F460656

General Info

Members Datasets Scaffolds Average Seq Length
535 268 1070 175

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10000483|Ga0157373_100004833
Length 197
Sequence MRAEIGDPEREPLLWAKSAPRRKLKGEMEVLLTEQEIAGRVEALAAEIAPRVDDETVAVCLLTGGIWFTADLTRALGRLGRNLRFDALWLSSYKDDRASSGRCQVRADLQRPLSGRKALIVDDVFDTGLSLSEAARLVRDAGASEVLTAVFARKPWPSARAIEPDFVAWEAPARFLVGYGMDSAGAMRGLPYIGALD

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
115 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
220 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
221 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
222 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
223 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
224 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
225 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
226 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
227 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
228 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
229 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
230 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
231 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
232 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
233 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
234 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
235 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
242 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
243 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
244 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
245 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
246 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
247 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
248 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
249 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
250 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
251 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
254 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
255 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
256 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
257 2643221640 Caulobacter sp. Root342 Isolate Unclassified
258 2643221642 Caulobacter sp. Root343 Isolate Unclassified
259 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
260 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
261 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
262 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
263 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
264 2849560528 Caulobacter zeae 410 Isolate Unclassified
265 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
266 2851153111 Caulobacter radicis 736 Isolate Unclassified
267 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
268 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.01
Metatranscriptomes 0
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.37
Nodule 0.37
Rhizoplane 3.74
Rhizosphere 67.66
Stem 0
Stem Tuber 0
Unclassified 1.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10000483 3300013100 Bacteria 31535
2 JGI25153J46596_10082870 3300003215 Bacteria 794
3 rootH1_10010331 3300003316 Bacteria 2703
4 rootL2_10104603 3300003322 Bacteria 2007
5 Ga0055536_1000271 3300003781 Bacteria 39460
6 Ga0055536_1000307 3300003781 Bacteria 36826
7 Ga0055530_10000026 3300003791 Bacteria 129960
8 Ga0055530_10016026 3300003791 Bacteria 2415
9 Ga0055540_1034941 3300003792 Bacteria 1127
10 Ga0055531_10000899 3300003794 Bacteria 24257
11 Ga0055531_10001385 3300003794 Bacteria 17985
12 Ga0055531_10002897 3300003794 Bacteria 11172
13 Ga0055531_10036234 3300003794 Bacteria 1526
14 Ga0055531_10045156 3300003794 Bacteria 1226
15 Ga0065165_1001058 3300005262 Bacteria 32976
16 Ga0070670_100019351 3300005331 Bacteria 5841
17 Ga0070670_101095779 3300005331 Bacteria 726
18 Ga0070666_10004481 3300005335 Bacteria 8511
19 Ga0070666_10316287 3300005335 Bacteria 1113
20 Ga0070680_100090930 3300005336 Unclassified 2526
21 Ga0070680_100116049 3300005336 Bacteria 2231
22 Ga0070660_100025252 3300005339 Bacteria 4415
23 Ga0070660_100038099 3300005339 Bacteria 3647
24 Ga0070691_10148878 3300005341 Bacteria 1198
25 Ga0070668_100000733 3300005347 Bacteria 22420
26 Ga0070668_100001360 3300005347 Bacteria 17507
27 Ga0070668_100003875 3300005347 Bacteria 11044
28 Ga0070668_100022966 3300005347 Bacteria 4716
29 Ga0070668_100052603 3300005347 Bacteria 3139
30 Ga0070669_100014242 3300005353 Bacteria 5658
31 Ga0070669_100339889 3300005353 Bacteria 1216
32 Ga0070669_101093842 3300005353 Bacteria 686
33 Ga0070671_100001866 3300005355 Bacteria 16097
34 Ga0070671_100115923 3300005355 Bacteria 2252
35 Ga0070671_100430173 3300005355 Bacteria 1131
36 Ga0070671_100462822 3300005355 Unclassified 1088
37 Ga0070659_100000143 3300005366 Bacteria 55183
38 Ga0070659_100005171 3300005366 Bacteria 9360
39 Ga0070659_100033290 3300005366 Bacteria 4002
40 Ga0070667_100000146 3300005367 Bacteria 88847
41 Ga0070667_100007034 3300005367 Bacteria 9355
42 Ga0070667_100008886 3300005367 Bacteria 8316
43 Ga0070667_100020951 3300005367 Bacteria 5430
44 Ga0070663_100416060 3300005455 Bacteria 1102
45 Ga0070681_10019225 3300005458 Bacteria 6836
46 Ga0070681_10056881 3300005458 Bacteria 3892
47 Ga0070681_10371719 3300005458 Bacteria 1340
48 Ga0070685_10011937 3300005466 Bacteria 4555
49 Ga0070679_100142727 3300005530 Bacteria 2373
50 Ga0070679_100243060 3300005530 Bacteria 1757
51 Ga0068853_100010326 3300005539 Bacteria 7552
52 Ga0068853_100178453 3300005539 Bacteria 1925
53 Ga0070665_100000144 3300005548 Bacteria 132302
54 Ga0070665_100001180 3300005548 Bacteria 31967
55 Ga0070665_100002958 3300005548 Bacteria 18347
56 Ga0070665_100020082 3300005548 Bacteria 6707
57 Ga0068855_100035613 3300005563 Bacteria 5929
58 Ga0068855_100044018 3300005563 Bacteria 5285
59 Ga0068855_100094249 3300005563 Bacteria 3452
60 Ga0070664_100034800 3300005564 Bacteria 4227
61 Ga0070664_100491603 3300005564 Bacteria 1130
62 Ga0070664_100578948 3300005564 Bacteria 1040
63 Ga0068857_100719809 3300005577 Bacteria 949
64 Ga0068854_100634187 3300005578 Bacteria 916
65 Ga0068856_100532527 3300005614 Bacteria 1196
66 Ga0068856_100836017 3300005614 Bacteria 940
67 Ga0068856_100928254 3300005614 Bacteria 889
68 Ga0068852_101047648 3300005616 Unclassified 835
69 Ga0068859_100000437 3300005617 Bacteria 41851
70 Ga0068859_100006364 3300005617 Bacteria 11977
71 Ga0068859_100374165 3300005617 Bacteria 1520
72 Ga0068859_100604081 3300005617 Bacteria 1190
73 Ga0068864_100000313 3300005618 Bacteria 42907
74 Ga0068864_100000503 3300005618 Bacteria 33698
75 Ga0068864_100054401 3300005618 Bacteria 3454
76 Ga0068864_100078305 3300005618 Bacteria 2893
77 Ga0068864_100117042 3300005618 Bacteria 2379
78 Ga0068864_100824166 3300005618 Bacteria 913
79 Ga0068864_101287707 3300005618 Bacteria 731
80 Ga0068861_100271154 3300005719 Bacteria 1457
81 Ga0068863_100000158 3300005841 Bacteria 71918
82 Ga0068863_100000253 3300005841 Bacteria 56367
83 Ga0068863_100002531 3300005841 Bacteria 18136
84 Ga0068863_100018754 3300005841 Bacteria 6620
85 Ga0068863_100023756 3300005841 Bacteria 5848
86 Ga0068863_100093271 3300005841 Bacteria 2857
87 Ga0068863_100288099 3300005841 Bacteria 1592
88 Ga0068858_100000746 3300005842 Bacteria 34090
89 Ga0068858_100003737 3300005842 Bacteria 15059
90 Ga0068858_100028444 3300005842 Bacteria 5192
91 Ga0068858_100277338 3300005842 Bacteria 1596
92 Ga0068860_100000234 3300005843 Bacteria 85182
93 Ga0068860_100000308 3300005843 Bacteria 67784
94 Ga0068860_100005340 3300005843 Bacteria 13040
95 Ga0068860_100032620 3300005843 Bacteria 5003
96 Ga0068860_101566425 3300005843 Bacteria 681
97 Ga0068862_100000129 3300005844 Bacteria 88141
98 Ga0068862_100003825 3300005844 Bacteria 12817
99 Ga0068862_100209629 3300005844 Bacteria 1760
100 Ga0070717_11186826 3300006028 Bacteria 695
101 Ga0075365_10412176 3300006038 Bacteria 954
102 Ga0075363_100063502 3300006048 Bacteria 1993
103 Ga0075364_10000411 3300006051 Bacteria 21397
104 Ga0075367_10037498 3300006178 Bacteria 2817
105 Ga0075369_10013650 3300006186 Bacteria 3231
106 Ga0075369_10050924 3300006186 Bacteria 1792
107 Ga0075366_10146406 3300006195 Bacteria 1429
108 Ga0097621_100951954 3300006237 Bacteria 802
109 Ga0075370_10058310 3300006353 Bacteria 2195
110 Ga0075370_10397428 3300006353 Bacteria 827
111 Ga0068871_100722356 3300006358 Bacteria 914
112 Ga0068865_100034685 3300006881 Bacteria 3387
113 Ga0097620_100000437 3300006931 Bacteria 41851
114 Ga0097620_100006364 3300006931 Bacteria 11977
115 Ga0097620_100374163 3300006931 Bacteria 1520
116 Ga0097620_100604029 3300006931 Bacteria 1190
117 Ga0079104_1015810 3300006946 Bacteria 2225
118 Ga0105240_10022612 3300009093 Bacteria 8328
119 Ga0105240_10071568 3300009093 Bacteria 4288
120 Ga0105240_10102063 3300009093 Bacteria 3487
121 Ga0105240_11564385 3300009093 Unclassified 690
122 Ga0105247_10258579 3300009101 Bacteria 1193
123 Ga0105248_10000489 3300009177 Bacteria 45002
124 Ga0105248_10011458 3300009177 Bacteria 9771
125 Ga0105248_10036925 3300009177 Bacteria 5464
126 Ga0105248_10046013 3300009177 Bacteria 4892
127 Ga0105248_10065826 3300009177 Bacteria 4069
128 Ga0105248_10368099 3300009177 Bacteria 1618
129 Ga0105237_10346428 3300009545 Bacteria 1490
130 Ga0105238_10033188 3300009551 Bacteria 5253
131 Ga0105238_10039857 3300009551 Bacteria 4762
132 Ga0105238_10248466 3300009551 Bacteria 1757
133 Ga0105238_10290071 3300009551 Bacteria 1618
134 Ga0105238_10887696 3300009551 Bacteria 909
135 Ga0105238_11545175 3300009551 Bacteria 693
136 Ga0105249_10009776 3300009553 Bacteria 8402
137 Ga0105249_10102394 3300009553 Bacteria 2695
138 Ga0105249_10157395 3300009553 Bacteria 2192
139 Ga0105249_10674899 3300009553 Bacteria 1092
140 Ga0105239_10070776 3300010375 Bacteria 3832
141 Ga0105239_10436328 3300010375 Bacteria 1485
142 Ga0105239_10474680 3300010375 Bacteria 1420
143 Ga0157373_10000482 3300013100 Bacteria 31638
144 Ga0157370_10249794 3300013104 Bacteria 1641
145 Ga0157369_10499209 3300013105 Bacteria 1259
146 Ga0157374_10234511 3300013296 Bacteria 1803
147 Ga0163162_10240161 3300013306 Bacteria 1943
148 Ga0163162_10267262 3300013306 Bacteria 1842
149 Ga0157372_10477738 3300013307 Bacteria 1453
150 Ga0157375_10036236 3300013308 Bacteria 4717
151 Ga0163163_10026201 3300014325 Bacteria 5569
152 Ga0163163_10071631 3300014325 Bacteria 3454
153 Ga0163163_10156347 3300014325 Bacteria 2324
154 Ga0163163_10188185 3300014325 Bacteria 2112
155 Ga0163163_10277552 3300014325 Bacteria 1727
156 Ga0163163_10534393 3300014325 Bacteria 1235
157 Ga0157380_10182384 3300014326 Bacteria 1845
158 Ga0157377_10312658 3300014745 Bacteria 1041
159 Ga0157379_10000967 3300014968 Bacteria 23322
160 Ga0157379_10068713 3300014968 Bacteria 3167
161 Ga0157379_10101168 3300014968 Bacteria 2587
162 Ga0213876_10101676 3300021384 Bacteria 1524
163 Ga0213875_10191657 3300021388 Bacteria 961
164 Ga0209026_1032207 3300025250 Bacteria 775
165 Ga0209026_1040267 3300025250 Bacteria 678
166 Ga0209148_1004982 3300025254 Bacteria 3129
167 Ga0209676_1000224 3300025292 Bacteria 124160
168 Ga0209676_1000422 3300025292 Bacteria 74541
169 Ga0209758_1002891 3300025297 Bacteria 16602
170 Ga0209050_1000029 3300025298 Bacteria 465801
171 Ga0209050_1000463 3300025298 Bacteria 72380
172 Ga0209050_1001193 3300025298 Bacteria 30547
173 Ga0209050_1001204 3300025298 Bacteria 30367
174 Ga0209256_1010255 3300025299 Bacteria 3953
175 Ga0209051_1008867 3300025303 Bacteria 5262
176 Ga0209257_1000152 3300025304 Bacteria 189432
177 Ga0209257_1000512 3300025304 Bacteria 67436
178 Ga0209257_1001271 3300025304 Bacteria 30931
179 Ga0209257_1026554 3300025304 Bacteria 1948
180 Ga0207710_10133530 3300025900 Bacteria 1193
181 Ga0207680_10003990 3300025903 Bacteria 6971
182 Ga0207680_10072151 3300025903 Bacteria 2143
183 Ga0207680_10104166 3300025903 Bacteria 1828
184 Ga0207705_10010119 3300025909 Bacteria 6866
185 Ga0207705_10134293 3300025909 Bacteria 1844
186 Ga0207654_10026762 3300025911 Bacteria 3127
187 Ga0207707_10021262 3300025912 Bacteria 5671
188 Ga0207707_10197451 3300025912 Bacteria 1754
189 Ga0207695_10001763 3300025913 Bacteria 34269
190 Ga0207695_10005400 3300025913 Bacteria 16971
191 Ga0207695_10010025 3300025913 Bacteria 11633
192 Ga0207695_10091696 3300025913 Bacteria 3051
193 Ga0207695_10448088 3300025913 Bacteria 1174
194 Ga0207695_10453311 3300025913 Bacteria 1166
195 Ga0207695_11059629 3300025913 Unclassified 690
196 Ga0207660_10065045 3300025917 Bacteria 2634
197 Ga0207660_10077752 3300025917 Bacteria 2430
198 Ga0207657_10010954 3300025919 Bacteria 9018
199 Ga0207657_10048620 3300025919 Bacteria 3702
200 Ga0207657_10584929 3300025919 Bacteria 872
201 Ga0207649_10895664 3300025920 Unclassified 695
202 Ga0207652_10049193 3300025921 Bacteria 3608
203 Ga0207681_10019464 3300025923 Bacteria 4288
204 Ga0207681_10317829 3300025923 Bacteria 1237
205 Ga0207681_10961036 3300025923 Bacteria 716
206 Ga0207694_10013384 3300025924 Bacteria 6179
207 Ga0207694_10037272 3300025924 Bacteria 3734
208 Ga0207694_10131137 3300025924 Bacteria 2009
209 Ga0207694_10173450 3300025924 Bacteria 1747
210 Ga0207694_10196787 3300025924 Bacteria 1639
211 Ga0207694_10781388 3300025924 Bacteria 806
212 Ga0207694_10895722 3300025924 Bacteria 750
213 Ga0207650_10000064 3300025925 Bacteria 142969
214 Ga0207650_10011859 3300025925 Bacteria 6005
215 Ga0207650_10012174 3300025925 Bacteria 5931
216 Ga0207650_10432680 3300025925 Bacteria 1093
217 Ga0207650_10603840 3300025925 Bacteria 923
218 Ga0207687_10109059 3300025927 Bacteria 2050
219 Ga0207644_10001126 3300025931 Bacteria 17127
220 Ga0207644_10044081 3300025931 Bacteria 3168
221 Ga0207644_10047989 3300025931 Bacteria 3050
222 Ga0207644_10904597 3300025931 Bacteria 740
223 Ga0207644_10921842 3300025931 Bacteria 732
224 Ga0207690_10010748 3300025932 Bacteria 5455
225 Ga0207690_10060693 3300025932 Bacteria 2568
226 Ga0207690_10120154 3300025932 Bacteria 1907
227 Ga0207706_10502381 3300025933 Unclassified 1047
228 Ga0207704_10002245 3300025938 Bacteria 8672
229 Ga0207704_11061664 3300025938 Bacteria 687
230 Ga0207711_10001700 3300025941 Bacteria 20250
231 Ga0207711_10002832 3300025941 Bacteria 15237
232 Ga0207711_10004706 3300025941 Bacteria 11596
233 Ga0207711_10035666 3300025941 Bacteria 4218
234 Ga0207711_10047787 3300025941 Bacteria 3660
235 Ga0207711_10548793 3300025941 Bacteria 1078
236 Ga0207679_10001519 3300025945 Bacteria 14513
237 Ga0207679_10526318 3300025945 Bacteria 1058
238 Ga0207667_10021083 3300025949 Bacteria 7227
239 Ga0207667_10024032 3300025949 Bacteria 6701
240 Ga0207667_10024243 3300025949 Bacteria 6665
241 Ga0207667_10048194 3300025949 Bacteria 4506
242 Ga0207667_10112218 3300025949 Bacteria 2811
243 Ga0207667_10265930 3300025949 Bacteria 1753
244 Ga0207667_10789991 3300025949 Bacteria 947
245 Ga0207651_10035437 3300025960 Bacteria 3245
246 Ga0207712_10002582 3300025961 Bacteria 11640
247 Ga0207712_10123258 3300025961 Bacteria 1964
248 Ga0207668_10000154 3300025972 Bacteria 47517
249 Ga0207668_10000379 3300025972 Bacteria 28234
250 Ga0207668_10024993 3300025972 Bacteria 3860
251 Ga0207668_10067921 3300025972 Bacteria 2532
252 Ga0207668_10306512 3300025972 Bacteria 1312
253 Ga0207640_10533573 3300025981 Bacteria 983
254 Ga0207640_10533705 3300025981 Bacteria 983
255 Ga0207658_10001071 3300025986 Bacteria 22181
256 Ga0207658_10002901 3300025986 Bacteria 12291
257 Ga0207658_10009216 3300025986 Bacteria 6692
258 Ga0207658_10559439 3300025986 Bacteria 1024
259 Ga0207703_10000598 3300026035 Bacteria 36651
260 Ga0207703_10008480 3300026035 Bacteria 8122
261 Ga0207703_10022519 3300026035 Bacteria 4943
262 Ga0207703_10040750 3300026035 Bacteria 3719
263 Ga0207703_10363726 3300026035 Bacteria 1335
264 Ga0207639_10007364 3300026041 Bacteria 7503
265 Ga0207639_10107998 3300026041 Bacteria 2262
266 Ga0207639_10535913 3300026041 Bacteria 1073
267 Ga0207639_11029634 3300026041 Unclassified 771
268 Ga0207678_10414111 3300026067 Bacteria 1168
269 Ga0207702_10438312 3300026078 Bacteria 1266
270 Ga0207702_10656129 3300026078 Bacteria 1032
271 Ga0207641_10000634 3300026088 Bacteria 38355
272 Ga0207641_10000687 3300026088 Bacteria 36473
273 Ga0207641_10013816 3300026088 Bacteria 6622
274 Ga0207641_10031521 3300026088 Bacteria 4397
275 Ga0207641_10089677 3300026088 Bacteria 2688
276 Ga0207641_10411472 3300026088 Bacteria 1300
277 Ga0207676_10000131 3300026095 Bacteria 66092
278 Ga0207676_10001356 3300026095 Bacteria 18203
279 Ga0207676_10016556 3300026095 Bacteria 5339
280 Ga0207676_10317426 3300026095 Bacteria 1429
281 Ga0207675_100250571 3300026118 Bacteria 1714
282 Ga0207683_10519105 3300026121 Bacteria 1101
283 Ga0207698_11315540 3300026142 Bacteria 737
284 Ga0209281_1020179 3300027111 Bacteria 1306
285 Ga0209999_1005526 3300027543 Bacteria 2273
286 Ga0209983_1006282 3300027665 Bacteria 2447
287 Ga0209813_10021188 3300027866 Bacteria 1825
288 Ga0268266_10000003 3300028379 Bacteria 1701703
289 Ga0268266_10000812 3300028379 Bacteria 41107
290 Ga0268266_10010701 3300028379 Bacteria 7993
291 Ga0268266_10021721 3300028379 Bacteria 5470
292 Ga0268265_10005471 3300028380 Bacteria 8675
293 Ga0268265_10007810 3300028380 Bacteria 7219
294 Ga0268265_10010074 3300028380 Bacteria 6380
295 Ga0268265_10019747 3300028380 Bacteria 4691
296 Ga0268264_10000008 3300028381 Bacteria 773387
297 Ga0268264_10000360 3300028381 Bacteria 67798
298 Ga0268264_10009444 3300028381 Bacteria 8078
299 Ga0268264_10027358 3300028381 Bacteria 4658
300 Ga0268264_11115257 3300028381 Bacteria 798
301 Ga0307517_10001670 3300028786 Bacteria 36710
302 Ga0307517_10319785 3300028786 Bacteria 859
303 Ga0307515_10080529 3300028794 Bacteria 4245
304 Ga0307511_10081846 3300030521 Bacteria 2262
305 Ga0265320_10040362 3300031240 Bacteria 2328
306 Ga0265327_10001234 3300031251 Bacteria 34331
307 Ga0265327_10001963 3300031251 Bacteria 23543
308 Ga0307513_10002302 3300031456 Bacteria 26655
309 Ga0307513_10004456 3300031456 Bacteria 18698
310 Ga0307513_10008813 3300031456 Bacteria 12845
311 Ga0307513_10013285 3300031456 Bacteria 10111
312 Ga0307408_100326063 3300031548 Bacteria 1295
313 Ga0307408_100524683 3300031548 Bacteria 1041
314 Ga0307508_10186371 3300031616 Bacteria 1677
315 Ga0307516_10000002 3300031730 Bacteria 467851
316 Ga0307405_11196128 3300031731 Bacteria 657
317 Ga0307412_11129131 3300031911 Bacteria 699
318 Ga0307409_101297984 3300031995 Bacteria 753
319 Ga0307510_10024786 3300033180 Bacteria 6927
320 Ga0307510_10099020 3300033180 Bacteria 2716
321 Ga0307510_10293312 3300033180 Bacteria 1091
322 Ga0373944_0018453 3300035089 Bacteria 1992
323 Ga0373936_0000516 3300035113 Bacteria 13169
324 Ga0373935_0009585 3300035692 Bacteria 5797
325 Ga0373927_0000155 3300035695 Bacteria 53529
326 Ga0373925_0000032 3300037068 Bacteria 145357
327 Ga0395899_0000018 3300037312 Bacteria 423194
328 Ga0395899_0455146 3300037312 Bacteria 837
329 Ga0395900_0297431 3300037418 Bacteria 1601
330 Ga0395898_0167800 3300037466 Bacteria 2098
331 Ga0395898_0181550 3300037466 Bacteria 2011
332 Ga0395905_0039392 3300037471 Bacteria 4434
333 Ga0395905_0114341 3300037471 Bacteria 2536
334 Ga0395905_0191014 3300037471 Bacteria 1921
335 Ga0395905_0511372 3300037471 Bacteria 1101
336 Ga0395905_0534517 3300037471 Bacteria 1073
337 Ga0395905_0947091 3300037471 Bacteria 764
338 Ga0436364_0492243 3300037853 Bacteria 4293
339 Ga0395901_0479689 3300038443 Bacteria 1268
340 Ga0395901_0917891 3300038443 Bacteria 856
341 Ga0436365_1003114 3300039437 Bacteria 3933
342 Ga0436365_1903966 3300039437 Bacteria 1583
343 Ga0436360_0825270 3300039438 Bacteria 1137
344 Ga0451849_1285073 3300041505 Bacteria 709
345 Ga0466969_0098025 3300044656 Bacteria 1382
346 Ga0466965_0186397 3300044683 Bacteria 1096
347 Ga0466966_0048377 3300044684 Bacteria 2709
348 Ga0453684_0284929 3300044712 Bacteria 1883
349 Ga0466967_1004503 3300045976 Bacteria 831
350 Ga0495638_0000387 3300046460 Bacteria 54475
351 Ga0495650_0053984 3300046471 Bacteria 1642
352 Ga0495639_0087693 3300046475 Bacteria 1457
353 Ga0495585_0073113 3300046492 Bacteria 1867
354 Ga0495585_0346020 3300046492 Bacteria 723
355 Ga0495606_0084795 3300046507 Bacteria 1961
356 Ga0495606_0387029 3300046507 Bacteria 732
357 Ga0495610_0008207 3300046512 Bacteria 6803
358 Ga0495628_0567309 3300046516 Bacteria 813
359 Ga0495631_0024702 3300046518 Bacteria 2773
360 Ga0495637_0053805 3300046520 Bacteria 1674
361 Ga0495643_0037753 3300046522 Bacteria 2647
362 Ga0495648_0000130 3300046524 Bacteria 88368
363 Ga0495642_0008312 3300046528 Bacteria 3970
364 Ga0495642_0050744 3300046528 Bacteria 1706
365 Ga0495642_0058164 3300046528 Bacteria 1600
366 Ga0495642_0146935 3300046528 Bacteria 1019
367 Ga0495654_0058620 3300046530 Bacteria 1857
368 Ga0495665_0118504 3300046531 Bacteria 1387
369 Ga0495609_0029574 3300046538 Bacteria 2494
370 Ga0495597_0011104 3300046542 Bacteria 4374
371 Ga0495645_0182157 3300046543 Bacteria 1438
372 Ga0495622_0001260 3300046557 Bacteria 12983
373 Ga0495633_0385759 3300046558 Bacteria 634
374 Ga0495668_0000060 3300046616 Bacteria 193823
375 Ga0495668_0006917 3300046616 Bacteria 7340
376 Ga0495668_0009979 3300046616 Bacteria 5784
377 Ga0495668_0057638 3300046616 Bacteria 2144
378 Ga0495668_0058492 3300046616 Bacteria 2127
379 Ga0495668_0118677 3300046616 Bacteria 1446
380 Ga0495668_0121672 3300046616 Bacteria 1428
381 Ga0495668_0519649 3300046616 Bacteria 656
382 Ga0495611_0052845 3300046648 Bacteria 1833
383 Ga0495625_0115670 3300046660 Bacteria 1830
384 Ga0495625_0277026 3300046660 Bacteria 1080
385 Ga0495625_0284918 3300046660 Bacteria 1062
386 Ga0495669_0000020 3300046684 Bacteria 122868
387 Ga0495669_0000449 3300046684 Bacteria 19393
388 Ga0495669_0365580 3300046684 Bacteria 698
389 Ga0495581_0259614 3300047315 Bacteria 1016
390 Ga0495636_0022590 3300047318 Bacteria 2544
391 Ga0495672_0094555 3300047320 Bacteria 1634
392 Ga0495672_0178016 3300047320 Bacteria 1079
393 Ga0495677_0101930 3300047445 Bacteria 1087
394 Ga0495673_0000397 3300047469 Bacteria 50855
395 Ga0495686_0003413 3300047472 Bacteria 13818
396 Ga0495686_0006846 3300047472 Bacteria 8637
397 Ga0495686_0022922 3300047472 Bacteria 4125
398 Ga0495686_0027185 3300047472 Bacteria 3737
399 Ga0495593_0048021 3300047673 Bacteria 2269
400 Ga0495602_1030366 3300048088 Bacteria 542
401 Ga0496101_0677998 3300048904 Bacteria 814
402 Ga0496101_0755736 3300048904 Bacteria 767
403 Ga0496102_0127445 3300048905 Bacteria 2380
404 Ga0496102_0736931 3300048905 Bacteria 908
405 Ga0496104_0300365 3300048907 Bacteria 1518
406 Ga0496105_0416605 3300048908 Bacteria 1064
407 Ga0496106_0194821 3300048909 Bacteria 1612
408 Ga0496107_0202677 3300048910 Bacteria 1475
409 Ga0496108_0457796 3300048911 Bacteria 1114
410 Ga0496109_0008454 3300048912 Bacteria 8751
411 Ga0496110_0063516 3300048913 Bacteria 3263
412 Ga0496111_0356062 3300048914 Bacteria 1083
413 Ga0496112_0096047 3300048915 Bacteria 2934
414 Ga0496112_0404157 3300048915 Bacteria 1305
415 Ga0496112_0566275 3300048915 Bacteria 1069
416 Ga0496113_0129757 3300048916 Bacteria 1977
417 Ga0496115_0001272 3300048918 Bacteria 18065
418 Ga0496115_0001892 3300048918 Bacteria 14984
419 Ga0496115_0049114 3300048918 Bacteria 3376
420 Ga0496115_0112706 3300048918 Bacteria 2235
421 Ga0496116_0145196 3300048919 Bacteria 1327
422 Ga0496118_0006963 3300048921 Bacteria 12207
423 Ga0496119_0024095 3300048922 Bacteria 4293
424 Ga0496121_0000059 3300048924 Bacteria 278177
425 Ga0496121_0459648 3300048924 Bacteria 818
426 Ga0496124_0031509 3300048927 Bacteria 4693
427 Ga0496125_0054108 3300048928 Bacteria 3283
428 Ga0496126_0002857 3300048929 Bacteria 22576
429 Ga0495678_010667 3300049459 Bacteria 4448
430 Ga0501032_0123187 3300049569 Bacteria 1713
431 Ga0501034_0111449 3300049571 Bacteria 2727
432 Ga0501038_0669470 3300049574 Bacteria 780
433 Ga0501038_1099885 3300049574 Bacteria 580
434 Ga0501041_0420412 3300049577 Bacteria 848
435 Ga0501043_0649516 3300049579 Bacteria 775
436 Ga0501043_0829225 3300049579 Bacteria 667
437 Ga0501047_0011838 3300049581 Bacteria 8250
438 Ga0501047_0110346 3300049581 Bacteria 2634
439 Ga0501047_1123564 3300049581 Bacteria 599
440 Ga0501073_0417036 3300049589 Bacteria 928
441 Ga0501035_0222185 3300049822 Bacteria 1612
442 Ga0501035_0290560 3300049822 Bacteria 1380
443 Ga0501035_1064125 3300049822 Bacteria 633
444 Ga0501044_0007104 3300049823 Bacteria 12322
445 Ga0501044_0406252 3300049823 Bacteria 1274
446 nmdc:mga00v17_528_c1 3300050491 Bacteria 21420
447 nmdc:mga0k408_153012_c1 3300050493 Bacteria 1374
448 nmdc:mga0k408_172319_c1 3300050493 Bacteria 816
449 nmdc:mga0k408_40701_c1 3300050493 Bacteria 2675
450 nmdc:mga04h51_94948_c1 3300050495 Bacteria 1079
451 nmdc:mga07m45_23460_c1 3300050496 Bacteria 3374
452 nmdc:mga07m45_326376_c1 3300050496 Bacteria 892
453 nmdc:mga07m45_365970_c1 3300050496 Bacteria 838
454 nmdc:mga07m45_7027_c1 3300050496 Bacteria 5728
455 nmdc:mga0sz30_14908_c1 3300050516 Bacteria 3066
456 nmdc:mga0sz30_40080_c1 3300050516 Bacteria 1968
457 Ga0500635_0000231 3300053080 Bacteria 24724
458 Ga0500578_0000377 3300053086 Bacteria 54788
459 Ga0500578_0308811 3300053086 Bacteria 936
460 Ga0500643_001547 3300053087 Bacteria 13032
461 Ga0500643_005330 3300053087 Bacteria 5561
462 Ga0500643_008562 3300053087 Bacteria 4011
463 Ga0500643_041617 3300053087 Bacteria 1348
464 Ga0500644_0000037 3300053088 Bacteria 80217
465 Ga0500647_0102980 3300053091 Bacteria 1362
466 Ga0500566_0012647 3300053094 Bacteria 4966
467 Ga0500641_0005016 3300053096 Bacteria 4694
468 Ga0500641_0033204 3300053096 Bacteria 2047
469 Ga0500556_0001589 3300053104 Bacteria 9084
470 Ga0500556_0018139 3300053104 Bacteria 2216
471 Ga0500556_0076320 3300053104 Bacteria 1260
472 Ga0500562_002621 3300053108 Bacteria 4476
473 Ga0500562_006226 3300053108 Bacteria 3011
474 Ga0500562_007092 3300053108 Bacteria 2827
475 Ga0500562_033260 3300053108 Bacteria 1362
476 Ga0500572_000763 3300053111 Bacteria 10328
477 Ga0500572_069024 3300053111 Bacteria 1089
478 Ga0500594_0000422 3300053118 Bacteria 9406
479 Ga0500595_001465 3300053119 Bacteria 12587
480 Ga0500595_002355 3300053119 Bacteria 9446
481 Ga0500595_017715 3300053119 Bacteria 2622
482 Ga0500595_141140 3300053119 Bacteria 675
483 Ga0500607_108023 3300053121 Bacteria 1369
484 Ga0500608_000007 3300053122 Bacteria 100296
485 Ga0500608_001035 3300053122 Bacteria 9967
486 Ga0500608_043862 3300053122 Bacteria 2147
487 Ga0500614_002506 3300053123 Bacteria 4080
488 Ga0500655_021135 3300053133 Bacteria 1219
489 Ga0500655_033234 3300053133 Bacteria 998
490 Ga0500658_0023138 3300053134 Bacteria 2370
491 Ga0500559_0007905 3300053136 Bacteria 4689
492 Ga0500559_0094655 3300053136 Bacteria 1371
493 Ga0500559_0106168 3300053136 Bacteria 1298
494 Ga0500564_000009 3300053138 Bacteria 60470
495 Ga0500568_0214608 3300053139 Bacteria 703
496 Ga0500590_024734 3300053148 Bacteria 3117
497 Ga0500590_031802 3300053148 Bacteria 2736
498 Ga0500616_0056284 3300053153 Bacteria 2053
499 Ga0500616_0082029 3300053153 Bacteria 1618
500 Ga0500616_0090439 3300053153 Bacteria 1517
501 Ga0500619_045480 3300053154 Bacteria 1404
502 Ga0500620_161169 3300053155 Bacteria 778
503 Ga0500622_0000234 3300053156 Bacteria 57602
504 Ga0500622_0010533 3300053156 Bacteria 5071
505 Ga0500639_229291 3300053163 Bacteria 766
506 Ga0500636_0040609 3300053177 Bacteria 2751
507 Ga0500636_0115677 3300053177 Bacteria 1510
508 Ga0500636_0354114 3300053177 Bacteria 699
509 Ga0500637_0017588 3300053178 Bacteria 3830
510 Ga0500637_0075175 3300053178 Bacteria 1946
511 Ga0500576_099193 3300053725 Bacteria 1192
512 Ga0500611_005677 3300053727 Bacteria 1771
513 Ga0500645_001725 3300053730 Bacteria 10611
514 Ga0500645_002985 3300053730 Bacteria 7167
515 Ga0500645_008934 3300053730 Bacteria 3389
516 Ga0500645_040527 3300053730 Bacteria 1377
517 Ga0500552_017582 3300053733 Bacteria 981
518 Ga0500596_001181 3300053735 Bacteria 5267
519 Ga0501082_0373939 3300060353 Bacteria 1243
520 2585146975 2582581279 Bacteria 4980720
521 2587919362 2585428106 Bacteria 5179711
522 2644000633 2643221598 Bacteria 4578346
523 2644088540 2643221614 Bacteria 4260023
524 2644225191 2643221640 Bacteria 5258820
525 2644232499 2643221642 Bacteria 5357871
526 2644343776 2643221661 Bacteria 4267604
527 2644368746 2643221666 Bacteria 4265935
528 2739793535 2739367756 Bacteria 4553612
529 2792460209 2791355048 Bacteria 5832535
530 2843746779 2843744320 Bacteria 5659202
531 2849560856 2849560528 Bacteria 5393480
532 2849576712 2849573788 Bacteria 5421256
533 2851154061 2851153111 Bacteria 5542585
534 2884965199 2884960567 Bacteria 5437054
535 2898333327 2898329390 Bacteria 5168154
536 Ga0157373_10000483
537 JGI25153J46596_10082870
538 rootH1_10010331
539 rootL2_10104603
540 Ga0055536_1000271
541 Ga0055536_1000307
542 Ga0055530_10000026
543 Ga0055530_10016026
544 Ga0055540_1034941
545 Ga0055531_10000899
546 Ga0055531_10001385
547 Ga0055531_10002897
548 Ga0055531_10036234
549 Ga0055531_10045156
550 Ga0065165_1001058
551 Ga0070670_100019351
552 Ga0070670_101095779
553 Ga0070666_10004481
554 Ga0070666_10316287
555 Ga0070680_100090930
556 Ga0070680_100116049
557 Ga0070660_100025252
558 Ga0070660_100038099
559 Ga0070691_10148878
560 Ga0070668_100000733
561 Ga0070668_100001360
562 Ga0070668_100003875
563 Ga0070668_100022966
564 Ga0070668_100052603
565 Ga0070669_100014242
566 Ga0070669_100339889
567 Ga0070669_101093842
568 Ga0070671_100001866
569 Ga0070671_100115923
570 Ga0070671_100430173
571 Ga0070671_100462822
572 Ga0070659_100000143
573 Ga0070659_100005171
574 Ga0070659_100033290
575 Ga0070667_100000146
576 Ga0070667_100007034
577 Ga0070667_100008886
578 Ga0070667_100020951
579 Ga0070663_100416060
580 Ga0070681_10019225
581 Ga0070681_10056881
582 Ga0070681_10371719
583 Ga0070685_10011937
584 Ga0070679_100142727
585 Ga0070679_100243060
586 Ga0068853_100010326
587 Ga0068853_100178453
588 Ga0070665_100000144
589 Ga0070665_100001180
590 Ga0070665_100002958
591 Ga0070665_100020082
592 Ga0068855_100035613
593 Ga0068855_100044018
594 Ga0068855_100094249
595 Ga0070664_100034800
596 Ga0070664_100491603
597 Ga0070664_100578948
598 Ga0068857_100719809
599 Ga0068854_100634187
600 Ga0068856_100532527
601 Ga0068856_100836017
602 Ga0068856_100928254
603 Ga0068852_101047648
604 Ga0068859_100000437
605 Ga0068859_100006364
606 Ga0068859_100374165
607 Ga0068859_100604081
608 Ga0068864_100000313
609 Ga0068864_100000503
610 Ga0068864_100054401
611 Ga0068864_100078305
612 Ga0068864_100117042
613 Ga0068864_100824166
614 Ga0068864_101287707
615 Ga0068861_100271154
616 Ga0068863_100000158
617 Ga0068863_100000253
618 Ga0068863_100002531
619 Ga0068863_100018754
620 Ga0068863_100023756
621 Ga0068863_100093271
622 Ga0068863_100288099
623 Ga0068858_100000746
624 Ga0068858_100003737
625 Ga0068858_100028444
626 Ga0068858_100277338
627 Ga0068860_100000234
628 Ga0068860_100000308
629 Ga0068860_100005340
630 Ga0068860_100032620
631 Ga0068860_101566425
632 Ga0068862_100000129
633 Ga0068862_100003825
634 Ga0068862_100209629
635 Ga0070717_11186826
636 Ga0075365_10412176
637 Ga0075363_100063502
638 Ga0075364_10000411
639 Ga0075367_10037498
640 Ga0075369_10013650
641 Ga0075369_10050924
642 Ga0075366_10146406
643 Ga0097621_100951954
644 Ga0075370_10058310
645 Ga0075370_10397428
646 Ga0068871_100722356
647 Ga0068865_100034685
648 Ga0097620_100000437
649 Ga0097620_100006364
650 Ga0097620_100374163
651 Ga0097620_100604029
652 Ga0079104_1015810
653 Ga0105240_10022612
654 Ga0105240_10071568
655 Ga0105240_10102063
656 Ga0105240_11564385
657 Ga0105247_10258579
658 Ga0105248_10000489
659 Ga0105248_10011458
660 Ga0105248_10036925
661 Ga0105248_10046013
662 Ga0105248_10065826
663 Ga0105248_10368099
664 Ga0105237_10346428
665 Ga0105238_10033188
666 Ga0105238_10039857
667 Ga0105238_10248466
668 Ga0105238_10290071
669 Ga0105238_10887696
670 Ga0105238_11545175
671 Ga0105249_10009776
672 Ga0105249_10102394
673 Ga0105249_10157395
674 Ga0105249_10674899
675 Ga0105239_10070776
676 Ga0105239_10436328
677 Ga0105239_10474680
678 Ga0157373_10000482
679 Ga0157370_10249794
680 Ga0157369_10499209
681 Ga0157374_10234511
682 Ga0163162_10240161
683 Ga0163162_10267262
684 Ga0157372_10477738
685 Ga0157375_10036236
686 Ga0163163_10026201
687 Ga0163163_10071631
688 Ga0163163_10156347
689 Ga0163163_10188185
690 Ga0163163_10277552
691 Ga0163163_10534393
692 Ga0157380_10182384
693 Ga0157377_10312658
694 Ga0157379_10000967
695 Ga0157379_10068713
696 Ga0157379_10101168
697 Ga0213876_10101676
698 Ga0213875_10191657
699 Ga0209026_1032207
700 Ga0209026_1040267
701 Ga0209148_1004982
702 Ga0209676_1000224
703 Ga0209676_1000422
704 Ga0209758_1002891
705 Ga0209050_1000029
706 Ga0209050_1000463
707 Ga0209050_1001193
708 Ga0209050_1001204
709 Ga0209256_1010255
710 Ga0209051_1008867
711 Ga0209257_1000152
712 Ga0209257_1000512
713 Ga0209257_1001271
714 Ga0209257_1026554
715 Ga0207710_10133530
716 Ga0207680_10003990
717 Ga0207680_10072151
718 Ga0207680_10104166
719 Ga0207705_10010119
720 Ga0207705_10134293
721 Ga0207654_10026762
722 Ga0207707_10021262
723 Ga0207707_10197451
724 Ga0207695_10001763
725 Ga0207695_10005400
726 Ga0207695_10010025
727 Ga0207695_10091696
728 Ga0207695_10448088
729 Ga0207695_10453311
730 Ga0207695_11059629
731 Ga0207660_10065045
732 Ga0207660_10077752
733 Ga0207657_10010954
734 Ga0207657_10048620
735 Ga0207657_10584929
736 Ga0207649_10895664
737 Ga0207652_10049193
738 Ga0207681_10019464
739 Ga0207681_10317829
740 Ga0207681_10961036
741 Ga0207694_10013384
742 Ga0207694_10037272
743 Ga0207694_10131137
744 Ga0207694_10173450
745 Ga0207694_10196787
746 Ga0207694_10781388
747 Ga0207694_10895722
748 Ga0207650_10000064
749 Ga0207650_10011859
750 Ga0207650_10012174
751 Ga0207650_10432680
752 Ga0207650_10603840
753 Ga0207687_10109059
754 Ga0207644_10001126
755 Ga0207644_10044081
756 Ga0207644_10047989
757 Ga0207644_10904597
758 Ga0207644_10921842
759 Ga0207690_10010748
760 Ga0207690_10060693
761 Ga0207690_10120154
762 Ga0207706_10502381
763 Ga0207704_10002245
764 Ga0207704_11061664
765 Ga0207711_10001700
766 Ga0207711_10002832
767 Ga0207711_10004706
768 Ga0207711_10035666
769 Ga0207711_10047787
770 Ga0207711_10548793
771 Ga0207679_10001519
772 Ga0207679_10526318
773 Ga0207667_10021083
774 Ga0207667_10024032
775 Ga0207667_10024243
776 Ga0207667_10048194
777 Ga0207667_10112218
778 Ga0207667_10265930
779 Ga0207667_10789991
780 Ga0207651_10035437
781 Ga0207712_10002582
782 Ga0207712_10123258
783 Ga0207668_10000154
784 Ga0207668_10000379
785 Ga0207668_10024993
786 Ga0207668_10067921
787 Ga0207668_10306512
788 Ga0207640_10533573
789 Ga0207640_10533705
790 Ga0207658_10001071
791 Ga0207658_10002901
792 Ga0207658_10009216
793 Ga0207658_10559439
794 Ga0207703_10000598
795 Ga0207703_10008480
796 Ga0207703_10022519
797 Ga0207703_10040750
798 Ga0207703_10363726
799 Ga0207639_10007364
800 Ga0207639_10107998
801 Ga0207639_10535913
802 Ga0207639_11029634
803 Ga0207678_10414111
804 Ga0207702_10438312
805 Ga0207702_10656129
806 Ga0207641_10000634
807 Ga0207641_10000687
808 Ga0207641_10013816
809 Ga0207641_10031521
810 Ga0207641_10089677
811 Ga0207641_10411472
812 Ga0207676_10000131
813 Ga0207676_10001356
814 Ga0207676_10016556
815 Ga0207676_10317426
816 Ga0207675_100250571
817 Ga0207683_10519105
818 Ga0207698_11315540
819 Ga0209281_1020179
820 Ga0209999_1005526
821 Ga0209983_1006282
822 Ga0209813_10021188
823 Ga0268266_10000003
824 Ga0268266_10000812
825 Ga0268266_10010701
826 Ga0268266_10021721
827 Ga0268265_10005471
828 Ga0268265_10007810
829 Ga0268265_10010074
830 Ga0268265_10019747
831 Ga0268264_10000008
832 Ga0268264_10000360
833 Ga0268264_10009444
834 Ga0268264_10027358
835 Ga0268264_11115257
836 Ga0307517_10001670
837 Ga0307517_10319785
838 Ga0307515_10080529
839 Ga0307511_10081846
840 Ga0265320_10040362
841 Ga0265327_10001234
842 Ga0265327_10001963
843 Ga0307513_10002302
844 Ga0307513_10004456
845 Ga0307513_10008813
846 Ga0307513_10013285
847 Ga0307408_100326063
848 Ga0307408_100524683
849 Ga0307508_10186371
850 Ga0307516_10000002
851 Ga0307405_11196128
852 Ga0307412_11129131
853 Ga0307409_101297984
854 Ga0307510_10024786
855 Ga0307510_10099020
856 Ga0307510_10293312
857 Ga0373944_0018453
858 Ga0373936_0000516
859 Ga0373935_0009585
860 Ga0373927_0000155
861 Ga0373925_0000032
862 Ga0395899_0000018
863 Ga0395899_0455146
864 Ga0395900_0297431
865 Ga0395898_0167800
866 Ga0395898_0181550
867 Ga0395905_0039392
868 Ga0395905_0114341
869 Ga0395905_0191014
870 Ga0395905_0511372
871 Ga0395905_0534517
872 Ga0395905_0947091
873 Ga0436364_0492243
874 Ga0395901_0479689
875 Ga0395901_0917891
876 Ga0436365_1003114
877 Ga0436365_1903966
878 Ga0436360_0825270
879 Ga0451849_1285073
880 Ga0466969_0098025
881 Ga0466965_0186397
882 Ga0466966_0048377
883 Ga0453684_0284929
884 Ga0466967_1004503
885 Ga0495638_0000387
886 Ga0495650_0053984
887 Ga0495639_0087693
888 Ga0495585_0073113
889 Ga0495585_0346020
890 Ga0495606_0084795
891 Ga0495606_0387029
892 Ga0495610_0008207
893 Ga0495628_0567309
894 Ga0495631_0024702
895 Ga0495637_0053805
896 Ga0495643_0037753
897 Ga0495648_0000130
898 Ga0495642_0008312
899 Ga0495642_0050744
900 Ga0495642_0058164
901 Ga0495642_0146935
902 Ga0495654_0058620
903 Ga0495665_0118504
904 Ga0495609_0029574
905 Ga0495597_0011104
906 Ga0495645_0182157
907 Ga0495622_0001260
908 Ga0495633_0385759
909 Ga0495668_0000060
910 Ga0495668_0006917
911 Ga0495668_0009979
912 Ga0495668_0057638
913 Ga0495668_0058492
914 Ga0495668_0118677
915 Ga0495668_0121672
916 Ga0495668_0519649
917 Ga0495611_0052845
918 Ga0495625_0115670
919 Ga0495625_0277026
920 Ga0495625_0284918
921 Ga0495669_0000020
922 Ga0495669_0000449
923 Ga0495669_0365580
924 Ga0495581_0259614
925 Ga0495636_0022590
926 Ga0495672_0094555
927 Ga0495672_0178016
928 Ga0495677_0101930
929 Ga0495673_0000397
930 Ga0495686_0003413
931 Ga0495686_0006846
932 Ga0495686_0022922
933 Ga0495686_0027185
934 Ga0495593_0048021
935 Ga0495602_1030366
936 Ga0496101_0677998
937 Ga0496101_0755736
938 Ga0496102_0127445
939 Ga0496102_0736931
940 Ga0496104_0300365
941 Ga0496105_0416605
942 Ga0496106_0194821
943 Ga0496107_0202677
944 Ga0496108_0457796
945 Ga0496109_0008454
946 Ga0496110_0063516
947 Ga0496111_0356062
948 Ga0496112_0096047
949 Ga0496112_0404157
950 Ga0496112_0566275
951 Ga0496113_0129757
952 Ga0496115_0001272
953 Ga0496115_0001892
954 Ga0496115_0049114
955 Ga0496115_0112706
956 Ga0496116_0145196
957 Ga0496118_0006963
958 Ga0496119_0024095
959 Ga0496121_0000059
960 Ga0496121_0459648
961 Ga0496124_0031509
962 Ga0496125_0054108
963 Ga0496126_0002857
964 Ga0495678_010667
965 Ga0501032_0123187
966 Ga0501034_0111449
967 Ga0501038_0669470
968 Ga0501038_1099885
969 Ga0501041_0420412
970 Ga0501043_0649516
971 Ga0501043_0829225
972 Ga0501047_0011838
973 Ga0501047_0110346
974 Ga0501047_1123564
975 Ga0501073_0417036
976 Ga0501035_0222185
977 Ga0501035_0290560
978 Ga0501035_1064125
979 Ga0501044_0007104
980 Ga0501044_0406252
981 nmdc:mga00v17_528_c1
982 nmdc:mga0k408_153012_c1
983 nmdc:mga0k408_172319_c1
984 nmdc:mga0k408_40701_c1
985 nmdc:mga04h51_94948_c1
986 nmdc:mga07m45_23460_c1
987 nmdc:mga07m45_326376_c1
988 nmdc:mga07m45_365970_c1
989 nmdc:mga07m45_7027_c1
990 nmdc:mga0sz30_14908_c1
991 nmdc:mga0sz30_40080_c1
992 Ga0500635_0000231
993 Ga0500578_0000377
994 Ga0500578_0308811
995 Ga0500643_001547
996 Ga0500643_005330
997 Ga0500643_008562
998 Ga0500643_041617
999 Ga0500644_0000037
1000 Ga0500647_0102980
1001 Ga0500566_0012647
1002 Ga0500641_0005016
1003 Ga0500641_0033204
1004 Ga0500556_0001589
1005 Ga0500556_0018139
1006 Ga0500556_0076320
1007 Ga0500562_002621
1008 Ga0500562_006226
1009 Ga0500562_007092
1010 Ga0500562_033260
1011 Ga0500572_000763
1012 Ga0500572_069024
1013 Ga0500594_0000422
1014 Ga0500595_001465
1015 Ga0500595_002355
1016 Ga0500595_017715
1017 Ga0500595_141140
1018 Ga0500607_108023
1019 Ga0500608_000007
1020 Ga0500608_001035
1021 Ga0500608_043862
1022 Ga0500614_002506
1023 Ga0500655_021135
1024 Ga0500655_033234
1025 Ga0500658_0023138
1026 Ga0500559_0007905
1027 Ga0500559_0094655
1028 Ga0500559_0106168
1029 Ga0500564_000009
1030 Ga0500568_0214608
1031 Ga0500590_024734
1032 Ga0500590_031802
1033 Ga0500616_0056284
1034 Ga0500616_0082029
1035 Ga0500616_0090439
1036 Ga0500619_045480
1037 Ga0500620_161169
1038 Ga0500622_0000234
1039 Ga0500622_0010533
1040 Ga0500639_229291
1041 Ga0500636_0040609
1042 Ga0500636_0115677
1043 Ga0500636_0354114
1044 Ga0500637_0017588
1045 Ga0500637_0075175
1046 Ga0500576_099193
1047 Ga0500611_005677
1048 Ga0500645_001725
1049 Ga0500645_002985
1050 Ga0500645_008934
1051 Ga0500645_040527
1052 Ga0500552_017582
1053 Ga0500596_001181
1054 Ga0501082_0373939
1055 2585146975
1056 2587919362
1057 2644000633
1058 2644088540
1059 2644225191
1060 2644232499
1061 2644343776
1062 2644368746
1063 2739793535
1064 2792460209
1065 2843746779
1066 2849560856
1067 2849576712
1068 2851154061
1069 2884965199
1070 2898333327

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

28

184

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qri-assembly1.cif.gz_A 2.35 angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130 0.9436 6 174
4qri-assembly1.cif.gz_B 2.35 angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130 0.9407 6 174
3ohp-assembly1.cif.gz_D crystal structure of hgprt from vibrio cholerae 0.9391 6 174
4rht-assembly3.cif.gz_D crystal structures of mycobacterium tuberculosis 6-oxopurine phosphoribosyltransferase which is a potential target for drug development against this disease 0.9373 8 176
4rqa-assembly1.cif.gz_A crystal structure of a hypoxanthine phosphoribosyltransferase (target id nysgrc-029686) from staphylococcus aureus (orthorhombic space group) 0.9357 9 176
ID Description Score Start End Superfamily
4qriB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9407 6 174 3.40.50.2020
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9373 8 176 3.40.50.2020
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9098 8 176 3.40.50.2020
af_P0A717_198_307_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9094 86 132 3.40.50.2020
4qriB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8997 6 174 3.40.50.2020

Map