_c1 3300050512 Bacteria 14200
442 nmdc:mga0n895_26241_c1 3300050512 Bacteria 5514
443 nmdc:mga0n895_30084_c1 3300050512 Bacteria 5186
444 nmdc:mga0n895_4605_c1 3300050512 Bacteria 11365
445 nmdc:mga0rr50_112808_c1 3300050513 Bacteria 2154
446 nmdc:mga0rr50_234367_c1 3300050513 Bacteria 1520
447 nmdc:mga0rr50_4214_c1 3300050513 Bacteria 8407
448 nmdc:mga0rr50_43238_c1 3300050513 Bacteria 3295
449 nmdc:mga08x19_119008_c1 3300050514 Bacteria 1769
450 nmdc:mga08x19_183388_c1 3300050514 Bacteria 1429
451 nmdc:mga08x19_2840_c1 3300050514 Bacteria 10447
452 nmdc:mga08x19_89314_c1 3300050514 Bacteria 2032
453 nmdc:mga0a205_110829_c1 3300050515 Bacteria 2643
454 nmdc:mga0a205_15780_c1 3300050515 Bacteria 7062
455 nmdc:mga0a205_23567_c1 3300050515 Bacteria 5839
456 nmdc:mga0a205_70466_c1 3300050515 Bacteria 3376
457 Ga0500610_0015661 3300053079 Bacteria 3596
458 Ga0500610_0078864 3300053079 Bacteria 1715
459 Ga0500578_0000040 3300053086 Bacteria 133601
460 Ga0500651_0000261 3300053093 Bacteria 31479
461 Ga0500651_0128722 3300053093 Bacteria 1532
462 Ga0500594_0000600 3300053118 Bacteria 7720
463 Ga0500594_0004565 3300053118 Bacteria 3052
464 Ga0500628_002997 3300053129 Bacteria 2776
465 Ga0500655_011283 3300053133 Bacteria 1617
466 Ga0500658_0008702 3300053134 Bacteria 3746
467 Ga0500658_0009380 3300053134 Bacteria 3609
468 Ga0500559_0001133 3300053136 Bacteria 16045
469 Ga0500559_0035868 3300053136 Bacteria 2143
470 Ga0500622_0000138 3300053156 Bacteria 77892
471 Ga0500622_0005474 3300053156 Bacteria 7622
472 Ga0500627_0075640 3300053158 Bacteria 1496
473 Ga0500634_0074122 3300053161 Bacteria 1773
474 Ga0501084_0110608 3300054114 Bacteria 2308
475 Ga0501082_0018308 3300060353 Bacteria 6030
476 Ga0466962_0118867 3300061719 Bacteria 1274
477 2511243031 2511231002 Bacteria 5042903
478 2513229324 2513020051 Bacteria 6053213
479 2548498363 2547132374 Bacteria 5530232
480 2587758791 2585428062 Bacteria 6842168
481 2588290715 2588253510 Bacteria 6901809
482 2599447312 2599185178 Bacteria 5365746
483 2599622893 2599185214 Bacteria 8209958
484 2599671372 2599185226 Bacteria 8233575
485 2599679591 2599185227 Bacteria 8246414
486 2599691607 2599185229 Bacteria 8216126
487 2643867636 2643221570 Bacteria 5103772
488 2643972207 2643221592 Bacteria 6608788
489 2643990554 2643221596 Bacteria 5006805
490 2644062838 2643221609 Bacteria 6756331
491 2644070527 2643221611 Bacteria 6820941
492 2644141682 2643221625 Bacteria 6512927
493 2644247417 2643221644 Bacteria 6865017
494 2644275547 2643221648 Bacteria 6521465
495 2644294928 2643221652 Bacteria 5140275
496 2644325022 2643221658 Bacteria 6064537
497 2644400250 2643221672 Bacteria 6322190
498 2644648902 2643221717 Bacteria 5676132
499 2738718747 2738541277 Bacteria 7458140
500 2738746128 2738541281 Bacteria 5112672
501 2738884938 2738541307 Bacteria 8606193
502 2739243837 2738543012 Bacteria 7115078
503 2739280765 2738543019 Bacteria 7459457
504 2739355358 2738543032 Bacteria 5115625
505 2816472677 2816332133 Bacteria 7249298
506 2819602309 2818991446 Bacteria 7757362
507 2831265725 2831265667 Bacteria 7184833
508 2838056440 2838054893 Bacteria 7451788
509 2842681860 2842677519 Bacteria 5615038
510 2842720225 2842718218 Bacteria 4560148
511 2842737199 2842733646 Bacteria 5716726
512 2842750438 2842747753 Bacteria 5578255
513 2899930587 2899924645 Bacteria 7487985
514 2900582385 2900577576 Bacteria 5438534
515 2904452417 2904449895 Bacteria 6927402
516 2904458435 2904456579 Bacteria 6819253
517 2904481368 2904479285 Bacteria 5073931
518 2904546944 2904541872 Bacteria 8915136
519 2919466452 2919462493 Bacteria 5817112
520 2928039701 2928037797 Bacteria 7273642
521 2928044694 2928044640 Bacteria 7271509
522 2928052493 2928051484 Bacteria 7773759
523 2928064843 2928064002 Bacteria 7419480
524 2928074683 2928070936 Bacteria 8062541
525 2928087179 2928084124 Bacteria 7159212
526 2928118435 2928115317 Bacteria 6477646
527 2929164416 2929160207 Bacteria 9075316
528 2929522333 2929520902 Bacteria 6765052
529 2945910884 2945909444 Bacteria 7065066
530 2945946745 2945945610 Bacteria 5951079
531 2945976459 2945972063 Bacteria 6086495
532 2945986876 2945984333 Bacteria 7358892
533 2974322796 2974320154 Bacteria 4571377
534 2990713051 2990710928 Bacteria 5002431
535 643597879 643348564 Bacteria 8839022
536 Ga0114129_10006039
537 JGI24741J21665_1000039
538 JGI24740J21852_10006007
539 JGI24739J22299_10052753
540 JGI25154J39366_1000276
541 JGI25158J39367_1003505
542 JGI25152J39213_1005183
543 JGI25152J39213_1013359
544 JGI25150J39212_1005830
545 JGI25159J45721_1000215
546 JGI25159J45721_1011718
547 JGI25151J46595_10006665
548 JGI25151J46595_10009103
549 JGI25151J46595_10032839
550 JGI25153J46596_10004528
551 JGI25153J46596_10009787
552 JGI25160J50197_1000281
553 JGI25161J50226_1000124
554 Ga0055539_1000185
555 Ga0055533_1000627
556 Ga0055532_1000006
557 Ga0055525_1000586
558 Ga0055535_1000004
559 Ga0055535_1000442
560 Ga0055542_1000052
561 Ga0055542_1001212
562 Ga0055529_1000273
563 Ga0055526_1002654
564 Ga0055524_1000294
565 Ga0055524_1009094
566 Ga0055534_1006771
567 Ga0055528_1032441
568 Ga0055530_10004436
569 Ga0055530_10006319
570 Ga0055530_10007636
571 Ga0055540_1000028
572 Ga0055540_1003653
573 Ga0055540_1008366
574 Ga0055531_10000353
575 Ga0055531_10003684
576 Ga0055531_10005490
577 Ga0055531_10007116
578 Ga0055543_1004249
579 Ga0055543_1030231
580 Ga0065165_1004200
581 Ga0065165_1031614
582 Ga0065714_10007979
583 Ga0065704_10089200
584 Ga0070661_100000336
585 Ga0070668_100336938
586 Ga0070659_100001051
587 Ga0070667_100013586
588 Ga0070714_100286265
589 Ga0070700_100046168
590 Ga0070708_100019655
591 Ga0070663_100000344
592 Ga0070678_100018931
593 Ga0070706_100221576
594 Ga0070707_100037083
595 Ga0070707_100059281
596 Ga0070698_100144580
597 Ga0070699_100018199
598 Ga0070699_100073802
599 Ga0070697_100002587
600 Ga0070697_100032673
601 Ga0070697_100037601
602 Ga0068853_100065424
603 Ga0068853_100143512
604 Ga0068853_100386453
605 Ga0070695_100002753
606 Ga0070696_100246985
607 Ga0070665_100140158
608 Ga0068855_100079187
609 Ga0070664_100000122
610 Ga0068857_100004573
611 Ga0068854_100000121
612 Ga0068856_100001426
613 Ga0068864_100012311
614 Ga0068851_10010340
615 Ga0068851_10041918
616 Ga0068863_100351847
617 Ga0068860_100475068
618 Ga0070717_10198690
619 Ga0075365_10002292
620 Ga0075365_10060213
621 Ga0075363_100044603
622 Ga0075363_100066392
623 Ga0075364_10019297
624 Ga0075362_10001196
625 Ga0075362_10002954
626 Ga0075367_10118248
627 Ga0075366_10022219
628 Ga0075366_10075370
629 Ga0075366_10091864
630 Ga0097621_100307088
631 Ga0075370_10028299
632 Ga0075370_10029632
633 Ga0075370_10121230
634 Ga0075428_100000569
635 Ga0075428_100195271
636 Ga0075430_100000021
637 Ga0075433_10001898
638 Ga0075433_10132364
639 Ga0075433_10145148
640 Ga0075434_100009483
641 Ga0075434_100012102
642 Ga0075434_100043132
643 Ga0075434_100072346
644 Ga0075434_100188811
645 Ga0075429_100000375
646 Ga0075429_100019209
647 Ga0075436_100010774
648 Ga0075436_100012353
649 Ga0075436_100013296
650 Ga0075436_100083046
651 Ga0099824_1024096
652 Ga0099823_1000002
653 Ga0079104_1000194
654 Ga0099826_10088238
655 Ga0075435_100002109
656 Ga0075435_100040132
657 Ga0075435_100077737
658 Ga0075435_100384092
659 Ga0099794_10117711
660 Ga0105240_10004318
661 Ga0105240_10026585
662 Ga0111539_10151395
663 Ga0111539_10434409
664 Ga0105245_10368294
665 Ga0114129_10015140
666 Ga0114129_10027881
667 Ga0114129_10108933
668 Ga0105243_10006651
669 Ga0105243_10019822
670 Ga0105241_10139257
671 Ga0105242_10004317
672 Ga0105248_10503525
673 Ga0105237_10000080
674 Ga0105238_10005068
675 Ga0105239_10000116
676 Ga0157373_10026092
677 Ga0157371_10000072
678 Ga0157371_10176776
679 Ga0157370_10000031
680 Ga0157370_10096261
681 Ga0157372_10031683
682 Ga0157375_10862116
683 Ga0163163_10387795
684 Ga0182008_10005470
685 Ga0157379_10222801
686 Ga0157379_10541060
687 Ga0182006_1004474
688 Ga0182006_1008178
689 Ga0182007_10004417
690 Ga0182007_10017871
691 Ga0182005_1043028
692 Ga0183362_10004
693 Ga0163161_10000210
694 Ga0163161_10214000
695 Ga0154015_1302157
696 Ga0213875_10000030
697 Ga0209784_100006
698 Ga0209784_100616
699 Ga0209566_100002
700 Ga0209566_100428
701 Ga0209674_100010
702 Ga0209674_100098
703 Ga0209672_100364
704 Ga0209672_100423
705 Ga0209147_100015
706 Ga0209147_100433
707 Ga0209563_100004
708 Ga0209258_100009
709 Ga0209258_100021
710 Ga0207425_1000189
711 Ga0207425_1000238
712 Ga0207425_1004456
713 Ga0209646_1000082
714 Ga0209026_1001639
715 Ga0209677_100007
716 Ga0209677_101888
717 Ga0209148_1000007
718 Ga0209148_1000395
719 Ga0209759_1001325
720 Ga0209759_1001619
721 Ga0209129_1000062
722 Ga0209129_1000083
723 Ga0209129_1002273
724 Ga0209565_1001755
725 Ga0209455_1000028
726 Ga0209673_1000089
727 Ga0209673_1003676
728 Ga0209673_1006986
729 Ga0209673_1019526
730 Ga0209673_1020279
731 Ga0209130_1000463
732 Ga0209130_1000627
733 Ga0209130_1003871
734 Ga0209675_1000534
735 Ga0209675_1004229
736 Ga0209675_1029853
737 Ga0209676_1000004
738 Ga0209676_1000206
739 Ga0209025_1000133
740 Ga0209025_1000155
741 Ga0209025_1000692
742 Ga0209025_1005734
743 Ga0209564_1000014
744 Ga0209564_1000323
745 Ga0209564_1000332
746 Ga0209758_1000126
747 Ga0209758_1000129
748 Ga0209758_1000132
749 Ga0209758_1020576
750 Ga0209758_1024798
751 Ga0209050_1000002
752 Ga0209050_1000118
753 Ga0209050_1000282
754 Ga0209050_1002923
755 Ga0209050_1003576
756 Ga0209050_1006981
757 Ga0209050_1007456
758 Ga0209256_1000015
759 Ga0209256_1000375
760 Ga0209256_1000385
761 Ga0209256_1000659
762 Ga0209256_1016632
763 Ga0207426_1000323
764 Ga0207426_1000424
765 Ga0207426_1000517
766 Ga0209051_1000002
767 Ga0209051_1000022
768 Ga0209051_1000552
769 Ga0209051_1000749
770 Ga0209051_1002111
771 Ga0209051_1003283
772 Ga0209051_1019023
773 Ga0209257_1000002
774 Ga0209257_1000022
775 Ga0209257_1000030
776 Ga0209257_1000312
777 Ga0209257_1012820
778 Ga0207656_10010685
779 Ga0207655_1004685
780 Ga0207647_10087424
781 Ga0207645_10201759
782 Ga0207684_10001486
783 Ga0207684_10004735
784 Ga0207695_10002251
785 Ga0207695_10004216
786 Ga0207671_10003680
787 Ga0207657_10108038
788 Ga0207649_10000449
789 Ga0207646_10011702
790 Ga0207646_10036294
791 Ga0207646_10136131
792 Ga0207681_10005500
793 Ga0207694_10006723
794 Ga0207694_10334026
795 Ga0207664_10043153
796 Ga0207644_10382399
797 Ga0207690_10005650
798 Ga0207686_10013399
799 Ga0207709_10007351
800 Ga0207711_10049904
801 Ga0207689_10137081
802 Ga0207679_10000007
803 Ga0207640_10000107
804 Ga0207658_10007588
805 Ga0207639_10306751
806 Ga0207678_10000207
807 Ga0207708_10071768
808 Ga0207702_10000260
809 Ga0207674_10088393
810 Ga0207674_10108997
811 Ga0207683_10037660
812 Ga0209281_1000083
813 Ga0209389_1000340
814 Ga0209371_1000003
815 Ga0209588_1021831
816 Ga0268266_10083474
817 Ga0307517_10004249
818 Ga0307515_10000468
819 Ga0307515_10000996
820 Ga0307515_10016105
821 Ga0307515_10023690
822 Ga0307515_10033855
823 Ga0307515_10083379
824 Ga0307515_10157508
825 Ga0307515_10168734
826 Ga0268256_1000004
827 Ga0307512_10091169
828 Ga0314311_1004344
829 Ga0316178_1040733
830 Ga0316183_1025593
831 Ga0316182_1127356
832 Ga0265328_10003064
833 Ga0265327_10000143
834 Ga0265327_10002325
835 Ga0307513_10009782
836 Ga0307513_10010816
837 Ga0307513_10038458
838 Ga0307513_10154013
839 Ga0307513_10325626
840 Ga0307509_10006186
841 Ga0307509_10013803
842 Ga0307509_10047956
843 Ga0307509_10204277
844 Ga0307509_10263176
845 Ga0307408_100025084
846 Ga0307408_100407240
847 Ga0307508_10137279
848 Ga0307514_10012067
849 Ga0307514_10066287
850 Ga0307516_10013210
851 Ga0307516_10264207
852 Ga0307405_10057896
853 Ga0307406_10006155
854 Ga0307416_100051416
855 Ga0307416_100554160
856 Ga0307510_10001484
857 Ga0307510_10029737
858 Ga0307510_10133499
859 Ga0307510_10156716
860 Ga0373937_0069374
861 Ga0395899_0090468
862 Ga0395900_0009997
863 Ga0395900_0078567
864 Ga0395898_0016690
865 Ga0395905_0000181
866 Ga0436364_0048713
867 Ga0436364_0164703
868 Ga0395901_0018012
869 Ga0436365_0361666
870 Ga0439436_0017633
871 Ga0439439_0004879
872 Ga0451800_0435002
873 Ga0451802_1617884
874 Ga0451804_0553819
875 Ga0451807_0833619
876 Ga0451855_1366561
877 Ga0439449_0017485
878 Ga0439457_027196
879 Ga0450919_003166
880 Ga0450898_028713
881 Ga0450906_023953
882 Ga0439446_0018184
883 Ga0439434_0013319
884 Ga0450918_000218
885 Ga0466969_0033048
886 Ga0466978_0127421
887 Ga0453683_0005531
888 Ga0466965_0033846
889 Ga0466961_0000242
890 Ga0466964_0006208
891 Ga0453684_0021150
892 Ga0466968_0085874
893 Ga0466970_0002465
894 Ga0466960_0034748
895 Ga0466959_0016492
896 Ga0451576_0039332
897 Ga0451576_0041514
898 Ga0466967_0006234
899 Ga0495592_0000495
900 Ga0495638_0133199
901 Ga0495639_0003270
902 Ga0495610_0062947
903 Ga0495616_0000899
904 Ga0495632_0017745
905 Ga0495637_0007675
906 Ga0495643_0113569
907 Ga0495666_0066709
908 Ga0495654_0002885
909 Ga0495625_0000057
910 Ga0495599_0130581
911 Ga0495624_0082086
912 Ga0495672_0108136
913 Ga0495676_0061247
914 Ga0495676_0233218
915 Ga0495685_035318
916 Ga0495593_0006885
917 Ga0495614_0014202
918 Ga0496101_0044140
919 Ga0496102_0012945
920 Ga0496102_0045310
921 Ga0496102_0474739
922 Ga0496103_0037782
923 Ga0496104_0002642
924 Ga0496106_0481355
925 Ga0496108_0073364
926 Ga0496109_0036306
927 Ga0496110_0020858
928 Ga0496111_0056807
929 Ga0496122_0000039
930 Ga0496122_0144007
931 Ga0496123_0000026
932 Ga0496124_0000126
933 Ga0496124_0011786
934 Ga0496125_0029741
935 Ga0496125_0079785
936 Ga0496125_0164908
937 Ga0501034_0049824
938 Ga0501034_0093665
939 Ga0501034_0153637
940 Ga0501037_0064679
941 Ga0501039_0393811
942 Ga0501043_0026628
943 Ga0501043_0159304
944 Ga0501047_0078127
945 Ga0501067_0003970
946 Ga0501070_0129165
947 Ga0501072_0551821
948 Ga0501073_0026363
949 Ga0501076_0155878
950 Ga0501077_0085280
951 Ga0501249_013664
952 Ga0501225_0005204
953 Ga0501080_0177944
954 Ga0501083_0013652
955 Ga0501035_0015893
956 Ga0501035_0082715
957 Ga0501044_0056675
958 Ga0501044_0149309
959 nmdc:mga03683_394_c1
960 nmdc:mga0yw44_23307_c1
961 nmdc:mga0k408_12966_c1
962 nmdc:mga0k408_50518_c2
963 nmdc:mga0k408_9068_c1
964 nmdc:mga06z11_4490_c1
965 nmdc:mga07m45_119790_c1
966 nmdc:mga07m45_31081_c1
967 nmdc:mga05p37_2330_c1
968 nmdc:mga05p37_3465_c1
969 nmdc:mga05p37_3512_c1
970 nmdc:mga05p37_4649_c1
971 nmdc:mga09592_13107_c1
972 nmdc:mga09592_18143_c1
973 nmdc:mga0qj67_689_c1
974 nmdc:mga06r32_1730_c1
975 nmdc:mga06r32_79371_c1
976 nmdc:mga0n895_2591_c1
977 nmdc:mga0n895_26241_c1
978 nmdc:mga0n895_30084_c1
979 nmdc:mga0n895_4605_c1
980 nmdc:mga0rr50_112808_c1
981 nmdc:mga0rr50_234367_c1
982 nmdc:mga0rr50_4214_c1
983 nmdc:mga0rr50_43238_c1
984 nmdc:mga08x19_119008_c1
985 nmdc:mga08x19_183388_c1
986 nmdc:mga08x19_2840_c1
987 nmdc:mga08x19_89314_c1
988 nmdc:mga0a205_110829_c1
989 nmdc:mga0a205_15780_c1
990 nmdc:mga0a205_23567_c1
991 nmdc:mga0a205_70466_c1
992 Ga0500610_0015661
993 Ga0500610_0078864
994 Ga0500578_0000040
995 Ga0500651_0000261
996 Ga0500651_0128722
997 Ga0500594_0000600
998 Ga0500594_0004565
999 Ga0500628_002997
1000 Ga0500655_011283
1001 Ga0500658_0008702
1002 Ga0500658_0009380
1003 Ga0500559_0001133
1004 Ga0500559_0035868
1005 Ga0500622_0000138
1006 Ga0500622_0005474
1007 Ga0500627_0075640
1008 Ga0500634_0074122
1009 Ga0501084_0110608
1010 Ga0501082_0018308
1011 Ga0466962_0118867
1012 2511243031
1013 2513229324
1014 2548498363
1015 2587758791
1016 2588290715
1017 2599447312
1018 2599622893
1019 2599671372
1020 2599679591
1021 2599691607
1022 2643867636
1023 2643972207
1024 2643990554
1025 2644062838
1026 2644070527
1027 2644141682
1028 2644247417
1029 2644275547
1030 2644294928
1031 2644325022
1032 2644400250
1033 2644648902
1034 2738718747
1035 2738746128
1036 2738884938
1037 2739243837
1038 2739280765
1039 2739355358
1040 2816472677
1041 2819602309
1042 2831265725
1043 2838056440
1044 2842681860
1045 2842720225
1046 2842737199
1047 2842750438
1048 2899930587
1049 2900582385
1050 2904452417
1051 2904458435
1052 2904481368
1053 2904546944
1054 2919466452
1055 2928039701
1056 2928044694
1057 2928052493
1058 2928064843
1059 2928074683
1060 2928087179
1061 2928118435
1062 2929164416
1063 2929522333
1064 2945910884
1065 2945946745
1066 2945976459
1067 2945986876
1068 2974322796
1069 2990713051
1070 643597879

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

30

329

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.7702 11 289
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7484 10 285
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.7287 11 289
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.7272 11 286
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7122 11 286
ID Description Score Start End Superfamily
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7855 14 286 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7723 13 292 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7722 46 291 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7704 14 286 1.10.3720.10
af_Q2G2B0_2_264_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7689 9 286 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4Q5R4M2-F1-model_v4 ABC transporter permease 0.9312 11 234 GO:0005886
GO:0055085
AF-A0A6P0QT05-F1-model_v4 deleted 0.9156 7 220
AF-A0A3G6WVH1-F1-model_v4 deleted 0.895 30 223
AF-A0A4Q5R4M2-F1-model_v4 ABC transporter permease 0.8916 11 234 GO:0005886
GO:0055085
AF-A0A7V1MI83-F1-model_v4 ABC transporter permease 0.8915 1 223 GO:0005886
GO:0055085

Map