F460653

General Info

Members Datasets Scaffolds Average Seq Length
535 260 535 205

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10755963|Ga0105238_107559631
Length 220
Sequence MQWLRRSFIAGFFVTVPLIISVAAILWLFRLVDGLVGPLYIKLLGPNAVPPGLGVATTALAILLVGAIATNVVGKRLLQRTEWLLMHVPLFRSIYAPVKQLVVAFSPDNEYGFKRVVLIEDVSRGFLLGFLTREFTIDRGQGPEPLVAVYVPTNHLYLGDIVICPRDRASYPDITVEQGIRIFLTGGMALAGRIGARRGDDRVGDFRVQSGVLTLYKGRE

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
180 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
183 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
184 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
185 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
253 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
254 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 0
Rhizoplane 4.11
Rhizosphere 90.28
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10002619 3300005290 Bacteria 4325
2 Ga0065712_10112318 3300005290 Bacteria 1802
3 Ga0065712_10317043 3300005290 Unclassified 834
4 Ga0065715_10018429 3300005293 Bacteria 3032
5 Ga0065715_10097585 3300005293 Bacteria 3682
6 Ga0065715_10154316 3300005293 Bacteria 1694
7 Ga0065715_10202184 3300005293 Bacteria 1356
8 Ga0065715_10283236 3300005293 Bacteria 1081
9 Ga0065707_10002935 3300005295 Bacteria 6637
10 Ga0065707_10114178 3300005295 Bacteria 2304
11 Ga0065707_10145516 3300005295 Bacteria 1719
12 Ga0065707_10397455 3300005295 Bacteria 857
13 Ga0070658_10188679 3300005327 Bacteria 1737
14 Ga0070676_10028753 3300005328 Bacteria 3158
15 Ga0070676_10053472 3300005328 Bacteria 2379
16 Ga0070683_100086185 3300005329 Bacteria 2945
17 Ga0070690_100019138 3300005330 Bacteria 4149
18 Ga0070670_100013699 3300005331 Bacteria 6949
19 Ga0070670_100023819 3300005331 Bacteria 5267
20 Ga0070670_100144660 3300005331 Bacteria 2056
21 Ga0070670_100193329 3300005331 Bacteria 1768
22 Ga0070677_10123467 3300005333 Bacteria 1172
23 Ga0070677_10220866 3300005333 Bacteria 925
24 Ga0068869_100049354 3300005334 Bacteria 3046
25 Ga0068869_100083017 3300005334 Bacteria 2396
26 Ga0068869_100246271 3300005334 Unclassified 1426
27 Ga0070666_10047510 3300005335 Bacteria 2882
28 Ga0070680_100044316 3300005336 Bacteria 3615
29 Ga0070682_100443072 3300005337 Bacteria 993
30 Ga0068868_100062110 3300005338 Bacteria 2961
31 Ga0070689_100039302 3300005340 Bacteria 3622
32 Ga0070689_100997082 3300005340 Bacteria 745
33 Ga0070691_10025596 3300005341 Bacteria 2748
34 Ga0070687_100123098 3300005343 Unclassified 1486
35 Ga0070687_100537898 3300005343 Unclassified 793
36 Ga0070661_100021350 3300005344 Bacteria 4622
37 Ga0070692_10029084 3300005345 Bacteria 2753
38 Ga0070668_100005545 3300005347 Bacteria 9365
39 Ga0070669_100025522 3300005353 Bacteria 4244
40 Ga0070675_100222314 3300005354 Unclassified 1645
41 Ga0070675_100640074 3300005354 Bacteria 966
42 Ga0070675_100777513 3300005354 Bacteria 875
43 Ga0070671_100202840 3300005355 Bacteria 1682
44 Ga0070674_100049731 3300005356 Bacteria 2883
45 Ga0070674_100198478 3300005356 Bacteria 1548
46 Ga0070674_100337625 3300005356 Bacteria 1213
47 Ga0070673_100034852 3300005364 Bacteria 3813
48 Ga0070673_100223534 3300005364 Bacteria 1630
49 Ga0070673_100312650 3300005364 Bacteria 1386
50 Ga0070673_100345898 3300005364 Bacteria 1319
51 Ga0070673_100483559 3300005364 Bacteria 1118
52 Ga0070688_100020716 3300005365 Bacteria 3828
53 Ga0070688_100053447 3300005365 Bacteria 2527
54 Ga0070688_100223070 3300005365 Bacteria 1329
55 Ga0070688_100347336 3300005365 Bacteria 1085
56 Ga0070659_100047831 3300005366 Bacteria 3357
57 Ga0070659_100265501 3300005366 Bacteria 1425
58 Ga0070659_100396721 3300005366 Unclassified 1164
59 Ga0070659_101079130 3300005366 Bacteria 707
60 Ga0070667_100190076 3300005367 Bacteria 1819
61 Ga0070667_100375559 3300005367 Bacteria 1290
62 Ga0070701_10010253 3300005438 Bacteria 4136
63 Ga0070701_10020810 3300005438 Bacteria 3120
64 Ga0070701_10174201 3300005438 Unclassified 1255
65 Ga0070701_10326874 3300005438 Bacteria 951
66 Ga0070711_100215273 3300005439 Bacteria 1490
67 Ga0070700_100043722 3300005441 Bacteria 2757
68 Ga0070663_100115274 3300005455 Bacteria 2024
69 Ga0070663_100277849 3300005455 Bacteria 1334
70 Ga0070663_100847532 3300005455 Unclassified 786
71 Ga0070678_100010948 3300005456 Bacteria 5567
72 Ga0070678_100117354 3300005456 Bacteria 2093
73 Ga0070662_100023264 3300005457 Bacteria 4254
74 Ga0070662_100042946 3300005457 Bacteria 3232
75 Ga0070662_100560632 3300005457 Bacteria 958
76 Ga0070681_10141241 3300005458 Bacteria 2338
77 Ga0070681_10160798 3300005458 Bacteria 2170
78 Ga0068867_100034734 3300005459 Bacteria 3657
79 Ga0068867_100346688 3300005459 Bacteria 1238
80 Ga0070706_100304782 3300005467 Bacteria 1486
81 Ga0070707_100095763 3300005468 Bacteria 2875
82 Ga0070698_100315432 3300005471 Bacteria 1494
83 Ga0070679_100085984 3300005530 Bacteria 3132
84 Ga0070684_100000213 3300005535 Bacteria 40774
85 Ga0070684_100021090 3300005535 Bacteria 5413
86 Ga0070672_100260643 3300005543 Bacteria 1462
87 Ga0070672_100491436 3300005543 Bacteria 1061
88 Ga0070686_100030771 3300005544 Bacteria 3276
89 Ga0070695_100458497 3300005545 Bacteria 978
90 Ga0070693_100018762 3300005547 Bacteria 3617
91 Ga0070693_100048812 3300005547 Bacteria 2412
92 Ga0070693_100345193 3300005547 Bacteria 1017
93 Ga0070704_100019929 3300005549 Bacteria 4316
94 Ga0070704_100083332 3300005549 Bacteria 2360
95 Ga0070704_100105787 3300005549 Bacteria 2131
96 Ga0068855_100197821 3300005563 Bacteria 2264
97 Ga0068855_100367469 3300005563 Bacteria 1582
98 Ga0070664_100003485 3300005564 Bacteria 12706
99 Ga0070664_100251768 3300005564 Bacteria 1588
100 Ga0070664_100563693 3300005564 Bacteria 1054
101 Ga0070664_100869639 3300005564 Bacteria 844
102 Ga0068857_100115181 3300005577 Bacteria 2418
103 Ga0068857_100145826 3300005577 Bacteria 2142
104 Ga0068854_100072781 3300005578 Bacteria 2517
105 Ga0068856_100358811 3300005614 Unclassified 1476
106 Ga0070702_100020751 3300005615 Bacteria 3446
107 Ga0068852_100027261 3300005616 Bacteria 4655
108 Ga0068852_100385947 3300005616 Bacteria 1375
109 Ga0068859_100105083 3300005617 Bacteria 2883
110 Ga0068859_100460888 3300005617 Bacteria 1367
111 Ga0068859_100952348 3300005617 Unclassified 942
112 Ga0068864_100235982 3300005618 Bacteria 1693
113 Ga0068864_100394559 3300005618 Bacteria 1314
114 Ga0068866_10096221 3300005718 Bacteria 1623
115 Ga0068861_100017062 3300005719 Bacteria 5150
116 Ga0068861_100130224 3300005719 Bacteria 2041
117 Ga0068861_100513805 3300005719 Bacteria 1085
118 Ga0068861_100676883 3300005719 Bacteria 956
119 Ga0068861_101107645 3300005719 Bacteria 761
120 Ga0068858_100042644 3300005842 Bacteria 4207
121 Ga0068858_100188574 3300005842 Bacteria 1948
122 Ga0068860_100169730 3300005843 Bacteria 2107
123 Ga0068862_100016570 3300005844 Bacteria 6137
124 Ga0068862_100023828 3300005844 Bacteria 5130
125 Ga0068862_100522120 3300005844 Bacteria 1130
126 Ga0075365_10007126 3300006038 Bacteria 6237
127 Ga0075365_10047716 3300006038 Bacteria 2816
128 Ga0075368_10003124 3300006042 Bacteria 5495
129 Ga0075364_10011584 3300006051 Bacteria 5359
130 Ga0075367_10003066 3300006178 Bacteria 7835
131 Ga0075367_10442936 3300006178 Unclassified 823
132 Ga0075369_10100541 3300006186 Bacteria 1297
133 Ga0075366_10007177 3300006195 Bacteria 6138
134 Ga0075366_10355114 3300006195 Bacteria 900
135 Ga0097621_100028109 3300006237 Bacteria 4430
136 Ga0097621_100812541 3300006237 Unclassified 867
137 Ga0075370_10033912 3300006353 Bacteria 2860
138 Ga0068871_100607659 3300006358 Bacteria 995
139 Ga0068871_100790291 3300006358 Bacteria 874
140 Ga0075428_100006187 3300006844 Bacteria 13316
141 Ga0075431_100142913 3300006847 Bacteria 2467
142 Ga0075431_100494938 3300006847 Bacteria 1214
143 Ga0075433_10112240 3300006852 Bacteria 2418
144 Ga0075434_100001737 3300006871 Bacteria 18704
145 Ga0075434_100196888 3300006871 Bacteria 2035
146 Ga0075434_100278027 3300006871 Bacteria 1694
147 Ga0075434_100328886 3300006871 Bacteria 1549
148 Ga0075434_100413990 3300006871 Bacteria 1369
149 Ga0075434_100658306 3300006871 Bacteria 1065
150 Ga0075429_100051387 3300006880 Bacteria 3587
151 Ga0075429_100497814 3300006880 Bacteria 1068
152 Ga0068865_100095685 3300006881 Bacteria 2164
153 Ga0068865_100245525 3300006881 Unclassified 1410
154 Ga0068865_100297874 3300006881 Bacteria 1290
155 Ga0097620_100105077 3300006931 Bacteria 2883
156 Ga0097620_100302895 3300006931 Bacteria 1692
157 Ga0097620_100460846 3300006931 Bacteria 1367
158 Ga0097620_100952268 3300006931 Unclassified 942
159 Ga0075435_100001458 3300007076 Bacteria 15191
160 Ga0075435_100030576 3300007076 Bacteria 4236
161 Ga0075435_100096310 3300007076 Bacteria 2448
162 Ga0075435_100539614 3300007076 Unclassified 1010
163 Ga0105240_10278604 3300009093 Bacteria 1922
164 Ga0105240_10940545 3300009093 Unclassified 928
165 Ga0111539_10000512 3300009094 Bacteria 49211
166 Ga0111539_10001914 3300009094 Bacteria 27722
167 Ga0111539_10009801 3300009094 Bacteria 12091
168 Ga0111539_10125663 3300009094 Bacteria 3005
169 Ga0111539_10192331 3300009094 Bacteria 2380
170 Ga0111539_10195219 3300009094 Bacteria 2361
171 Ga0111539_10627154 3300009094 Bacteria 1252
172 Ga0111539_10805781 3300009094 Bacteria 1093
173 Ga0111539_10900625 3300009094 Bacteria 1029
174 Ga0111539_11422240 3300009094 Bacteria 804
175 Ga0111539_11734897 3300009094 Unclassified 724
176 Ga0105245_10315143 3300009098 Bacteria 1539
177 Ga0105245_11473898 3300009098 Unclassified 731
178 Ga0114129_10007864 3300009147 Bacteria 15169
179 Ga0114129_10044141 3300009147 Bacteria 6271
180 Ga0114129_10048827 3300009147 Bacteria 5948
181 Ga0114129_10380665 3300009147 Bacteria 1864
182 Ga0114129_10458172 3300009147 Bacteria 1671
183 Ga0114129_11274450 3300009147 Bacteria 912
184 Ga0105243_10009828 3300009148 Bacteria 7281
185 Ga0105241_10117423 3300009174 Bacteria 2138
186 Ga0105242_10177626 3300009176 Bacteria 1876
187 Ga0105242_10332953 3300009176 Bacteria 1396
188 Ga0105242_10343296 3300009176 Bacteria 1377
189 Ga0105242_10443131 3300009176 Unclassified 1222
190 Ga0105248_10004840 3300009177 Bacteria 14908
191 Ga0105248_10033622 3300009177 Bacteria 5728
192 Ga0105248_10199785 3300009177 Bacteria 2253
193 Ga0105248_10210289 3300009177 Bacteria 2192
194 Ga0105248_10836044 3300009177 Bacteria 1039
195 Ga0105238_10380557 3300009551 Bacteria 1403
196 Ga0105238_10755963 3300009551 Bacteria 986
197 Ga0105249_10028686 3300009553 Bacteria 5023
198 Ga0105249_10263133 3300009553 Bacteria 1715
199 Ga0105249_10329213 3300009553 Bacteria 1541
200 Ga0105239_10114307 3300010375 Bacteria 2994
201 Ga0105246_11320867 3300011119 Bacteria 669
202 Ga0157370_10366137 3300013104 Bacteria 1328
203 Ga0157374_10216644 3300013296 Bacteria 1878
204 Ga0157378_10257850 3300013297 Bacteria 1672
205 Ga0157378_11838241 3300013297 Bacteria 654
206 Ga0163162_10236445 3300013306 Bacteria 1957
207 Ga0157375_11256666 3300013308 Unclassified 870
208 Ga0157380_10012408 3300014326 Bacteria 6183
209 Ga0157380_10028867 3300014326 Bacteria 4235
210 Ga0157380_10136255 3300014326 Bacteria 2102
211 Ga0157380_10267614 3300014326 Bacteria 1556
212 Ga0157380_10700138 3300014326 Bacteria 1018
213 Ga0157380_10754838 3300014326 Bacteria 985
214 Ga0157380_11154145 3300014326 Unclassified 816
215 Ga0157377_10142010 3300014745 Bacteria 1476
216 Ga0157376_10052778 3300014969 Bacteria 3382
217 Ga0157376_10535494 3300014969 Bacteria 1157
218 Ga0207666_1017999 3300025271 Bacteria 1024
219 Ga0207697_10048968 3300025315 Bacteria 1744
220 Ga0207653_10012507 3300025885 Bacteria 2650
221 Ga0207682_10040786 3300025893 Bacteria 1893
222 Ga0207682_10156975 3300025893 Unclassified 1029
223 Ga0207642_10074523 3300025899 Bacteria 1627
224 Ga0207688_10094660 3300025901 Bacteria 1719
225 Ga0207680_10072653 3300025903 Bacteria 2136
226 Ga0207647_10026527 3300025904 Bacteria 3790
227 Ga0207645_10004801 3300025907 Bacteria 9940
228 Ga0207645_10095662 3300025907 Bacteria 1913
229 Ga0207645_10144081 3300025907 Bacteria 1553
230 Ga0207643_10461625 3300025908 Bacteria 809
231 Ga0207684_10217008 3300025910 Bacteria 1650
232 Ga0207684_10502344 3300025910 Bacteria 1039
233 Ga0207654_10062896 3300025911 Bacteria 2176
234 Ga0207707_10035269 3300025912 Bacteria 4375
235 Ga0207707_10232195 3300025912 Bacteria 1605
236 Ga0207695_10107454 3300025913 Bacteria 2776
237 Ga0207663_10144579 3300025916 Bacteria 1661
238 Ga0207660_10671897 3300025917 Unclassified 845
239 Ga0207662_10019837 3300025918 Bacteria 3831
240 Ga0207657_10174048 3300025919 Bacteria 1743
241 Ga0207649_10005774 3300025920 Bacteria 6700
242 Ga0207652_10057453 3300025921 Bacteria 3351
243 Ga0207681_10030196 3300025923 Bacteria 3531
244 Ga0207681_10073425 3300025923 Bacteria 2393
245 Ga0207681_10124983 3300025923 Bacteria 1893
246 Ga0207681_10127065 3300025923 Bacteria 1879
247 Ga0207681_10796462 3300025923 Bacteria 789
248 Ga0207694_10236296 3300025924 Bacteria 1493
249 Ga0207694_10608786 3300025924 Bacteria 919
250 Ga0207650_10002558 3300025925 Bacteria 12608
251 Ga0207650_10052308 3300025925 Bacteria 3025
252 Ga0207650_10055778 3300025925 Bacteria 2934
253 Ga0207650_10112252 3300025925 Bacteria 2112
254 Ga0207659_10229685 3300025926 Bacteria 1496
255 Ga0207659_10670849 3300025926 Bacteria 887
256 Ga0207700_10018642 3300025928 Bacteria 4670
257 Ga0207700_10793400 3300025928 Bacteria 847
258 Ga0207644_10068704 3300025931 Bacteria 2585
259 Ga0207644_10155998 3300025931 Bacteria 1770
260 Ga0207690_10142835 3300025932 Bacteria 1766
261 Ga0207690_10250313 3300025932 Bacteria 1368
262 Ga0207690_10267609 3300025932 Unclassified 1326
263 Ga0207690_10314693 3300025932 Bacteria 1229
264 Ga0207706_10025340 3300025933 Bacteria 5315
265 Ga0207706_10045161 3300025933 Bacteria 3904
266 Ga0207706_10358046 3300025933 Bacteria 1268
267 Ga0207686_10040858 3300025934 Bacteria 2823
268 Ga0207709_10041775 3300025935 Bacteria 2754
269 Ga0207670_10059839 3300025936 Bacteria 2592
270 Ga0207669_10010037 3300025937 Bacteria 4542
271 Ga0207669_10018356 3300025937 Bacteria 3614
272 Ga0207669_10054679 3300025937 Bacteria 2413
273 Ga0207669_10301580 3300025937 Bacteria 1218
274 Ga0207704_10069821 3300025938 Bacteria 2222
275 Ga0207691_10194892 3300025940 Bacteria 1766
276 Ga0207691_10273269 3300025940 Bacteria 1455
277 Ga0207691_10485989 3300025940 Unclassified 1049
278 Ga0207711_10048716 3300025941 Bacteria 3625
279 Ga0207711_10343976 3300025941 Bacteria 1381
280 Ga0207711_10512701 3300025941 Bacteria 1118
281 Ga0207711_10639480 3300025941 Bacteria 992
282 Ga0207689_10083290 3300025942 Bacteria 2630
283 Ga0207689_10087572 3300025942 Bacteria 2558
284 Ga0207661_10001430 3300025944 Bacteria 16095
285 Ga0207661_10002652 3300025944 Bacteria 12308
286 Ga0207679_10006989 3300025945 Bacteria 7154
287 Ga0207679_10159812 3300025945 Bacteria 1844
288 Ga0207679_10217763 3300025945 Bacteria 1605
289 Ga0207667_10097614 3300025949 Bacteria 3032
290 Ga0207667_10648305 3300025949 Unclassified 1062
291 Ga0207651_10038744 3300025960 Bacteria 3135
292 Ga0207651_10184824 3300025960 Bacteria 1657
293 Ga0207651_10349985 3300025960 Bacteria 1244
294 Ga0207712_10030890 3300025961 Bacteria 3605
295 Ga0207712_10216944 3300025961 Bacteria 1527
296 Ga0207668_10134823 3300025972 Bacteria 1890
297 Ga0207668_10153312 3300025972 Bacteria 1787
298 Ga0207640_10226376 3300025981 Bacteria 1435
299 Ga0207677_10027982 3300026023 Bacteria 3559
300 Ga0207677_10143333 3300026023 Bacteria 1833
301 Ga0207703_10154777 3300026035 Bacteria 2002
302 Ga0207703_10184687 3300026035 Bacteria 1842
303 Ga0207678_10123974 3300026067 Bacteria 2205
304 Ga0207708_10001820 3300026075 Bacteria 15737
305 Ga0207708_10040703 3300026075 Bacteria 3543
306 Ga0207708_10061138 3300026075 Bacteria 2876
307 Ga0207708_10074839 3300026075 Bacteria 2596
308 Ga0207708_10075078 3300026075 Bacteria 2592
309 Ga0207641_10210148 3300026088 Bacteria 1799
310 Ga0207641_10859035 3300026088 Unclassified 900
311 Ga0207648_10000959 3300026089 Bacteria 32621
312 Ga0207648_10248001 3300026089 Bacteria 1587
313 Ga0207676_10049985 3300026095 Bacteria 3257
314 Ga0207674_10142992 3300026116 Bacteria 2352
315 Ga0207674_10149511 3300026116 Bacteria 2293
316 Ga0207675_100021012 3300026118 Bacteria 6086
317 Ga0207675_100041107 3300026118 Bacteria 4318
318 Ga0207675_100058891 3300026118 Bacteria 3584
319 Ga0207675_100213852 3300026118 Bacteria 1855
320 Ga0207675_100595574 3300026118 Bacteria 1108
321 Ga0207675_100647230 3300026118 Unclassified 1063
322 Ga0207675_101122487 3300026118 Unclassified 806
323 Ga0207683_10015366 3300026121 Bacteria 6518
324 Ga0207683_10238190 3300026121 Bacteria 1660
325 Ga0207683_10551791 3300026121 Unclassified 1065
326 Ga0207683_10803172 3300026121 Bacteria 873
327 Ga0207698_10414892 3300026142 Unclassified 1290
328 Ga0207698_11038178 3300026142 Bacteria 831
329 Ga0209983_1016753 3300027665 Bacteria 1515
330 Ga0209813_10026655 3300027866 Bacteria 1673
331 Ga0207428_10000574 3300027907 Bacteria 43446
332 Ga0207428_10000658 3300027907 Bacteria 40461
333 Ga0207428_10020157 3300027907 Bacteria 5670
334 Ga0207428_10027003 3300027907 Bacteria 4783
335 Ga0207428_10262144 3300027907 Bacteria 1287
336 Ga0268265_10016262 3300028380 Bacteria 5107
337 Ga0268265_10029346 3300028380 Bacteria 3947
338 Ga0268265_10253192 3300028380 Bacteria 1561
339 Ga0268265_10261287 3300028380 Bacteria 1539
340 Ga0268265_10262261 3300028380 Bacteria 1537
341 Ga0268264_10189786 3300028381 Bacteria 1872
342 Ga0268264_10241461 3300028381 Bacteria 1673
343 Ga0307408_100063720 3300031548 Bacteria 2698
344 Ga0307408_101041518 3300031548 Bacteria 756
345 Ga0307405_10006363 3300031731 Bacteria 5804
346 Ga0307405_10496745 3300031731 Bacteria 977
347 Ga0307410_10007286 3300031852 Bacteria 6045
348 Ga0307410_10061361 3300031852 Bacteria 2573
349 Ga0307410_10228013 3300031852 Bacteria 1437
350 Ga0307406_10834899 3300031901 Unclassified 780
351 Ga0307409_100072275 3300031995 Bacteria 2746
352 Ga0307409_100538395 3300031995 Bacteria 1144
353 Ga0307416_100029325 3300032002 Bacteria 4108
354 Ga0307416_100068319 3300032002 Bacteria 2936
355 Ga0307416_100233377 3300032002 Bacteria 1776
356 Ga0307416_100397650 3300032002 Bacteria 1414
357 Ga0307416_100564764 3300032002 Unclassified 1213
358 Ga0307416_101805867 3300032002 Bacteria 715
359 Ga0307414_10270413 3300032004 Bacteria 1423
360 Ga0307411_10102883 3300032005 Bacteria 2025
361 Ga0307411_10129057 3300032005 Bacteria 1844
362 Ga0307411_10193844 3300032005 Bacteria 1554
363 Ga0307411_10194446 3300032005 Bacteria 1552
364 Ga0373938_0073997 3300034957 Bacteria 819
365 Ga0373940_0073249 3300035088 Unclassified 1001
366 Ga0373936_0281824 3300035113 Unclassified 747
367 Ga0373939_0028886 3300035114 Bacteria 1582
368 Ga0373945_0093038 3300035116 Unclassified 1170
369 Ga0373960_0030610 3300035121 Bacteria 1500
370 Ga0373943_0048756 3300035170 Bacteria 2076
371 Ga0373955_0442476 3300035172 Bacteria 792
372 Ga0373942_0006218 3300035207 Bacteria 2757
373 Ga0373924_0087018 3300035410 Bacteria 1334
374 Ga0373927_0133554 3300035695 Bacteria 1622
375 Ga0373937_0001942 3300036401 Bacteria 17300
376 Ga0373925_0012122 3300037068 Bacteria 6239
377 Ga0395905_0282231 3300037471 Bacteria 1547
378 Ga0451789_1281983 3300041443 Bacteria 952
379 Ga0451800_0974527 3300041459 Unclassified 726
380 Ga0451853_0228372 3300041512 Unclassified 1156
381 Ga0451853_0573528 3300041512 Unclassified 804
382 Ga0439433_0018173 3300041999 Bacteria 1564
383 Ga0450894_012701 3300042131 Unclassified 1103
384 Ga0439446_0180376 3300042156 Unclassified 706
385 Ga0439435_0003763 3300042436 Bacteria 3193
386 Ga0451577_0046462 3300042876 Bacteria 3885
387 Ga0451577_0541077 3300042876 Bacteria 1057
388 Ga0453684_0016537 3300044712 Bacteria 11519
389 Ga0453684_0664494 3300044712 Bacteria 1136
390 Ga0466957_0500715 3300044842 Unclassified 842
391 Ga0466959_0195915 3300045049 Bacteria 1408
392 Ga0451576_0595731 3300045051 Unclassified 1162
393 Ga0466967_0266701 3300045976 Bacteria 1639
394 Ga0466967_0271806 3300045976 Bacteria 1624
395 Ga0495662_0044246 3300046476 Bacteria 2150
396 Ga0495628_0347348 3300046516 Unclassified 1091
397 Ga0495628_0494320 3300046516 Bacteria 884
398 Ga0495630_0221894 3300046517 Bacteria 1443
399 Ga0495598_0087526 3300046537 Bacteria 1010
400 Ga0495621_0079561 3300046539 Bacteria 1220
401 Ga0495667_0217781 3300046559 Bacteria 1219
402 Ga0495599_0110315 3300046678 Bacteria 1714
403 Ga0495599_0354825 3300046678 Bacteria 879
404 Ga0495613_0071535 3300046689 Bacteria 2528
405 Ga0495686_0212747 3300047472 Bacteria 1104
406 Ga0496102_0934982 3300048905 Bacteria 788
407 Ga0496104_0003311 3300048907 Bacteria 13902
408 Ga0496106_0208517 3300048909 Bacteria 1556
409 Ga0496108_0012914 3300048911 Bacteria 6806
410 Ga0496109_0003151 3300048912 Bacteria 13754
411 Ga0496109_0511993 3300048912 Unclassified 1133
412 Ga0496109_0570499 3300048912 Unclassified 1067
413 Ga0496109_0580127 3300048912 Bacteria 1057
414 Ga0496110_0009805 3300048913 Bacteria 7758
415 Ga0496110_0232016 3300048913 Bacteria 1679
416 Ga0496110_0268287 3300048913 Bacteria 1554
417 Ga0496110_0352288 3300048913 Bacteria 1341
418 Ga0496111_0544357 3300048914 Bacteria 852
419 Ga0496112_0000717 3300048915 Bacteria 23023
420 Ga0496112_0189779 3300048915 Bacteria 2017
421 Ga0496112_0283239 3300048915 Bacteria 1604
422 Ga0496112_0636185 3300048915 Unclassified 997
423 Ga0496113_0239117 3300048916 Bacteria 1449
424 Ga0496114_0544986 3300048917 Bacteria 1025
425 Ga0496114_0702560 3300048917 Unclassified 887
426 Ga0501033_0117061 3300049570 Bacteria 1936
427 Ga0501034_0001614 3300049571 Bacteria 29290
428 Ga0501036_0026429 3300049572 Bacteria 4900
429 Ga0501036_0052796 3300049572 Bacteria 3443
430 Ga0501036_0457091 3300049572 Bacteria 1064
431 Ga0501037_0384706 3300049573 Unclassified 964
432 Ga0501039_0082902 3300049575 Bacteria 2497
433 Ga0501039_0180668 3300049575 Bacteria 1659
434 Ga0501039_0246502 3300049575 Bacteria 1405
435 Ga0501040_0061552 3300049576 Bacteria 2582
436 Ga0501041_0021830 3300049577 Bacteria 3835
437 Ga0501041_0109699 3300049577 Bacteria 1712
438 Ga0501041_0151459 3300049577 Bacteria 1448
439 Ga0501043_0273200 3300049579 Bacteria 1297
440 Ga0501047_0209696 3300049581 Bacteria 1807
441 Ga0501048_0072673 3300049582 Bacteria 2428
442 Ga0501048_0073428 3300049582 Bacteria 2414
443 Ga0501048_0209678 3300049582 Bacteria 1382
444 Ga0501048_0265045 3300049582 Bacteria 1221
445 Ga0501067_0020356 3300049583 Bacteria 3671
446 Ga0501067_0066226 3300049583 Bacteria 2000
447 Ga0501069_0321583 3300049585 Bacteria 909
448 Ga0501070_0776280 3300049586 Unclassified 754
449 Ga0501071_0023114 3300049587 Bacteria 4339
450 Ga0501071_0094123 3300049587 Bacteria 2203
451 Ga0501071_0126453 3300049587 Unclassified 1897
452 Ga0501071_0226020 3300049587 Unclassified 1409
453 Ga0501071_0526630 3300049587 Bacteria 907
454 Ga0501072_0013537 3300049588 Bacteria 6243
455 Ga0501072_0241238 3300049588 Unclassified 1439
456 Ga0501073_0003523 3300049589 Bacteria 11760
457 Ga0501074_0134858 3300049590 Bacteria 1766
458 Ga0501075_0012805 3300049591 Bacteria 5970
459 Ga0501075_0014199 3300049591 Bacteria 5707
460 Ga0501075_0039869 3300049591 Bacteria 3516
461 Ga0501076_0014418 3300049592 Bacteria 5953
462 Ga0501076_0031805 3300049592 Bacteria 4117
463 Ga0501076_0804701 3300049592 Unclassified 775
464 Ga0501079_0042170 3300049741 Bacteria 3525
465 Ga0501079_0247263 3300049741 Bacteria 1394
466 Ga0501079_0555324 3300049741 Bacteria 903
467 Ga0501080_0187391 3300049742 Bacteria 1902
468 Ga0501080_0544191 3300049742 Bacteria 1034
469 Ga0501081_0043093 3300049743 Bacteria 3095
470 Ga0501081_0046116 3300049743 Bacteria 2995
471 Ga0501083_0262280 3300049744 Bacteria 1124
472 Ga0501045_0032970 3300049824 Bacteria 3755
473 Ga0501045_0045220 3300049824 Bacteria 3206
474 Ga0501045_0205979 3300049824 Bacteria 1465
475 Ga0501045_0336321 3300049824 Bacteria 1124
476 Ga0501045_0715289 3300049824 Bacteria 739
477 nmdc:mga03683_20734_c1 3300050489 Bacteria 2526
478 nmdc:mga03n38_164324_c1 3300050490 Bacteria 1126
479 nmdc:mga00v17_123973_c1 3300050491 Unclassified 1647
480 nmdc:mga00v17_26716_c1 3300050491 Bacteria 3366
481 nmdc:mga00v17_4710_c1 3300050491 Bacteria 7128
482 nmdc:mga0yw44_44397_c1 3300050492 Bacteria 2658
483 nmdc:mga0yw44_5821_c1 3300050492 Bacteria 5880
484 nmdc:mga0k408_411246_c1 3300050493 Bacteria 805
485 nmdc:mga0k408_7994_c1 3300050493 Bacteria 5671
486 nmdc:mga06z11_2267_c1 3300050494 Bacteria 7319
487 nmdc:mga06z11_398448_c1 3300050494 Unclassified 828
488 nmdc:mga04h51_22198_c1 3300050495 Bacteria 1918
489 nmdc:mga07m45_35200_c1 3300050496 Bacteria 2785
490 nmdc:mga05p37_2107_c3 3300050507 Bacteria 21373
491 nmdc:mga05p37_23171_c1 3300050507 Bacteria 7533
492 nmdc:mga05p37_365850_c1 3300050507 Bacteria 1694
493 nmdc:mga05p37_859692_c1 3300050507 Unclassified 984
494 nmdc:mga06r32_166677_c1 3300050510 Bacteria 2186
495 nmdc:mga06r32_304935_c1 3300050510 Bacteria 1578
496 nmdc:mga06r32_333649_c1 3300050510 Bacteria 1501
497 nmdc:mga06r32_650732_c1 3300050510 Unclassified 1022
498 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
499 nmdc:mga08y16_15384_c1 3300050511 Bacteria 8046
500 nmdc:mga08y16_413944_c1 3300050511 Bacteria 1378
501 nmdc:mga08y16_42111_c1 3300050511 Bacteria 4783
502 nmdc:mga08y16_457924_c1 3300050511 Bacteria 1300
503 nmdc:mga08y16_46791_c1 3300050511 Bacteria 4529
504 nmdc:mga08y16_504_c1 3300050511 Bacteria 36040
505 nmdc:mga08y16_553286_c1 3300050511 Bacteria 1164
506 nmdc:mga08y16_833873_c1 3300050511 Bacteria 912
507 nmdc:mga0n895_10522_c1 3300050512 Bacteria 8181
508 nmdc:mga0n895_1452021_c1 3300050512 Unclassified 653
509 nmdc:mga0n895_230447_c1 3300050512 Unclassified 1880
510 nmdc:mga0n895_253976_c1 3300050512 Bacteria 1784
511 nmdc:mga0n895_305068_c1 3300050512 Bacteria 1614
512 nmdc:mga0n895_352058_c1 3300050512 Bacteria 1492
513 nmdc:mga0n895_840183_c1 3300050512 Bacteria 907
514 nmdc:mga0rr50_241035_c1 3300050513 Bacteria 1499
515 nmdc:mga0rr50_522648_c1 3300050513 Unclassified 1010
516 nmdc:mga0rr50_75639_c1 3300050513 Bacteria 2582
517 nmdc:mga0a205_106639_c1 3300050515 Bacteria 2700
518 nmdc:mga0a205_121162_c1 3300050515 Bacteria 2515
519 nmdc:mga0a205_142168_c1 3300050515 Bacteria 2300
520 nmdc:mga0a205_63715_c1 3300050515 Bacteria 3561
521 nmdc:mga0sz30_25710_c1 3300050516 Bacteria 2408
522 Ga0495595_0092087 3300053084 Bacteria 1455
523 Ga0495619_0366294 3300053085 Bacteria 996
524 Ga0500646_0021345 3300053090 Bacteria 1725
525 Ga0500628_029297 3300053129 Bacteria 1182
526 Ga0500652_090000 3300053131 Unclassified 1281
527 Ga0501084_0018536 3300054114 Bacteria 5793
528 Ga0501084_0615021 3300054114 Unclassified 918
529 Ga0590071_000685 3300059421 Bacteria 9608
530 Ga0590071_013115 3300059421 Bacteria 1942
531 Ga0590075_000348 3300059424 Bacteria 12914
532 Ga0590077_000756 3300059426 Bacteria 8468
533 Ga0501082_0134351 3300060353 Bacteria 2146
534 Ga0501082_0546192 3300060353 Bacteria 1013
535 Ga0530510_0049455 3300061734 Bacteria 3038

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_11838241 Ga0157378_118382412 160
2 3300025893 Ga0207682_10156975 Ga0207682_101569752 181
3 3300050512 nmdc:mga0n895_1452021_c1 nmdc:mga0n895_1452021_c1_32_586 184
4 3300025928 Ga0207700_10018642 Ga0207700_100186424 185
5 3300031852 Ga0307410_10228013 Ga0307410_102280132 185
6 3300049577 Ga0501041_0109699 Ga0501041_0109699_175_810 185
7 3300006880 Ga0075429_100497814 Ga0075429_1004978142 187
8 3300032002 Ga0307416_100397650 Ga0307416_1003976502 188
9 3300049572 Ga0501036_0457091 Ga0501036_0457091_262_864 189
10 3300049581 Ga0501047_0209696 Ga0501047_0209696_175_777 189
11 3300006358 Ga0068871_100607659 Ga0068871_1006076592 190
12 3300037068 Ga0373925_0012122 Ga0373925_0012122_2406_3029 190
13 3300007076 Ga0075435_100539614 Ga0075435_1005396142 191
14 3300050513 nmdc:mga0rr50_522648_c1 nmdc:mga0rr50_522648_c1_123_698 191
15 3300035113 Ga0373936_0281824 Ga0373936_0281824_94_693 192
16 3300005295 Ga0065707_10397455 Ga0065707_103974551 194
17 3300005328 Ga0070676_10053472 Ga0070676_100534723 194
18 3300005340 Ga0070689_100997082 Ga0070689_1009970822 194
19 3300005343 Ga0070687_100537898 Ga0070687_1005378981 194
20 3300005347 Ga0070668_100005545 Ga0070668_1000055457 194
21 3300005364 Ga0070673_100345898 Ga0070673_1003458982 194
22 3300005457 Ga0070662_100042946 Ga0070662_1000429462 194
23 3300005543 Ga0070672_100491436 Ga0070672_1004914362 194
24 3300005547 Ga0070693_100345193 Ga0070693_1003451932 194
25 3300005719 Ga0068861_100513805 Ga0068861_1005138052 194
26 3300005843 Ga0068860_100169730 Ga0068860_1001697302 194
27 3300005844 Ga0068862_100016570 Ga0068862_1000165705 194
28 3300006847 Ga0075431_100142913 Ga0075431_1001429132 194
29 3300009094 Ga0111539_10009801 Ga0111539_100098012 194
30 3300009176 Ga0105242_10443131 Ga0105242_104431312 194
31 3300009177 Ga0105248_10199785 Ga0105248_101997853 194
32 3300009553 Ga0105249_10263133 Ga0105249_102631332 194
33 3300011119 Ga0105246_11320867 Ga0105246_113208671 194
34 3300013308 Ga0157375_11256666 Ga0157375_112566662 194
35 3300014326 Ga0157380_10267614 Ga0157380_102676141 194
36 3300025907 Ga0207645_10095662 Ga0207645_100956622 194
37 3300025923 Ga0207681_10127065 Ga0207681_101270653 194
38 3300025933 Ga0207706_10045161 Ga0207706_100451613 194
39 3300025937 Ga0207669_10301580 Ga0207669_103015802 194
40 3300025940 Ga0207691_10273269 Ga0207691_102732692 194
41 3300025941 Ga0207711_10343976 Ga0207711_103439762 194
42 3300025941 Ga0207711_10512701 Ga0207711_105127012 194
43 3300025961 Ga0207712_10216944 Ga0207712_102169442 194
44 3300025972 Ga0207668_10134823 Ga0207668_101348232 194
45 3300026075 Ga0207708_10040703 Ga0207708_100407032 194
46 3300026118 Ga0207675_100213852 Ga0207675_1002138522 194
47 3300026118 Ga0207675_100595574 Ga0207675_1005955742 194
48 3300028380 Ga0268265_10029346 Ga0268265_100293462 194
49 3300028380 Ga0268265_10261287 Ga0268265_102612872 194
50 3300028381 Ga0268264_10241461 Ga0268264_102414612 194
51 3300036401 Ga0373937_0001942 Ga0373937_0001942_8054_8686 194
52 3300046516 Ga0495628_0347348 Ga0495628_0347348_146_778 194
53 3300050510 nmdc:mga06r32_166677_c1 nmdc:mga06r32_166677_c1_307_891 194
54 3300050511 nmdc:mga08y16_15384_c1 nmdc:mga08y16_15384_c1_4564_5148 194
55 3300053084 Ga0495595_0092087 Ga0495595_0092087_473_1105 194
56 3300005327 Ga0070658_10188679 Ga0070658_101886792 195
57 3300005331 Ga0070670_100193329 Ga0070670_1001933292 195
58 3300005333 Ga0070677_10123467 Ga0070677_101234672 195
59 3300005364 Ga0070673_100223534 Ga0070673_1002235342 195
60 3300005365 Ga0070688_100347336 Ga0070688_1003473361 195
61 3300005456 Ga0070678_100010948 Ga0070678_1000109482 195
62 3300006237 Ga0097621_100028109 Ga0097621_1000281092 195
63 3300006237 Ga0097621_100812541 Ga0097621_1008125411 195
64 3300009093 Ga0105240_10940545 Ga0105240_109405452 195
65 3300009147 Ga0114129_11274450 Ga0114129_112744501 195
66 3300009176 Ga0105242_10343296 Ga0105242_103432962 195
67 3300009177 Ga0105248_10836044 Ga0105248_108360441 195
68 3300009551 Ga0105238_10380557 Ga0105238_103805572 195
69 3300013306 Ga0163162_10236445 Ga0163162_102364453 195
70 3300025893 Ga0207682_10040786 Ga0207682_100407862 195
71 3300025908 Ga0207643_10461625 Ga0207643_104616252 195
72 3300025923 Ga0207681_10030196 Ga0207681_100301962 195
73 3300025924 Ga0207694_10236296 Ga0207694_102362962 195
74 3300025925 Ga0207650_10112252 Ga0207650_101122522 195
75 3300025928 Ga0207700_10793400 Ga0207700_107934002 195
76 3300025937 Ga0207669_10054679 Ga0207669_100546792 195
77 3300025941 Ga0207711_10639480 Ga0207711_106394802 195
78 3300025960 Ga0207651_10184824 Ga0207651_101848242 195
79 3300026088 Ga0207641_10859035 Ga0207641_108590352 195
80 3300026121 Ga0207683_10015366 Ga0207683_100153666 195
81 3300026121 Ga0207683_10551791 Ga0207683_105517912 195
82 3300035695 Ga0373927_0133554 Ga0373927_0133554_450_1037 195
83 3300048912 Ga0496109_0511993 Ga0496109_0511993_77_697 195
84 3300048913 Ga0496110_0232016 Ga0496110_0232016_594_1214 195
85 3300048917 Ga0496114_0702560 Ga0496114_0702560_142_762 195
86 3300059421 Ga0590071_000685 Ga0590071_000685_4298_4930 195
87 3300059424 Ga0590075_000348 Ga0590075_000348_9235_9867 195
88 3300059426 Ga0590077_000756 Ga0590077_000756_3368_4000 195
89 3300005336 Ga0070680_100044316 Ga0070680_1000443164 196
90 3300005356 Ga0070674_100337625 Ga0070674_1003376252 196
91 3300005438 Ga0070701_10174201 Ga0070701_101742012 196
92 3300005438 Ga0070701_10326874 Ga0070701_103268742 196
93 3300005549 Ga0070704_100105787 Ga0070704_1001057872 196
94 3300009094 Ga0111539_10195219 Ga0111539_101952193 196
95 3300009094 Ga0111539_11422240 Ga0111539_114222402 196
96 3300009147 Ga0114129_10380665 Ga0114129_103806652 196
97 3300014326 Ga0157380_10700138 Ga0157380_107001382 196
98 3300014326 Ga0157380_10754838 Ga0157380_107548381 196
99 3300025937 Ga0207669_10010037 Ga0207669_100100374 196
100 3300026075 Ga0207708_10061138 Ga0207708_100611382 196
101 3300026075 Ga0207708_10074839 Ga0207708_100748393 196
102 3300026089 Ga0207648_10248001 Ga0207648_102480012 196
103 3300026118 Ga0207675_101122487 Ga0207675_1011224872 196
104 3300026121 Ga0207683_10803172 Ga0207683_108031722 196
105 3300027907 Ga0207428_10000574 Ga0207428_1000057412 196
106 3300027907 Ga0207428_10020157 Ga0207428_100201573 196
107 3300032002 Ga0307416_100564764 Ga0307416_1005647642 196
108 3300041443 Ga0451789_1281983 Ga0451789_1281983_205_795 196
109 3300042156 Ga0439446_0180376 Ga0439446_0180376_35_640 196
110 3300042436 Ga0439435_0003763 Ga0439435_0003763_2140_2730 196
111 3300046537 Ga0495598_0087526 Ga0495598_0087526_325_915 196
112 3300046539 Ga0495621_0079561 Ga0495621_0079561_196_786 196
113 3300050507 nmdc:mga05p37_365850_c1 nmdc:mga05p37_365850_c1_806_1396 196
114 3300050511 nmdc:mga08y16_46791_c1 nmdc:mga08y16_46791_c1_2161_2751 196
115 3300050511 nmdc:mga08y16_504_c1 nmdc:mga08y16_504_c1_20578_21168 196
116 3300053090 Ga0500646_0021345 Ga0500646_0021345_151_741 196
117 3300053131 Ga0500652_090000 Ga0500652_090000_132_722 196
118 3300005354 Ga0070675_100777513 Ga0070675_1007775132 197
119 3300005366 Ga0070659_100265501 Ga0070659_1002655012 197
120 3300005468 Ga0070707_100095763 Ga0070707_1000957632 197
121 3300006871 Ga0075434_100658306 Ga0075434_1006583062 197
122 3300007076 Ga0075435_100030576 Ga0075435_1000305763 197
123 3300009147 Ga0114129_10044141 Ga0114129_100441414 197
124 3300013104 Ga0157370_10366137 Ga0157370_103661372 197
125 3300025910 Ga0207684_10502344 Ga0207684_105023442 197
126 3300025926 Ga0207659_10670849 Ga0207659_106708492 197
127 3300025932 Ga0207690_10142835 Ga0207690_101428353 197
128 3300025940 Ga0207691_10485989 Ga0207691_104859892 197
129 3300050507 nmdc:mga05p37_23171_c1 nmdc:mga05p37_23171_c1_5708_6319 197
130 3300050512 nmdc:mga0n895_352058_c1 nmdc:mga0n895_352058_c1_382_993 197
131 3300050513 nmdc:mga0rr50_241035_c1 nmdc:mga0rr50_241035_c1_365_976 197
132 3300050515 nmdc:mga0a205_106639_c1 nmdc:mga0a205_106639_c1_792_1403 197
133 3300005341 Ga0070691_10025596 Ga0070691_100255962 199
134 3300026142 Ga0207698_11038178 Ga0207698_110381782 199
135 3300031731 Ga0307405_10496745 Ga0307405_104967451 199
136 3300031852 Ga0307410_10061361 Ga0307410_100613612 199
137 3300031901 Ga0307406_10834899 Ga0307406_108348992 199
138 3300032002 Ga0307416_100233377 Ga0307416_1002333772 199
139 3300032005 Ga0307411_10193844 Ga0307411_101938442 199
140 3300048912 Ga0496109_0580127 Ga0496109_0580127_257_877 199
141 3300048915 Ga0496112_0283239 Ga0496112_0283239_841_1461 199
142 3300006871 Ga0075434_100278027 Ga0075434_1002780272 200
143 3300009094 Ga0111539_10900625 Ga0111539_109006252 200
144 3300049585 Ga0501069_0321583 Ga0501069_0321583_96_698 200
145 3300049589 Ga0501073_0003523 Ga0501073_0003523_6198_6800 200
146 3300050512 nmdc:mga0n895_840183_c1 nmdc:mga0n895_840183_c1_275_877 200
147 3300005333 Ga0070677_10220866 Ga0070677_102208661 201
148 3300005354 Ga0070675_100640074 Ga0070675_1006400742 201
149 3300005365 Ga0070688_100020716 Ga0070688_1000207164 201
150 3300005471 Ga0070698_100315432 Ga0070698_1003154321 201
151 3300005616 Ga0068852_100385947 Ga0068852_1003859472 201
152 3300005617 Ga0068859_100460888 Ga0068859_1004608881 201
153 3300005719 Ga0068861_100676883 Ga0068861_1006768832 201
154 3300006931 Ga0097620_100460846 Ga0097620_1004608462 201
155 3300009094 Ga0111539_10192331 Ga0111539_101923312 201
156 3300014326 Ga0157380_10028867 Ga0157380_100288674 201
157 3300014326 Ga0157380_10136255 Ga0157380_101362552 201
158 3300014326 Ga0157380_11154145 Ga0157380_111541451 201
159 3300014969 Ga0157376_10052778 Ga0157376_100527782 201
160 3300025923 Ga0207681_10073425 Ga0207681_100734253 201
161 3300025926 Ga0207659_10229685 Ga0207659_102296852 201
162 3300026118 Ga0207675_100647230 Ga0207675_1006472302 201
163 3300027907 Ga0207428_10262144 Ga0207428_102621441 201
164 3300041459 Ga0451800_0974527 Ga0451800_0974527_71_679 201
165 3300041512 Ga0451853_0573528 Ga0451853_0573528_62_670 201
166 3300046516 Ga0495628_0494320 Ga0495628_0494320_107_736 201
167 3300046678 Ga0495599_0110315 Ga0495599_0110315_691_1299 201
168 3300049587 Ga0501071_0226020 Ga0501071_0226020_72_677 201
169 3300049591 Ga0501075_0039869 Ga0501075_0039869_2100_2705 201
170 3300054114 Ga0501084_0615021 Ga0501084_0615021_282_887 201
171 3300005438 Ga0070701_10010253 Ga0070701_100102532 202
172 3300025271 Ga0207666_1017999 Ga0207666_10179992 202
173 3300049590 Ga0501074_0134858 Ga0501074_0134858_1052_1687 202
174 3300005293 Ga0065715_10097585 Ga0065715_100975852 203
175 3300007076 Ga0075435_100096310 Ga0075435_1000963102 203
176 3300025924 Ga0207694_10608786 Ga0207694_106087862 203
177 3300035088 Ga0373940_0073249 Ga0373940_0073249_40_681 203
178 3300045049 Ga0466959_0195915 Ga0466959_0195915_360_980 203
179 3300045976 Ga0466967_0271806 Ga0466967_0271806_390_1010 203
180 3300050513 nmdc:mga0rr50_75639_c1 nmdc:mga0rr50_75639_c1_953_1594 203
181 3300050515 nmdc:mga0a205_63715_c1 nmdc:mga0a205_63715_c1_986_1627 203
182 3300032002 Ga0307416_100068319 Ga0307416_1000683192 204
183 3300032005 Ga0307411_10102883 Ga0307411_101028833 204
184 3300047472 Ga0495686_0212747 Ga0495686_0212747_197_811 204
185 3300049583 Ga0501067_0066226 Ga0501067_0066226_314_928 204
186 3300005295 Ga0065707_10114178 Ga0065707_101141781 205
187 3300005353 Ga0070669_100025522 Ga0070669_1000255223 205
188 3300005354 Ga0070675_100222314 Ga0070675_1002223142 205
189 3300005364 Ga0070673_100483559 Ga0070673_1004835592 205
190 3300005365 Ga0070688_100223070 Ga0070688_1002230701 205
191 3300005564 Ga0070664_100563693 Ga0070664_1005636932 205
192 3300005564 Ga0070664_100869639 Ga0070664_1008696392 205
193 3300005577 Ga0068857_100115181 Ga0068857_1001151812 205
194 3300005844 Ga0068862_100023828 Ga0068862_1000238283 205
195 3300006844 Ga0075428_100006187 Ga0075428_1000061875 205
196 3300006847 Ga0075431_100494938 Ga0075431_1004949382 205
197 3300006880 Ga0075429_100051387 Ga0075429_1000513872 205
198 3300006931 Ga0097620_100302895 Ga0097620_1003028952 205
199 3300009094 Ga0111539_10000512 Ga0111539_1000051247 205
200 3300009094 Ga0111539_10001914 Ga0111539_1000191422 205
201 3300009147 Ga0114129_10007864 Ga0114129_100078642 205
202 3300009553 Ga0105249_10028686 Ga0105249_100286864 205
203 3300014745 Ga0157377_10142010 Ga0157377_101420102 205
204 3300025901 Ga0207688_10094660 Ga0207688_100946602 205
205 3300025940 Ga0207691_10194892 Ga0207691_101948922 205
206 3300025960 Ga0207651_10349985 Ga0207651_103499851 205
207 3300025961 Ga0207712_10030890 Ga0207712_100308903 205
208 3300026116 Ga0207674_10142992 Ga0207674_101429922 205
209 3300027907 Ga0207428_10000658 Ga0207428_1000065817 205
210 3300027907 Ga0207428_10027003 Ga0207428_100270031 205
211 3300028380 Ga0268265_10016262 Ga0268265_100162625 205
212 3300031995 Ga0307409_100538395 Ga0307409_1005383952 205
213 3300042876 Ga0451577_0046462 Ga0451577_0046462_2370_3023 205
214 3300044712 Ga0453684_0016537 Ga0453684_0016537_5337_5990 205
215 3300048917 Ga0496114_0544986 Ga0496114_0544986_349_966 205
216 3300049572 Ga0501036_0026429 Ga0501036_0026429_1565_2212 205
217 3300049575 Ga0501039_0246502 Ga0501039_0246502_625_1272 205
218 3300049576 Ga0501040_0061552 Ga0501040_0061552_98_745 205
219 3300049577 Ga0501041_0021830 Ga0501041_0021830_1999_2646 205
220 3300049582 Ga0501048_0209678 Ga0501048_0209678_159_806 205
221 3300049587 Ga0501071_0126453 Ga0501071_0126453_313_960 205
222 3300049591 Ga0501075_0012805 Ga0501075_0012805_4709_5356 205
223 3300049741 Ga0501079_0247263 Ga0501079_0247263_317_964 205
224 3300049742 Ga0501080_0544191 Ga0501080_0544191_237_884 205
225 3300049824 Ga0501045_0045220 Ga0501045_0045220_68_715 205
226 3300050507 nmdc:mga05p37_859692_c1 nmdc:mga05p37_859692_c1_211_852 205
227 3300050510 nmdc:mga06r32_304935_c1 nmdc:mga06r32_304935_c1_843_1484 205
228 3300050510 nmdc:mga06r32_650732_c1 nmdc:mga06r32_650732_c1_71_700 205
229 3300050511 nmdc:mga08y16_10_c1 nmdc:mga08y16_10_c1_100450_101082 205
230 3300050511 nmdc:mga08y16_42111_c1 nmdc:mga08y16_42111_c1_4058_4699 205
231 3300060353 Ga0501082_0546192 Ga0501082_0546192_311_958 205
232 3300005290 Ga0065712_10112318 Ga0065712_101123182 206
233 3300005290 Ga0065712_10317043 Ga0065712_103170431 206
234 3300005293 Ga0065715_10283236 Ga0065715_102832362 206
235 3300005329 Ga0070683_100086185 Ga0070683_1000861852 206
236 3300005331 Ga0070670_100013699 Ga0070670_1000136997 206
237 3300005331 Ga0070670_100023819 Ga0070670_1000238192 206
238 3300005331 Ga0070670_100144660 Ga0070670_1001446602 206
239 3300005334 Ga0068869_100246271 Ga0068869_1002462711 206
240 3300005344 Ga0070661_100021350 Ga0070661_1000213502 206
241 3300005355 Ga0070671_100202840 Ga0070671_1002028402 206
242 3300005356 Ga0070674_100049731 Ga0070674_1000497312 206
243 3300005364 Ga0070673_100312650 Ga0070673_1003126501 206
244 3300005366 Ga0070659_100396721 Ga0070659_1003967212 206
245 3300005366 Ga0070659_101079130 Ga0070659_1010791301 206
246 3300005367 Ga0070667_100190076 Ga0070667_1001900761 206
247 3300005367 Ga0070667_100375559 Ga0070667_1003755592 206
248 3300005439 Ga0070711_100215273 Ga0070711_1002152732 206
249 3300005455 Ga0070663_100115274 Ga0070663_1001152742 206
250 3300005455 Ga0070663_100277849 Ga0070663_1002778492 206
251 3300005455 Ga0070663_100847532 Ga0070663_1008475321 206
252 3300005456 Ga0070678_100117354 Ga0070678_1001173542 206
253 3300005457 Ga0070662_100560632 Ga0070662_1005606322 206
254 3300005458 Ga0070681_10141241 Ga0070681_101412412 206
255 3300005458 Ga0070681_10160798 Ga0070681_101607982 206
256 3300005459 Ga0068867_100346688 Ga0068867_1003466882 206
257 3300005530 Ga0070679_100085984 Ga0070679_1000859842 206
258 3300005535 Ga0070684_100000213 Ga0070684_1000002132 206
259 3300005535 Ga0070684_100021090 Ga0070684_1000210902 206
260 3300005543 Ga0070672_100260643 Ga0070672_1002606431 206
261 3300005547 Ga0070693_100048812 Ga0070693_1000488123 206
262 3300005549 Ga0070704_100083332 Ga0070704_1000833323 206
263 3300005563 Ga0068855_100197821 Ga0068855_1001978212 206
264 3300005563 Ga0068855_100367469 Ga0068855_1003674692 206
265 3300005564 Ga0070664_100003485 Ga0070664_1000034859 206
266 3300005564 Ga0070664_100251768 Ga0070664_1002517682 206
267 3300005577 Ga0068857_100145826 Ga0068857_1001458262 206
268 3300005614 Ga0068856_100358811 Ga0068856_1003588112 206
269 3300005617 Ga0068859_100952348 Ga0068859_1009523482 206
270 3300005618 Ga0068864_100394559 Ga0068864_1003945592 206
271 3300005719 Ga0068861_100017062 Ga0068861_1000170624 206
272 3300005719 Ga0068861_101107645 Ga0068861_1011076451 206
273 3300005842 Ga0068858_100042644 Ga0068858_1000426442 206
274 3300005844 Ga0068862_100522120 Ga0068862_1005221201 206
275 3300006038 Ga0075365_10007126 Ga0075365_100071264 206
276 3300006038 Ga0075365_10047716 Ga0075365_100477164 206
277 3300006042 Ga0075368_10003124 Ga0075368_100031242 206
278 3300006051 Ga0075364_10011584 Ga0075364_100115844 206
279 3300006178 Ga0075367_10003066 Ga0075367_100030662 206
280 3300006178 Ga0075367_10442936 Ga0075367_104429361 206
281 3300006186 Ga0075369_10100541 Ga0075369_101005412 206
282 3300006195 Ga0075366_10007177 Ga0075366_100071773 206
283 3300006195 Ga0075366_10355114 Ga0075366_103551142 206
284 3300006353 Ga0075370_10033912 Ga0075370_100339122 206
285 3300006358 Ga0068871_100790291 Ga0068871_1007902912 206
286 3300006852 Ga0075433_10112240 Ga0075433_101122402 206
287 3300006871 Ga0075434_100001737 Ga0075434_1000017378 206
288 3300006871 Ga0075434_100196888 Ga0075434_1001968882 206
289 3300006871 Ga0075434_100328886 Ga0075434_1003288862 206
290 3300006871 Ga0075434_100413990 Ga0075434_1004139902 206
291 3300006881 Ga0068865_100245525 Ga0068865_1002455252 206
292 3300006881 Ga0068865_100297874 Ga0068865_1002978742 206
293 3300006931 Ga0097620_100952268 Ga0097620_1009522682 206
294 3300009093 Ga0105240_10278604 Ga0105240_102786042 206
295 3300009094 Ga0111539_10125663 Ga0111539_101256632 206
296 3300009094 Ga0111539_11734897 Ga0111539_117348971 206
297 3300009098 Ga0105245_11473898 Ga0105245_114738981 206
298 3300009147 Ga0114129_10048827 Ga0114129_100488272 206
299 3300009147 Ga0114129_10458172 Ga0114129_104581722 206
300 3300009176 Ga0105242_10332953 Ga0105242_103329532 206
301 3300009177 Ga0105248_10033622 Ga0105248_100336226 206
302 3300009177 Ga0105248_10210289 Ga0105248_102102892 206
303 3300009553 Ga0105249_10329213 Ga0105249_103292131 206
304 3300013296 Ga0157374_10216644 Ga0157374_102166443 206
305 3300014326 Ga0157380_10012408 Ga0157380_100124086 206
306 3300014969 Ga0157376_10535494 Ga0157376_105354941 206
307 3300025907 Ga0207645_10144081 Ga0207645_101440812 206
308 3300025912 Ga0207707_10035269 Ga0207707_100352692 206
309 3300025912 Ga0207707_10232195 Ga0207707_102321952 206
310 3300025913 Ga0207695_10107454 Ga0207695_101074542 206
311 3300025916 Ga0207663_10144579 Ga0207663_101445792 206
312 3300025917 Ga0207660_10671897 Ga0207660_106718972 206
313 3300025919 Ga0207657_10174048 Ga0207657_101740481 206
314 3300025920 Ga0207649_10005774 Ga0207649_100057747 206
315 3300025921 Ga0207652_10057453 Ga0207652_100574532 206
316 3300025923 Ga0207681_10124983 Ga0207681_101249831 206
317 3300025923 Ga0207681_10796462 Ga0207681_107964621 206
318 3300025925 Ga0207650_10002558 Ga0207650_100025584 206
319 3300025925 Ga0207650_10052308 Ga0207650_100523081 206
320 3300025925 Ga0207650_10055778 Ga0207650_100557781 206
321 3300025931 Ga0207644_10155998 Ga0207644_101559982 206
322 3300025932 Ga0207690_10267609 Ga0207690_102676092 206
323 3300025932 Ga0207690_10314693 Ga0207690_103146932 206
324 3300025933 Ga0207706_10358046 Ga0207706_103580461 206
325 3300025937 Ga0207669_10018356 Ga0207669_100183562 206
326 3300025944 Ga0207661_10001430 Ga0207661_100014308 206
327 3300025944 Ga0207661_10002652 Ga0207661_100026525 206
328 3300025945 Ga0207679_10006989 Ga0207679_100069895 206
329 3300025945 Ga0207679_10159812 Ga0207679_101598123 206
330 3300025945 Ga0207679_10217763 Ga0207679_102177632 206
331 3300025949 Ga0207667_10097614 Ga0207667_100976143 206
332 3300025949 Ga0207667_10648305 Ga0207667_106483052 206
333 3300025972 Ga0207668_10153312 Ga0207668_101533122 206
334 3300025981 Ga0207640_10226376 Ga0207640_102263762 206
335 3300026023 Ga0207677_10143333 Ga0207677_101433332 206
336 3300026035 Ga0207703_10154777 Ga0207703_101547772 206
337 3300026067 Ga0207678_10123974 Ga0207678_101239742 206
338 3300026075 Ga0207708_10075078 Ga0207708_100750782 206
339 3300026095 Ga0207676_10049985 Ga0207676_100499852 206
340 3300026116 Ga0207674_10149511 Ga0207674_101495111 206
341 3300026118 Ga0207675_100041107 Ga0207675_1000411073 206
342 3300026118 Ga0207675_100058891 Ga0207675_1000588914 206
343 3300026121 Ga0207683_10238190 Ga0207683_102381902 206
344 3300027665 Ga0209983_1016753 Ga0209983_10167532 206
345 3300027866 Ga0209813_10026655 Ga0209813_100266552 206
346 3300028380 Ga0268265_10262261 Ga0268265_102622611 206
347 3300031548 Ga0307408_100063720 Ga0307408_1000637202 206
348 3300031731 Ga0307405_10006363 Ga0307405_100063635 206
349 3300031852 Ga0307410_10007286 Ga0307410_100072862 206
350 3300031995 Ga0307409_100072275 Ga0307409_1000722753 206
351 3300032002 Ga0307416_100029325 Ga0307416_1000293252 206
352 3300032002 Ga0307416_101805867 Ga0307416_1018058671 206
353 3300032004 Ga0307414_10270413 Ga0307414_102704131 206
354 3300032005 Ga0307411_10129057 Ga0307411_101290573 206
355 3300032005 Ga0307411_10194446 Ga0307411_101944462 206
356 3300035116 Ga0373945_0093038 Ga0373945_0093038_281_916 206
357 3300035170 Ga0373943_0048756 Ga0373943_0048756_1042_1677 206
358 3300035172 Ga0373955_0442476 Ga0373955_0442476_20_646 206
359 3300035410 Ga0373924_0087018 Ga0373924_0087018_289_912 206
360 3300037471 Ga0395905_0282231 Ga0395905_0282231_746_1366 206
361 3300041512 Ga0451853_0228372 Ga0451853_0228372_320_940 206
362 3300041999 Ga0439433_0018173 Ga0439433_0018173_815_1438 206
363 3300042131 Ga0450894_012701 Ga0450894_012701_265_885 206
364 3300042876 Ga0451577_0541077 Ga0451577_0541077_305_925 206
365 3300044712 Ga0453684_0664494 Ga0453684_0664494_80_700 206
366 3300044842 Ga0466957_0500715 Ga0466957_0500715_15_635 206
367 3300045051 Ga0451576_0595731 Ga0451576_0595731_484_1125 206
368 3300045976 Ga0466967_0266701 Ga0466967_0266701_825_1445 206
369 3300046476 Ga0495662_0044246 Ga0495662_0044246_1388_2011 206
370 3300046517 Ga0495630_0221894 Ga0495630_0221894_558_1181 206
371 3300046559 Ga0495667_0217781 Ga0495667_0217781_490_1113 206
372 3300046678 Ga0495599_0354825 Ga0495599_0354825_96_719 206
373 3300046689 Ga0495613_0071535 Ga0495613_0071535_1071_1697 206
374 3300048905 Ga0496102_0934982 Ga0496102_0934982_13_654 206
375 3300048907 Ga0496104_0003311 Ga0496104_0003311_6489_7130 206
376 3300048911 Ga0496108_0012914 Ga0496108_0012914_3631_4272 206
377 3300048912 Ga0496109_0003151 Ga0496109_0003151_4333_4974 206
378 3300048913 Ga0496110_0009805 Ga0496110_0009805_7050_7691 206
379 3300048913 Ga0496110_0352288 Ga0496110_0352288_703_1329 206
380 3300048914 Ga0496111_0544357 Ga0496111_0544357_136_777 206
381 3300048915 Ga0496112_0000717 Ga0496112_0000717_5890_6531 206
382 3300048915 Ga0496112_0189779 Ga0496112_0189779_1183_1803 206
383 3300048916 Ga0496113_0239117 Ga0496113_0239117_279_899 206
384 3300049570 Ga0501033_0117061 Ga0501033_0117061_800_1447 206
385 3300049571 Ga0501034_0001614 Ga0501034_0001614_22700_23323 206
386 3300049572 Ga0501036_0052796 Ga0501036_0052796_1684_2307 206
387 3300049573 Ga0501037_0384706 Ga0501037_0384706_168_815 206
388 3300049575 Ga0501039_0082902 Ga0501039_0082902_938_1585 206
389 3300049575 Ga0501039_0180668 Ga0501039_0180668_806_1429 206
390 3300049577 Ga0501041_0151459 Ga0501041_0151459_813_1436 206
391 3300049579 Ga0501043_0273200 Ga0501043_0273200_359_982 206
392 3300049582 Ga0501048_0072673 Ga0501048_0072673_1560_2183 206
393 3300049582 Ga0501048_0073428 Ga0501048_0073428_1071_1718 206
394 3300049582 Ga0501048_0265045 Ga0501048_0265045_584_1207 206
395 3300049586 Ga0501070_0776280 Ga0501070_0776280_70_693 206
396 3300049587 Ga0501071_0023114 Ga0501071_0023114_152_799 206
397 3300049587 Ga0501071_0094123 Ga0501071_0094123_741_1364 206
398 3300049587 Ga0501071_0526630 Ga0501071_0526630_194_817 206
399 3300049588 Ga0501072_0013537 Ga0501072_0013537_5343_5966 206
400 3300049588 Ga0501072_0241238 Ga0501072_0241238_469_1116 206
401 3300049591 Ga0501075_0014199 Ga0501075_0014199_265_912 206
402 3300049592 Ga0501076_0014418 Ga0501076_0014418_2930_3553 206
403 3300049592 Ga0501076_0031805 Ga0501076_0031805_2459_3106 206
404 3300049592 Ga0501076_0804701 Ga0501076_0804701_126_761 206
405 3300049741 Ga0501079_0042170 Ga0501079_0042170_953_1600 206
406 3300049741 Ga0501079_0555324 Ga0501079_0555324_148_768 206
407 3300049742 Ga0501080_0187391 Ga0501080_0187391_1095_1718 206
408 3300049743 Ga0501081_0043093 Ga0501081_0043093_606_1229 206
409 3300049743 Ga0501081_0046116 Ga0501081_0046116_886_1509 206
410 3300049744 Ga0501083_0262280 Ga0501083_0262280_416_1039 206
411 3300049824 Ga0501045_0032970 Ga0501045_0032970_2267_2890 206
412 3300049824 Ga0501045_0205979 Ga0501045_0205979_111_758 206
413 3300049824 Ga0501045_0336321 Ga0501045_0336321_409_1053 206
414 3300049824 Ga0501045_0715289 Ga0501045_0715289_30_650 206
415 3300050489 nmdc:mga03683_20734_c1 nmdc:mga03683_20734_c1_129_752 206
416 3300050490 nmdc:mga03n38_164324_c1 nmdc:mga03n38_164324_c1_237_860 206
417 3300050491 nmdc:mga00v17_123973_c1 nmdc:mga00v17_123973_c1_349_972 206
418 3300050491 nmdc:mga00v17_26716_c1 nmdc:mga00v17_26716_c1_2731_3354 206
419 3300050491 nmdc:mga00v17_4710_c1 nmdc:mga00v17_4710_c1_4779_5402 206
420 3300050492 nmdc:mga0yw44_44397_c1 nmdc:mga0yw44_44397_c1_1252_1875 206
421 3300050492 nmdc:mga0yw44_5821_c1 nmdc:mga0yw44_5821_c1_2832_3452 206
422 3300050493 nmdc:mga0k408_411246_c1 nmdc:mga0k408_411246_c1_39_668 206
423 3300050493 nmdc:mga0k408_7994_c1 nmdc:mga0k408_7994_c1_2848_3471 206
424 3300050494 nmdc:mga06z11_2267_c1 nmdc:mga06z11_2267_c1_1866_2489 206
425 3300050494 nmdc:mga06z11_398448_c1 nmdc:mga06z11_398448_c1_127_756 206
426 3300050495 nmdc:mga04h51_22198_c1 nmdc:mga04h51_22198_c1_198_821 206
427 3300050496 nmdc:mga07m45_35200_c1 nmdc:mga07m45_35200_c1_1859_2482 206
428 3300050507 nmdc:mga05p37_2107_c3 nmdc:mga05p37_2107_c3_410_1057 206
429 3300050510 nmdc:mga06r32_333649_c1 nmdc:mga06r32_333649_c1_133_765 206
430 3300050511 nmdc:mga08y16_413944_c1 nmdc:mga08y16_413944_c1_531_1172 206
431 3300050511 nmdc:mga08y16_833873_c1 nmdc:mga08y16_833873_c1_85_726 206
432 3300050512 nmdc:mga0n895_10522_c1 nmdc:mga0n895_10522_c1_575_1195 206
433 3300050512 nmdc:mga0n895_230447_c1 nmdc:mga0n895_230447_c1_138_779 206
434 3300050512 nmdc:mga0n895_253976_c1 nmdc:mga0n895_253976_c1_96_737 206
435 3300050512 nmdc:mga0n895_305068_c1 nmdc:mga0n895_305068_c1_578_1201 206
436 3300050515 nmdc:mga0a205_121162_c1 nmdc:mga0a205_121162_c1_1097_1717 206
437 3300050515 nmdc:mga0a205_142168_c1 nmdc:mga0a205_142168_c1_1006_1650 206
438 3300050516 nmdc:mga0sz30_25710_c1 nmdc:mga0sz30_25710_c1_237_857 206
439 3300053085 Ga0495619_0366294 Ga0495619_0366294_14_640 206
440 3300054114 Ga0501084_0018536 Ga0501084_0018536_3657_4304 206
441 3300059421 Ga0590071_013115 Ga0590071_013115_854_1498 206
442 3300060353 Ga0501082_0134351 Ga0501082_0134351_575_1198 206
443 3300061734 Ga0530510_0049455 Ga0530510_0049455_966_1589 206
444 3300005290 Ga0065712_10002619 Ga0065712_100026192 207
445 3300005293 Ga0065715_10018429 Ga0065715_100184292 207
446 3300005293 Ga0065715_10154316 Ga0065715_101543162 207
447 3300005293 Ga0065715_10202184 Ga0065715_102021842 207
448 3300005295 Ga0065707_10002935 Ga0065707_100029354 207
449 3300005295 Ga0065707_10145516 Ga0065707_101455162 207
450 3300005328 Ga0070676_10028753 Ga0070676_100287533 207
451 3300005330 Ga0070690_100019138 Ga0070690_1000191382 207
452 3300005334 Ga0068869_100049354 Ga0068869_1000493544 207
453 3300005334 Ga0068869_100083017 Ga0068869_1000830172 207
454 3300005335 Ga0070666_10047510 Ga0070666_100475104 207
455 3300005337 Ga0070682_100443072 Ga0070682_1004430722 207
456 3300005338 Ga0068868_100062110 Ga0068868_1000621102 207
457 3300005340 Ga0070689_100039302 Ga0070689_1000393023 207
458 3300005343 Ga0070687_100123098 Ga0070687_1001230981 207
459 3300005345 Ga0070692_10029084 Ga0070692_100290844 207
460 3300005356 Ga0070674_100198478 Ga0070674_1001984781 207
461 3300005364 Ga0070673_100034852 Ga0070673_1000348522 207
462 3300005365 Ga0070688_100053447 Ga0070688_1000534471 207
463 3300005366 Ga0070659_100047831 Ga0070659_1000478313 207
464 3300005438 Ga0070701_10020810 Ga0070701_100208103 207
465 3300005441 Ga0070700_100043722 Ga0070700_1000437223 207
466 3300005457 Ga0070662_100023264 Ga0070662_1000232642 207
467 3300005459 Ga0068867_100034734 Ga0068867_1000347342 207
468 3300005467 Ga0070706_100304782 Ga0070706_1003047822 207
469 3300005544 Ga0070686_100030771 Ga0070686_1000307713 207
470 3300005545 Ga0070695_100458497 Ga0070695_1004584971 207
471 3300005547 Ga0070693_100018762 Ga0070693_1000187622 207
472 3300005549 Ga0070704_100019929 Ga0070704_1000199294 207
473 3300005578 Ga0068854_100072781 Ga0068854_1000727813 207
474 3300005615 Ga0070702_100020751 Ga0070702_1000207513 207
475 3300005616 Ga0068852_100027261 Ga0068852_1000272614 207
476 3300005617 Ga0068859_100105083 Ga0068859_1001050832 207
477 3300005618 Ga0068864_100235982 Ga0068864_1002359822 207
478 3300005718 Ga0068866_10096221 Ga0068866_100962212 207
479 3300005719 Ga0068861_100130224 Ga0068861_1001302242 207
480 3300005842 Ga0068858_100188574 Ga0068858_1001885742 207
481 3300006881 Ga0068865_100095685 Ga0068865_1000956851 207
482 3300006931 Ga0097620_100105077 Ga0097620_1001050774 207
483 3300007076 Ga0075435_100001458 Ga0075435_1000014589 207
484 3300009094 Ga0111539_10627154 Ga0111539_106271542 207
485 3300009094 Ga0111539_10805781 Ga0111539_108057812 207
486 3300009098 Ga0105245_10315143 Ga0105245_103151432 207
487 3300009148 Ga0105243_10009828 Ga0105243_100098287 207
488 3300009174 Ga0105241_10117423 Ga0105241_101174232 207
489 3300009176 Ga0105242_10177626 Ga0105242_101776262 207
490 3300009177 Ga0105248_10004840 Ga0105248_100048409 207
491 3300009551 Ga0105238_10755963 Ga0105238_107559631 207
492 3300010375 Ga0105239_10114307 Ga0105239_101143071 207
493 3300013297 Ga0157378_10257850 Ga0157378_102578502 207
494 3300025315 Ga0207697_10048968 Ga0207697_100489682 207
495 3300025885 Ga0207653_10012507 Ga0207653_100125073 207
496 3300025899 Ga0207642_10074523 Ga0207642_100745231 207
497 3300025903 Ga0207680_10072653 Ga0207680_100726531 207
498 3300025904 Ga0207647_10026527 Ga0207647_100265274 207
499 3300025907 Ga0207645_10004801 Ga0207645_100048012 207
500 3300025910 Ga0207684_10217008 Ga0207684_102170082 207
501 3300025911 Ga0207654_10062896 Ga0207654_100628962 207
502 3300025918 Ga0207662_10019837 Ga0207662_100198372 207
503 3300025931 Ga0207644_10068704 Ga0207644_100687043 207
504 3300025932 Ga0207690_10250313 Ga0207690_102503132 207
505 3300025933 Ga0207706_10025340 Ga0207706_100253402 207
506 3300025934 Ga0207686_10040858 Ga0207686_100408584 207
507 3300025935 Ga0207709_10041775 Ga0207709_100417751 207
508 3300025936 Ga0207670_10059839 Ga0207670_100598392 207
509 3300025938 Ga0207704_10069821 Ga0207704_100698212 207
510 3300025941 Ga0207711_10048716 Ga0207711_100487163 207
511 3300025942 Ga0207689_10083290 Ga0207689_100832901 207
512 3300025942 Ga0207689_10087572 Ga0207689_100875722 207
513 3300025960 Ga0207651_10038744 Ga0207651_100387444 207
514 3300026023 Ga0207677_10027982 Ga0207677_100279822 207
515 3300026035 Ga0207703_10184687 Ga0207703_101846873 207
516 3300026075 Ga0207708_10001820 Ga0207708_100018202 207
517 3300026088 Ga0207641_10210148 Ga0207641_102101483 207
518 3300026089 Ga0207648_10000959 Ga0207648_100009592 207
519 3300026118 Ga0207675_100021012 Ga0207675_1000210122 207
520 3300026142 Ga0207698_10414892 Ga0207698_104148922 207
521 3300028380 Ga0268265_10253192 Ga0268265_102531922 207
522 3300028381 Ga0268264_10189786 Ga0268264_101897863 207
523 3300031548 Ga0307408_101041518 Ga0307408_1010415181 207
524 3300034957 Ga0373938_0073997 Ga0373938_0073997_157_783 207
525 3300035114 Ga0373939_0028886 Ga0373939_0028886_836_1462 207
526 3300035121 Ga0373960_0030610 Ga0373960_0030610_671_1297 207
527 3300035207 Ga0373942_0006218 Ga0373942_0006218_163_789 207
528 3300048909 Ga0496106_0208517 Ga0496106_0208517_202_828 207
529 3300048912 Ga0496109_0570499 Ga0496109_0570499_86_712 207
530 3300048913 Ga0496110_0268287 Ga0496110_0268287_172_795 207
531 3300048915 Ga0496112_0636185 Ga0496112_0636185_345_968 207
532 3300049583 Ga0501067_0020356 Ga0501067_0020356_280_906 207
533 3300050511 nmdc:mga08y16_457924_c1 nmdc:mga08y16_457924_c1_544_1173 207
534 3300050511 nmdc:mga08y16_553286_c1 nmdc:mga08y16_553286_c1_315_938 207
535 3300053129 Ga0500628_029297 Ga0500628_029297_248_871 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04367

DUF502

Protein of unknown function (DUF502)

56

159

0.91

Feature Viewer

pLDDT pTM Quality
76.42 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map