F460656
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 535 | 268 | 1070 | 175 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10000483|Ga0157373_100004833 |
| Length | 197 |
| Sequence | MRAEIGDPEREPLLWAKSAPRRKLKGEMEVLLTEQEIAGRVEALAAEIAPRVDDETVAVCLLTGGIWFTADLTRALGRLGRNLRFDALWLSSYKDDRASSGRCQVRADLQRPLSGRKALIVDDVFDTGLSLSEAARLVRDAGASEVLTAVFARKPWPSARAIEPDFVAWEAPARFLVGYGMDSAGAMRGLPYIGALD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 70 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 71 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 115 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 122 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 123 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 124 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 126 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 127 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 128 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 129 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 130 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 134 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 135 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 136 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 146 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 147 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 148 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 149 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 150 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 151 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 152 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 153 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 186 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 187 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 188 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 189 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 190 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 193 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 194 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 195 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 196 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 197 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 198 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 199 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 200 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 201 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 202 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 203 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 204 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 215 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 216 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 217 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 218 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 219 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 220 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 221 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 222 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 223 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 224 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 225 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 226 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 227 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 228 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 229 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 230 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 231 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 232 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 233 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 234 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 235 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 236 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 237 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 238 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 239 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 240 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 241 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 242 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 243 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 244 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 245 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 246 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 247 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 248 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 249 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 250 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 251 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 252 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 254 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 255 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 256 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 257 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 258 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 259 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 260 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 261 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 262 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 263 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 264 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 265 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 266 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 267 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 268 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.01 |
| Metatranscriptomes | 0 |
| Isolates | 2.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.37 |
| Nodule | 0.37 |
| Rhizoplane | 3.74 |
| Rhizosphere | 67.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157373_10000483 | 3300013100 | Bacteria | 31535 |
| 2 | JGI25153J46596_10082870 | 3300003215 | Bacteria | 794 |
| 3 | rootH1_10010331 | 3300003316 | Bacteria | 2703 |
| 4 | rootL2_10104603 | 3300003322 | Bacteria | 2007 |
| 5 | Ga0055536_1000271 | 3300003781 | Bacteria | 39460 |
| 6 | Ga0055536_1000307 | 3300003781 | Bacteria | 36826 |
| 7 | Ga0055530_10000026 | 3300003791 | Bacteria | 129960 |
| 8 | Ga0055530_10016026 | 3300003791 | Bacteria | 2415 |
| 9 | Ga0055540_1034941 | 3300003792 | Bacteria | 1127 |
| 10 | Ga0055531_10000899 | 3300003794 | Bacteria | 24257 |
| 11 | Ga0055531_10001385 | 3300003794 | Bacteria | 17985 |
| 12 | Ga0055531_10002897 | 3300003794 | Bacteria | 11172 |
| 13 | Ga0055531_10036234 | 3300003794 | Bacteria | 1526 |
| 14 | Ga0055531_10045156 | 3300003794 | Bacteria | 1226 |
| 15 | Ga0065165_1001058 | 3300005262 | Bacteria | 32976 |
| 16 | Ga0070670_100019351 | 3300005331 | Bacteria | 5841 |
| 17 | Ga0070670_101095779 | 3300005331 | Bacteria | 726 |
| 18 | Ga0070666_10004481 | 3300005335 | Bacteria | 8511 |
| 19 | Ga0070666_10316287 | 3300005335 | Bacteria | 1113 |
| 20 | Ga0070680_100090930 | 3300005336 | Unclassified | 2526 |
| 21 | Ga0070680_100116049 | 3300005336 | Bacteria | 2231 |
| 22 | Ga0070660_100025252 | 3300005339 | Bacteria | 4415 |
| 23 | Ga0070660_100038099 | 3300005339 | Bacteria | 3647 |
| 24 | Ga0070691_10148878 | 3300005341 | Bacteria | 1198 |
| 25 | Ga0070668_100000733 | 3300005347 | Bacteria | 22420 |
| 26 | Ga0070668_100001360 | 3300005347 | Bacteria | 17507 |
| 27 | Ga0070668_100003875 | 3300005347 | Bacteria | 11044 |
| 28 | Ga0070668_100022966 | 3300005347 | Bacteria | 4716 |
| 29 | Ga0070668_100052603 | 3300005347 | Bacteria | 3139 |
| 30 | Ga0070669_100014242 | 3300005353 | Bacteria | 5658 |
| 31 | Ga0070669_100339889 | 3300005353 | Bacteria | 1216 |
| 32 | Ga0070669_101093842 | 3300005353 | Bacteria | 686 |
| 33 | Ga0070671_100001866 | 3300005355 | Bacteria | 16097 |
| 34 | Ga0070671_100115923 | 3300005355 | Bacteria | 2252 |
| 35 | Ga0070671_100430173 | 3300005355 | Bacteria | 1131 |
| 36 | Ga0070671_100462822 | 3300005355 | Unclassified | 1088 |
| 37 | Ga0070659_100000143 | 3300005366 | Bacteria | 55183 |
| 38 | Ga0070659_100005171 | 3300005366 | Bacteria | 9360 |
| 39 | Ga0070659_100033290 | 3300005366 | Bacteria | 4002 |
| 40 | Ga0070667_100000146 | 3300005367 | Bacteria | 88847 |
| 41 | Ga0070667_100007034 | 3300005367 | Bacteria | 9355 |
| 42 | Ga0070667_100008886 | 3300005367 | Bacteria | 8316 |
| 43 | Ga0070667_100020951 | 3300005367 | Bacteria | 5430 |
| 44 | Ga0070663_100416060 | 3300005455 | Bacteria | 1102 |
| 45 | Ga0070681_10019225 | 3300005458 | Bacteria | 6836 |
| 46 | Ga0070681_10056881 | 3300005458 | Bacteria | 3892 |
| 47 | Ga0070681_10371719 | 3300005458 | Bacteria | 1340 |
| 48 | Ga0070685_10011937 | 3300005466 | Bacteria | 4555 |
| 49 | Ga0070679_100142727 | 3300005530 | Bacteria | 2373 |
| 50 | Ga0070679_100243060 | 3300005530 | Bacteria | 1757 |
| 51 | Ga0068853_100010326 | 3300005539 | Bacteria | 7552 |
| 52 | Ga0068853_100178453 | 3300005539 | Bacteria | 1925 |
| 53 | Ga0070665_100000144 | 3300005548 | Bacteria | 132302 |
| 54 | Ga0070665_100001180 | 3300005548 | Bacteria | 31967 |
| 55 | Ga0070665_100002958 | 3300005548 | Bacteria | 18347 |
| 56 | Ga0070665_100020082 | 3300005548 | Bacteria | 6707 |
| 57 | Ga0068855_100035613 | 3300005563 | Bacteria | 5929 |
| 58 | Ga0068855_100044018 | 3300005563 | Bacteria | 5285 |
| 59 | Ga0068855_100094249 | 3300005563 | Bacteria | 3452 |
| 60 | Ga0070664_100034800 | 3300005564 | Bacteria | 4227 |
| 61 | Ga0070664_100491603 | 3300005564 | Bacteria | 1130 |
| 62 | Ga0070664_100578948 | 3300005564 | Bacteria | 1040 |
| 63 | Ga0068857_100719809 | 3300005577 | Bacteria | 949 |
| 64 | Ga0068854_100634187 | 3300005578 | Bacteria | 916 |
| 65 | Ga0068856_100532527 | 3300005614 | Bacteria | 1196 |
| 66 | Ga0068856_100836017 | 3300005614 | Bacteria | 940 |
| 67 | Ga0068856_100928254 | 3300005614 | Bacteria | 889 |
| 68 | Ga0068852_101047648 | 3300005616 | Unclassified | 835 |
| 69 | Ga0068859_100000437 | 3300005617 | Bacteria | 41851 |
| 70 | Ga0068859_100006364 | 3300005617 | Bacteria | 11977 |
| 71 | Ga0068859_100374165 | 3300005617 | Bacteria | 1520 |
| 72 | Ga0068859_100604081 | 3300005617 | Bacteria | 1190 |
| 73 | Ga0068864_100000313 | 3300005618 | Bacteria | 42907 |
| 74 | Ga0068864_100000503 | 3300005618 | Bacteria | 33698 |
| 75 | Ga0068864_100054401 | 3300005618 | Bacteria | 3454 |
| 76 | Ga0068864_100078305 | 3300005618 | Bacteria | 2893 |
| 77 | Ga0068864_100117042 | 3300005618 | Bacteria | 2379 |
| 78 | Ga0068864_100824166 | 3300005618 | Bacteria | 913 |
| 79 | Ga0068864_101287707 | 3300005618 | Bacteria | 731 |
| 80 | Ga0068861_100271154 | 3300005719 | Bacteria | 1457 |
| 81 | Ga0068863_100000158 | 3300005841 | Bacteria | 71918 |
| 82 | Ga0068863_100000253 | 3300005841 | Bacteria | 56367 |
| 83 | Ga0068863_100002531 | 3300005841 | Bacteria | 18136 |
| 84 | Ga0068863_100018754 | 3300005841 | Bacteria | 6620 |
| 85 | Ga0068863_100023756 | 3300005841 | Bacteria | 5848 |
| 86 | Ga0068863_100093271 | 3300005841 | Bacteria | 2857 |
| 87 | Ga0068863_100288099 | 3300005841 | Bacteria | 1592 |
| 88 | Ga0068858_100000746 | 3300005842 | Bacteria | 34090 |
| 89 | Ga0068858_100003737 | 3300005842 | Bacteria | 15059 |
| 90 | Ga0068858_100028444 | 3300005842 | Bacteria | 5192 |
| 91 | Ga0068858_100277338 | 3300005842 | Bacteria | 1596 |
| 92 | Ga0068860_100000234 | 3300005843 | Bacteria | 85182 |
| 93 | Ga0068860_100000308 | 3300005843 | Bacteria | 67784 |
| 94 | Ga0068860_100005340 | 3300005843 | Bacteria | 13040 |
| 95 | Ga0068860_100032620 | 3300005843 | Bacteria | 5003 |
| 96 | Ga0068860_101566425 | 3300005843 | Bacteria | 681 |
| 97 | Ga0068862_100000129 | 3300005844 | Bacteria | 88141 |
| 98 | Ga0068862_100003825 | 3300005844 | Bacteria | 12817 |
| 99 | Ga0068862_100209629 | 3300005844 | Bacteria | 1760 |
| 100 | Ga0070717_11186826 | 3300006028 | Bacteria | 695 |
| 101 | Ga0075365_10412176 | 3300006038 | Bacteria | 954 |
| 102 | Ga0075363_100063502 | 3300006048 | Bacteria | 1993 |
| 103 | Ga0075364_10000411 | 3300006051 | Bacteria | 21397 |
| 104 | Ga0075367_10037498 | 3300006178 | Bacteria | 2817 |
| 105 | Ga0075369_10013650 | 3300006186 | Bacteria | 3231 |
| 106 | Ga0075369_10050924 | 3300006186 | Bacteria | 1792 |
| 107 | Ga0075366_10146406 | 3300006195 | Bacteria | 1429 |
| 108 | Ga0097621_100951954 | 3300006237 | Bacteria | 802 |
| 109 | Ga0075370_10058310 | 3300006353 | Bacteria | 2195 |
| 110 | Ga0075370_10397428 | 3300006353 | Bacteria | 827 |
| 111 | Ga0068871_100722356 | 3300006358 | Bacteria | 914 |
| 112 | Ga0068865_100034685 | 3300006881 | Bacteria | 3387 |
| 113 | Ga0097620_100000437 | 3300006931 | Bacteria | 41851 |
| 114 | Ga0097620_100006364 | 3300006931 | Bacteria | 11977 |
| 115 | Ga0097620_100374163 | 3300006931 | Bacteria | 1520 |
| 116 | Ga0097620_100604029 | 3300006931 | Bacteria | 1190 |
| 117 | Ga0079104_1015810 | 3300006946 | Bacteria | 2225 |
| 118 | Ga0105240_10022612 | 3300009093 | Bacteria | 8328 |
| 119 | Ga0105240_10071568 | 3300009093 | Bacteria | 4288 |
| 120 | Ga0105240_10102063 | 3300009093 | Bacteria | 3487 |
| 121 | Ga0105240_11564385 | 3300009093 | Unclassified | 690 |
| 122 | Ga0105247_10258579 | 3300009101 | Bacteria | 1193 |
| 123 | Ga0105248_10000489 | 3300009177 | Bacteria | 45002 |
| 124 | Ga0105248_10011458 | 3300009177 | Bacteria | 9771 |
| 125 | Ga0105248_10036925 | 3300009177 | Bacteria | 5464 |
| 126 | Ga0105248_10046013 | 3300009177 | Bacteria | 4892 |
| 127 | Ga0105248_10065826 | 3300009177 | Bacteria | 4069 |
| 128 | Ga0105248_10368099 | 3300009177 | Bacteria | 1618 |
| 129 | Ga0105237_10346428 | 3300009545 | Bacteria | 1490 |
| 130 | Ga0105238_10033188 | 3300009551 | Bacteria | 5253 |
| 131 | Ga0105238_10039857 | 3300009551 | Bacteria | 4762 |
| 132 | Ga0105238_10248466 | 3300009551 | Bacteria | 1757 |
| 133 | Ga0105238_10290071 | 3300009551 | Bacteria | 1618 |
| 134 | Ga0105238_10887696 | 3300009551 | Bacteria | 909 |
| 135 | Ga0105238_11545175 | 3300009551 | Bacteria | 693 |
| 136 | Ga0105249_10009776 | 3300009553 | Bacteria | 8402 |
| 137 | Ga0105249_10102394 | 3300009553 | Bacteria | 2695 |
| 138 | Ga0105249_10157395 | 3300009553 | Bacteria | 2192 |
| 139 | Ga0105249_10674899 | 3300009553 | Bacteria | 1092 |
| 140 | Ga0105239_10070776 | 3300010375 | Bacteria | 3832 |
| 141 | Ga0105239_10436328 | 3300010375 | Bacteria | 1485 |
| 142 | Ga0105239_10474680 | 3300010375 | Bacteria | 1420 |
| 143 | Ga0157373_10000482 | 3300013100 | Bacteria | 31638 |
| 144 | Ga0157370_10249794 | 3300013104 | Bacteria | 1641 |
| 145 | Ga0157369_10499209 | 3300013105 | Bacteria | 1259 |
| 146 | Ga0157374_10234511 | 3300013296 | Bacteria | 1803 |
| 147 | Ga0163162_10240161 | 3300013306 | Bacteria | 1943 |
| 148 | Ga0163162_10267262 | 3300013306 | Bacteria | 1842 |
| 149 | Ga0157372_10477738 | 3300013307 | Bacteria | 1453 |
| 150 | Ga0157375_10036236 | 3300013308 | Bacteria | 4717 |
| 151 | Ga0163163_10026201 | 3300014325 | Bacteria | 5569 |
| 152 | Ga0163163_10071631 | 3300014325 | Bacteria | 3454 |
| 153 | Ga0163163_10156347 | 3300014325 | Bacteria | 2324 |
| 154 | Ga0163163_10188185 | 3300014325 | Bacteria | 2112 |
| 155 | Ga0163163_10277552 | 3300014325 | Bacteria | 1727 |
| 156 | Ga0163163_10534393 | 3300014325 | Bacteria | 1235 |
| 157 | Ga0157380_10182384 | 3300014326 | Bacteria | 1845 |
| 158 | Ga0157377_10312658 | 3300014745 | Bacteria | 1041 |
| 159 | Ga0157379_10000967 | 3300014968 | Bacteria | 23322 |
| 160 | Ga0157379_10068713 | 3300014968 | Bacteria | 3167 |
| 161 | Ga0157379_10101168 | 3300014968 | Bacteria | 2587 |
| 162 | Ga0213876_10101676 | 3300021384 | Bacteria | 1524 |
| 163 | Ga0213875_10191657 | 3300021388 | Bacteria | 961 |
| 164 | Ga0209026_1032207 | 3300025250 | Bacteria | 775 |
| 165 | Ga0209026_1040267 | 3300025250 | Bacteria | 678 |
| 166 | Ga0209148_1004982 | 3300025254 | Bacteria | 3129 |
| 167 | Ga0209676_1000224 | 3300025292 | Bacteria | 124160 |
| 168 | Ga0209676_1000422 | 3300025292 | Bacteria | 74541 |
| 169 | Ga0209758_1002891 | 3300025297 | Bacteria | 16602 |
| 170 | Ga0209050_1000029 | 3300025298 | Bacteria | 465801 |
| 171 | Ga0209050_1000463 | 3300025298 | Bacteria | 72380 |
| 172 | Ga0209050_1001193 | 3300025298 | Bacteria | 30547 |
| 173 | Ga0209050_1001204 | 3300025298 | Bacteria | 30367 |
| 174 | Ga0209256_1010255 | 3300025299 | Bacteria | 3953 |
| 175 | Ga0209051_1008867 | 3300025303 | Bacteria | 5262 |
| 176 | Ga0209257_1000152 | 3300025304 | Bacteria | 189432 |
| 177 | Ga0209257_1000512 | 3300025304 | Bacteria | 67436 |
| 178 | Ga0209257_1001271 | 3300025304 | Bacteria | 30931 |
| 179 | Ga0209257_1026554 | 3300025304 | Bacteria | 1948 |
| 180 | Ga0207710_10133530 | 3300025900 | Bacteria | 1193 |
| 181 | Ga0207680_10003990 | 3300025903 | Bacteria | 6971 |
| 182 | Ga0207680_10072151 | 3300025903 | Bacteria | 2143 |
| 183 | Ga0207680_10104166 | 3300025903 | Bacteria | 1828 |
| 184 | Ga0207705_10010119 | 3300025909 | Bacteria | 6866 |
| 185 | Ga0207705_10134293 | 3300025909 | Bacteria | 1844 |
| 186 | Ga0207654_10026762 | 3300025911 | Bacteria | 3127 |
| 187 | Ga0207707_10021262 | 3300025912 | Bacteria | 5671 |
| 188 | Ga0207707_10197451 | 3300025912 | Bacteria | 1754 |
| 189 | Ga0207695_10001763 | 3300025913 | Bacteria | 34269 |
| 190 | Ga0207695_10005400 | 3300025913 | Bacteria | 16971 |
| 191 | Ga0207695_10010025 | 3300025913 | Bacteria | 11633 |
| 192 | Ga0207695_10091696 | 3300025913 | Bacteria | 3051 |
| 193 | Ga0207695_10448088 | 3300025913 | Bacteria | 1174 |
| 194 | Ga0207695_10453311 | 3300025913 | Bacteria | 1166 |
| 195 | Ga0207695_11059629 | 3300025913 | Unclassified | 690 |
| 196 | Ga0207660_10065045 | 3300025917 | Bacteria | 2634 |
| 197 | Ga0207660_10077752 | 3300025917 | Bacteria | 2430 |
| 198 | Ga0207657_10010954 | 3300025919 | Bacteria | 9018 |
| 199 | Ga0207657_10048620 | 3300025919 | Bacteria | 3702 |
| 200 | Ga0207657_10584929 | 3300025919 | Bacteria | 872 |
| 201 | Ga0207649_10895664 | 3300025920 | Unclassified | 695 |
| 202 | Ga0207652_10049193 | 3300025921 | Bacteria | 3608 |
| 203 | Ga0207681_10019464 | 3300025923 | Bacteria | 4288 |
| 204 | Ga0207681_10317829 | 3300025923 | Bacteria | 1237 |
| 205 | Ga0207681_10961036 | 3300025923 | Bacteria | 716 |
| 206 | Ga0207694_10013384 | 3300025924 | Bacteria | 6179 |
| 207 | Ga0207694_10037272 | 3300025924 | Bacteria | 3734 |
| 208 | Ga0207694_10131137 | 3300025924 | Bacteria | 2009 |
| 209 | Ga0207694_10173450 | 3300025924 | Bacteria | 1747 |
| 210 | Ga0207694_10196787 | 3300025924 | Bacteria | 1639 |
| 211 | Ga0207694_10781388 | 3300025924 | Bacteria | 806 |
| 212 | Ga0207694_10895722 | 3300025924 | Bacteria | 750 |
| 213 | Ga0207650_10000064 | 3300025925 | Bacteria | 142969 |
| 214 | Ga0207650_10011859 | 3300025925 | Bacteria | 6005 |
| 215 | Ga0207650_10012174 | 3300025925 | Bacteria | 5931 |
| 216 | Ga0207650_10432680 | 3300025925 | Bacteria | 1093 |
| 217 | Ga0207650_10603840 | 3300025925 | Bacteria | 923 |
| 218 | Ga0207687_10109059 | 3300025927 | Bacteria | 2050 |
| 219 | Ga0207644_10001126 | 3300025931 | Bacteria | 17127 |
| 220 | Ga0207644_10044081 | 3300025931 | Bacteria | 3168 |
| 221 | Ga0207644_10047989 | 3300025931 | Bacteria | 3050 |
| 222 | Ga0207644_10904597 | 3300025931 | Bacteria | 740 |
| 223 | Ga0207644_10921842 | 3300025931 | Bacteria | 732 |
| 224 | Ga0207690_10010748 | 3300025932 | Bacteria | 5455 |
| 225 | Ga0207690_10060693 | 3300025932 | Bacteria | 2568 |
| 226 | Ga0207690_10120154 | 3300025932 | Bacteria | 1907 |
| 227 | Ga0207706_10502381 | 3300025933 | Unclassified | 1047 |
| 228 | Ga0207704_10002245 | 3300025938 | Bacteria | 8672 |
| 229 | Ga0207704_11061664 | 3300025938 | Bacteria | 687 |
| 230 | Ga0207711_10001700 | 3300025941 | Bacteria | 20250 |
| 231 | Ga0207711_10002832 | 3300025941 | Bacteria | 15237 |
| 232 | Ga0207711_10004706 | 3300025941 | Bacteria | 11596 |
| 233 | Ga0207711_10035666 | 3300025941 | Bacteria | 4218 |
| 234 | Ga0207711_10047787 | 3300025941 | Bacteria | 3660 |
| 235 | Ga0207711_10548793 | 3300025941 | Bacteria | 1078 |
| 236 | Ga0207679_10001519 | 3300025945 | Bacteria | 14513 |
| 237 | Ga0207679_10526318 | 3300025945 | Bacteria | 1058 |
| 238 | Ga0207667_10021083 | 3300025949 | Bacteria | 7227 |
| 239 | Ga0207667_10024032 | 3300025949 | Bacteria | 6701 |
| 240 | Ga0207667_10024243 | 3300025949 | Bacteria | 6665 |
| 241 | Ga0207667_10048194 | 3300025949 | Bacteria | 4506 |
| 242 | Ga0207667_10112218 | 3300025949 | Bacteria | 2811 |
| 243 | Ga0207667_10265930 | 3300025949 | Bacteria | 1753 |
| 244 | Ga0207667_10789991 | 3300025949 | Bacteria | 947 |
| 245 | Ga0207651_10035437 | 3300025960 | Bacteria | 3245 |
| 246 | Ga0207712_10002582 | 3300025961 | Bacteria | 11640 |
| 247 | Ga0207712_10123258 | 3300025961 | Bacteria | 1964 |
| 248 | Ga0207668_10000154 | 3300025972 | Bacteria | 47517 |
| 249 | Ga0207668_10000379 | 3300025972 | Bacteria | 28234 |
| 250 | Ga0207668_10024993 | 3300025972 | Bacteria | 3860 |
| 251 | Ga0207668_10067921 | 3300025972 | Bacteria | 2532 |
| 252 | Ga0207668_10306512 | 3300025972 | Bacteria | 1312 |
| 253 | Ga0207640_10533573 | 3300025981 | Bacteria | 983 |
| 254 | Ga0207640_10533705 | 3300025981 | Bacteria | 983 |
| 255 | Ga0207658_10001071 | 3300025986 | Bacteria | 22181 |
| 256 | Ga0207658_10002901 | 3300025986 | Bacteria | 12291 |
| 257 | Ga0207658_10009216 | 3300025986 | Bacteria | 6692 |
| 258 | Ga0207658_10559439 | 3300025986 | Bacteria | 1024 |
| 259 | Ga0207703_10000598 | 3300026035 | Bacteria | 36651 |
| 260 | Ga0207703_10008480 | 3300026035 | Bacteria | 8122 |
| 261 | Ga0207703_10022519 | 3300026035 | Bacteria | 4943 |
| 262 | Ga0207703_10040750 | 3300026035 | Bacteria | 3719 |
| 263 | Ga0207703_10363726 | 3300026035 | Bacteria | 1335 |
| 264 | Ga0207639_10007364 | 3300026041 | Bacteria | 7503 |
| 265 | Ga0207639_10107998 | 3300026041 | Bacteria | 2262 |
| 266 | Ga0207639_10535913 | 3300026041 | Bacteria | 1073 |
| 267 | Ga0207639_11029634 | 3300026041 | Unclassified | 771 |
| 268 | Ga0207678_10414111 | 3300026067 | Bacteria | 1168 |
| 269 | Ga0207702_10438312 | 3300026078 | Bacteria | 1266 |
| 270 | Ga0207702_10656129 | 3300026078 | Bacteria | 1032 |
| 271 | Ga0207641_10000634 | 3300026088 | Bacteria | 38355 |
| 272 | Ga0207641_10000687 | 3300026088 | Bacteria | 36473 |
| 273 | Ga0207641_10013816 | 3300026088 | Bacteria | 6622 |
| 274 | Ga0207641_10031521 | 3300026088 | Bacteria | 4397 |
| 275 | Ga0207641_10089677 | 3300026088 | Bacteria | 2688 |
| 276 | Ga0207641_10411472 | 3300026088 | Bacteria | 1300 |
| 277 | Ga0207676_10000131 | 3300026095 | Bacteria | 66092 |
| 278 | Ga0207676_10001356 | 3300026095 | Bacteria | 18203 |
| 279 | Ga0207676_10016556 | 3300026095 | Bacteria | 5339 |
| 280 | Ga0207676_10317426 | 3300026095 | Bacteria | 1429 |
| 281 | Ga0207675_100250571 | 3300026118 | Bacteria | 1714 |
| 282 | Ga0207683_10519105 | 3300026121 | Bacteria | 1101 |
| 283 | Ga0207698_11315540 | 3300026142 | Bacteria | 737 |
| 284 | Ga0209281_1020179 | 3300027111 | Bacteria | 1306 |
| 285 | Ga0209999_1005526 | 3300027543 | Bacteria | 2273 |
| 286 | Ga0209983_1006282 | 3300027665 | Bacteria | 2447 |
| 287 | Ga0209813_10021188 | 3300027866 | Bacteria | 1825 |
| 288 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 289 | Ga0268266_10000812 | 3300028379 | Bacteria | 41107 |
| 290 | Ga0268266_10010701 | 3300028379 | Bacteria | 7993 |
| 291 | Ga0268266_10021721 | 3300028379 | Bacteria | 5470 |
| 292 | Ga0268265_10005471 | 3300028380 | Bacteria | 8675 |
| 293 | Ga0268265_10007810 | 3300028380 | Bacteria | 7219 |
| 294 | Ga0268265_10010074 | 3300028380 | Bacteria | 6380 |
| 295 | Ga0268265_10019747 | 3300028380 | Bacteria | 4691 |
| 296 | Ga0268264_10000008 | 3300028381 | Bacteria | 773387 |
| 297 | Ga0268264_10000360 | 3300028381 | Bacteria | 67798 |
| 298 | Ga0268264_10009444 | 3300028381 | Bacteria | 8078 |
| 299 | Ga0268264_10027358 | 3300028381 | Bacteria | 4658 |
| 300 | Ga0268264_11115257 | 3300028381 | Bacteria | 798 |
| 301 | Ga0307517_10001670 | 3300028786 | Bacteria | 36710 |
| 302 | Ga0307517_10319785 | 3300028786 | Bacteria | 859 |
| 303 | Ga0307515_10080529 | 3300028794 | Bacteria | 4245 |
| 304 | Ga0307511_10081846 | 3300030521 | Bacteria | 2262 |
| 305 | Ga0265320_10040362 | 3300031240 | Bacteria | 2328 |
| 306 | Ga0265327_10001234 | 3300031251 | Bacteria | 34331 |
| 307 | Ga0265327_10001963 | 3300031251 | Bacteria | 23543 |
| 308 | Ga0307513_10002302 | 3300031456 | Bacteria | 26655 |
| 309 | Ga0307513_10004456 | 3300031456 | Bacteria | 18698 |
| 310 | Ga0307513_10008813 | 3300031456 | Bacteria | 12845 |
| 311 | Ga0307513_10013285 | 3300031456 | Bacteria | 10111 |
| 312 | Ga0307408_100326063 | 3300031548 | Bacteria | 1295 |
| 313 | Ga0307408_100524683 | 3300031548 | Bacteria | 1041 |
| 314 | Ga0307508_10186371 | 3300031616 | Bacteria | 1677 |
| 315 | Ga0307516_10000002 | 3300031730 | Bacteria | 467851 |
| 316 | Ga0307405_11196128 | 3300031731 | Bacteria | 657 |
| 317 | Ga0307412_11129131 | 3300031911 | Bacteria | 699 |
| 318 | Ga0307409_101297984 | 3300031995 | Bacteria | 753 |
| 319 | Ga0307510_10024786 | 3300033180 | Bacteria | 6927 |
| 320 | Ga0307510_10099020 | 3300033180 | Bacteria | 2716 |
| 321 | Ga0307510_10293312 | 3300033180 | Bacteria | 1091 |
| 322 | Ga0373944_0018453 | 3300035089 | Bacteria | 1992 |
| 323 | Ga0373936_0000516 | 3300035113 | Bacteria | 13169 |
| 324 | Ga0373935_0009585 | 3300035692 | Bacteria | 5797 |
| 325 | Ga0373927_0000155 | 3300035695 | Bacteria | 53529 |
| 326 | Ga0373925_0000032 | 3300037068 | Bacteria | 145357 |
| 327 | Ga0395899_0000018 | 3300037312 | Bacteria | 423194 |
| 328 | Ga0395899_0455146 | 3300037312 | Bacteria | 837 |
| 329 | Ga0395900_0297431 | 3300037418 | Bacteria | 1601 |
| 330 | Ga0395898_0167800 | 3300037466 | Bacteria | 2098 |
| 331 | Ga0395898_0181550 | 3300037466 | Bacteria | 2011 |
| 332 | Ga0395905_0039392 | 3300037471 | Bacteria | 4434 |
| 333 | Ga0395905_0114341 | 3300037471 | Bacteria | 2536 |
| 334 | Ga0395905_0191014 | 3300037471 | Bacteria | 1921 |
| 335 | Ga0395905_0511372 | 3300037471 | Bacteria | 1101 |
| 336 | Ga0395905_0534517 | 3300037471 | Bacteria | 1073 |
| 337 | Ga0395905_0947091 | 3300037471 | Bacteria | 764 |
| 338 | Ga0436364_0492243 | 3300037853 | Bacteria | 4293 |
| 339 | Ga0395901_0479689 | 3300038443 | Bacteria | 1268 |
| 340 | Ga0395901_0917891 | 3300038443 | Bacteria | 856 |
| 341 | Ga0436365_1003114 | 3300039437 | Bacteria | 3933 |
| 342 | Ga0436365_1903966 | 3300039437 | Bacteria | 1583 |
| 343 | Ga0436360_0825270 | 3300039438 | Bacteria | 1137 |
| 344 | Ga0451849_1285073 | 3300041505 | Bacteria | 709 |
| 345 | Ga0466969_0098025 | 3300044656 | Bacteria | 1382 |
| 346 | Ga0466965_0186397 | 3300044683 | Bacteria | 1096 |
| 347 | Ga0466966_0048377 | 3300044684 | Bacteria | 2709 |
| 348 | Ga0453684_0284929 | 3300044712 | Bacteria | 1883 |
| 349 | Ga0466967_1004503 | 3300045976 | Bacteria | 831 |
| 350 | Ga0495638_0000387 | 3300046460 | Bacteria | 54475 |
| 351 | Ga0495650_0053984 | 3300046471 | Bacteria | 1642 |
| 352 | Ga0495639_0087693 | 3300046475 | Bacteria | 1457 |
| 353 | Ga0495585_0073113 | 3300046492 | Bacteria | 1867 |
| 354 | Ga0495585_0346020 | 3300046492 | Bacteria | 723 |
| 355 | Ga0495606_0084795 | 3300046507 | Bacteria | 1961 |
| 356 | Ga0495606_0387029 | 3300046507 | Bacteria | 732 |
| 357 | Ga0495610_0008207 | 3300046512 | Bacteria | 6803 |
| 358 | Ga0495628_0567309 | 3300046516 | Bacteria | 813 |
| 359 | Ga0495631_0024702 | 3300046518 | Bacteria | 2773 |
| 360 | Ga0495637_0053805 | 3300046520 | Bacteria | 1674 |
| 361 | Ga0495643_0037753 | 3300046522 | Bacteria | 2647 |
| 362 | Ga0495648_0000130 | 3300046524 | Bacteria | 88368 |
| 363 | Ga0495642_0008312 | 3300046528 | Bacteria | 3970 |
| 364 | Ga0495642_0050744 | 3300046528 | Bacteria | 1706 |
| 365 | Ga0495642_0058164 | 3300046528 | Bacteria | 1600 |
| 366 | Ga0495642_0146935 | 3300046528 | Bacteria | 1019 |
| 367 | Ga0495654_0058620 | 3300046530 | Bacteria | 1857 |
| 368 | Ga0495665_0118504 | 3300046531 | Bacteria | 1387 |
| 369 | Ga0495609_0029574 | 3300046538 | Bacteria | 2494 |
| 370 | Ga0495597_0011104 | 3300046542 | Bacteria | 4374 |
| 371 | Ga0495645_0182157 | 3300046543 | Bacteria | 1438 |
| 372 | Ga0495622_0001260 | 3300046557 | Bacteria | 12983 |
| 373 | Ga0495633_0385759 | 3300046558 | Bacteria | 634 |
| 374 | Ga0495668_0000060 | 3300046616 | Bacteria | 193823 |
| 375 | Ga0495668_0006917 | 3300046616 | Bacteria | 7340 |
| 376 | Ga0495668_0009979 | 3300046616 | Bacteria | 5784 |
| 377 | Ga0495668_0057638 | 3300046616 | Bacteria | 2144 |
| 378 | Ga0495668_0058492 | 3300046616 | Bacteria | 2127 |
| 379 | Ga0495668_0118677 | 3300046616 | Bacteria | 1446 |
| 380 | Ga0495668_0121672 | 3300046616 | Bacteria | 1428 |
| 381 | Ga0495668_0519649 | 3300046616 | Bacteria | 656 |
| 382 | Ga0495611_0052845 | 3300046648 | Bacteria | 1833 |
| 383 | Ga0495625_0115670 | 3300046660 | Bacteria | 1830 |
| 384 | Ga0495625_0277026 | 3300046660 | Bacteria | 1080 |
| 385 | Ga0495625_0284918 | 3300046660 | Bacteria | 1062 |
| 386 | Ga0495669_0000020 | 3300046684 | Bacteria | 122868 |
| 387 | Ga0495669_0000449 | 3300046684 | Bacteria | 19393 |
| 388 | Ga0495669_0365580 | 3300046684 | Bacteria | 698 |
| 389 | Ga0495581_0259614 | 3300047315 | Bacteria | 1016 |
| 390 | Ga0495636_0022590 | 3300047318 | Bacteria | 2544 |
| 391 | Ga0495672_0094555 | 3300047320 | Bacteria | 1634 |
| 392 | Ga0495672_0178016 | 3300047320 | Bacteria | 1079 |
| 393 | Ga0495677_0101930 | 3300047445 | Bacteria | 1087 |
| 394 | Ga0495673_0000397 | 3300047469 | Bacteria | 50855 |
| 395 | Ga0495686_0003413 | 3300047472 | Bacteria | 13818 |
| 396 | Ga0495686_0006846 | 3300047472 | Bacteria | 8637 |
| 397 | Ga0495686_0022922 | 3300047472 | Bacteria | 4125 |
| 398 | Ga0495686_0027185 | 3300047472 | Bacteria | 3737 |
| 399 | Ga0495593_0048021 | 3300047673 | Bacteria | 2269 |
| 400 | Ga0495602_1030366 | 3300048088 | Bacteria | 542 |
| 401 | Ga0496101_0677998 | 3300048904 | Bacteria | 814 |
| 402 | Ga0496101_0755736 | 3300048904 | Bacteria | 767 |
| 403 | Ga0496102_0127445 | 3300048905 | Bacteria | 2380 |
| 404 | Ga0496102_0736931 | 3300048905 | Bacteria | 908 |
| 405 | Ga0496104_0300365 | 3300048907 | Bacteria | 1518 |
| 406 | Ga0496105_0416605 | 3300048908 | Bacteria | 1064 |
| 407 | Ga0496106_0194821 | 3300048909 | Bacteria | 1612 |
| 408 | Ga0496107_0202677 | 3300048910 | Bacteria | 1475 |
| 409 | Ga0496108_0457796 | 3300048911 | Bacteria | 1114 |
| 410 | Ga0496109_0008454 | 3300048912 | Bacteria | 8751 |
| 411 | Ga0496110_0063516 | 3300048913 | Bacteria | 3263 |
| 412 | Ga0496111_0356062 | 3300048914 | Bacteria | 1083 |
| 413 | Ga0496112_0096047 | 3300048915 | Bacteria | 2934 |
| 414 | Ga0496112_0404157 | 3300048915 | Bacteria | 1305 |
| 415 | Ga0496112_0566275 | 3300048915 | Bacteria | 1069 |
| 416 | Ga0496113_0129757 | 3300048916 | Bacteria | 1977 |
| 417 | Ga0496115_0001272 | 3300048918 | Bacteria | 18065 |
| 418 | Ga0496115_0001892 | 3300048918 | Bacteria | 14984 |
| 419 | Ga0496115_0049114 | 3300048918 | Bacteria | 3376 |
| 420 | Ga0496115_0112706 | 3300048918 | Bacteria | 2235 |
| 421 | Ga0496116_0145196 | 3300048919 | Bacteria | 1327 |
| 422 | Ga0496118_0006963 | 3300048921 | Bacteria | 12207 |
| 423 | Ga0496119_0024095 | 3300048922 | Bacteria | 4293 |
| 424 | Ga0496121_0000059 | 3300048924 | Bacteria | 278177 |
| 425 | Ga0496121_0459648 | 3300048924 | Bacteria | 818 |
| 426 | Ga0496124_0031509 | 3300048927 | Bacteria | 4693 |
| 427 | Ga0496125_0054108 | 3300048928 | Bacteria | 3283 |
| 428 | Ga0496126_0002857 | 3300048929 | Bacteria | 22576 |
| 429 | Ga0495678_010667 | 3300049459 | Bacteria | 4448 |
| 430 | Ga0501032_0123187 | 3300049569 | Bacteria | 1713 |
| 431 | Ga0501034_0111449 | 3300049571 | Bacteria | 2727 |
| 432 | Ga0501038_0669470 | 3300049574 | Bacteria | 780 |
| 433 | Ga0501038_1099885 | 3300049574 | Bacteria | 580 |
| 434 | Ga0501041_0420412 | 3300049577 | Bacteria | 848 |
| 435 | Ga0501043_0649516 | 3300049579 | Bacteria | 775 |
| 436 | Ga0501043_0829225 | 3300049579 | Bacteria | 667 |
| 437 | Ga0501047_0011838 | 3300049581 | Bacteria | 8250 |
| 438 | Ga0501047_0110346 | 3300049581 | Bacteria | 2634 |
| 439 | Ga0501047_1123564 | 3300049581 | Bacteria | 599 |
| 440 | Ga0501073_0417036 | 3300049589 | Bacteria | 928 |
| 441 | Ga0501035_0222185 | 3300049822 | Bacteria | 1612 |
| 442 | Ga0501035_0290560 | 3300049822 | Bacteria | 1380 |
| 443 | Ga0501035_1064125 | 3300049822 | Bacteria | 633 |
| 444 | Ga0501044_0007104 | 3300049823 | Bacteria | 12322 |
| 445 | Ga0501044_0406252 | 3300049823 | Bacteria | 1274 |
| 446 | nmdc:mga00v17_528_c1 | 3300050491 | Bacteria | 21420 |
| 447 | nmdc:mga0k408_153012_c1 | 3300050493 | Bacteria | 1374 |
| 448 | nmdc:mga0k408_172319_c1 | 3300050493 | Bacteria | 816 |
| 449 | nmdc:mga0k408_40701_c1 | 3300050493 | Bacteria | 2675 |
| 450 | nmdc:mga04h51_94948_c1 | 3300050495 | Bacteria | 1079 |
| 451 | nmdc:mga07m45_23460_c1 | 3300050496 | Bacteria | 3374 |
| 452 | nmdc:mga07m45_326376_c1 | 3300050496 | Bacteria | 892 |
| 453 | nmdc:mga07m45_365970_c1 | 3300050496 | Bacteria | 838 |
| 454 | nmdc:mga07m45_7027_c1 | 3300050496 | Bacteria | 5728 |
| 455 | nmdc:mga0sz30_14908_c1 | 3300050516 | Bacteria | 3066 |
| 456 | nmdc:mga0sz30_40080_c1 | 3300050516 | Bacteria | 1968 |
| 457 | Ga0500635_0000231 | 3300053080 | Bacteria | 24724 |
| 458 | Ga0500578_0000377 | 3300053086 | Bacteria | 54788 |
| 459 | Ga0500578_0308811 | 3300053086 | Bacteria | 936 |
| 460 | Ga0500643_001547 | 3300053087 | Bacteria | 13032 |
| 461 | Ga0500643_005330 | 3300053087 | Bacteria | 5561 |
| 462 | Ga0500643_008562 | 3300053087 | Bacteria | 4011 |
| 463 | Ga0500643_041617 | 3300053087 | Bacteria | 1348 |
| 464 | Ga0500644_0000037 | 3300053088 | Bacteria | 80217 |
| 465 | Ga0500647_0102980 | 3300053091 | Bacteria | 1362 |
| 466 | Ga0500566_0012647 | 3300053094 | Bacteria | 4966 |
| 467 | Ga0500641_0005016 | 3300053096 | Bacteria | 4694 |
| 468 | Ga0500641_0033204 | 3300053096 | Bacteria | 2047 |
| 469 | Ga0500556_0001589 | 3300053104 | Bacteria | 9084 |
| 470 | Ga0500556_0018139 | 3300053104 | Bacteria | 2216 |
| 471 | Ga0500556_0076320 | 3300053104 | Bacteria | 1260 |
| 472 | Ga0500562_002621 | 3300053108 | Bacteria | 4476 |
| 473 | Ga0500562_006226 | 3300053108 | Bacteria | 3011 |
| 474 | Ga0500562_007092 | 3300053108 | Bacteria | 2827 |
| 475 | Ga0500562_033260 | 3300053108 | Bacteria | 1362 |
| 476 | Ga0500572_000763 | 3300053111 | Bacteria | 10328 |
| 477 | Ga0500572_069024 | 3300053111 | Bacteria | 1089 |
| 478 | Ga0500594_0000422 | 3300053118 | Bacteria | 9406 |
| 479 | Ga0500595_001465 | 3300053119 | Bacteria | 12587 |
| 480 | Ga0500595_002355 | 3300053119 | Bacteria | 9446 |
| 481 | Ga0500595_017715 | 3300053119 | Bacteria | 2622 |
| 482 | Ga0500595_141140 | 3300053119 | Bacteria | 675 |
| 483 | Ga0500607_108023 | 3300053121 | Bacteria | 1369 |
| 484 | Ga0500608_000007 | 3300053122 | Bacteria | 100296 |
| 485 | Ga0500608_001035 | 3300053122 | Bacteria | 9967 |
| 486 | Ga0500608_043862 | 3300053122 | Bacteria | 2147 |
| 487 | Ga0500614_002506 | 3300053123 | Bacteria | 4080 |
| 488 | Ga0500655_021135 | 3300053133 | Bacteria | 1219 |
| 489 | Ga0500655_033234 | 3300053133 | Bacteria | 998 |
| 490 | Ga0500658_0023138 | 3300053134 | Bacteria | 2370 |
| 491 | Ga0500559_0007905 | 3300053136 | Bacteria | 4689 |
| 492 | Ga0500559_0094655 | 3300053136 | Bacteria | 1371 |
| 493 | Ga0500559_0106168 | 3300053136 | Bacteria | 1298 |
| 494 | Ga0500564_000009 | 3300053138 | Bacteria | 60470 |
| 495 | Ga0500568_0214608 | 3300053139 | Bacteria | 703 |
| 496 | Ga0500590_024734 | 3300053148 | Bacteria | 3117 |
| 497 | Ga0500590_031802 | 3300053148 | Bacteria | 2736 |
| 498 | Ga0500616_0056284 | 3300053153 | Bacteria | 2053 |
| 499 | Ga0500616_0082029 | 3300053153 | Bacteria | 1618 |
| 500 | Ga0500616_0090439 | 3300053153 | Bacteria | 1517 |
| 501 | Ga0500619_045480 | 3300053154 | Bacteria | 1404 |
| 502 | Ga0500620_161169 | 3300053155 | Bacteria | 778 |
| 503 | Ga0500622_0000234 | 3300053156 | Bacteria | 57602 |
| 504 | Ga0500622_0010533 | 3300053156 | Bacteria | 5071 |
| 505 | Ga0500639_229291 | 3300053163 | Bacteria | 766 |
| 506 | Ga0500636_0040609 | 3300053177 | Bacteria | 2751 |
| 507 | Ga0500636_0115677 | 3300053177 | Bacteria | 1510 |
| 508 | Ga0500636_0354114 | 3300053177 | Bacteria | 699 |
| 509 | Ga0500637_0017588 | 3300053178 | Bacteria | 3830 |
| 510 | Ga0500637_0075175 | 3300053178 | Bacteria | 1946 |
| 511 | Ga0500576_099193 | 3300053725 | Bacteria | 1192 |
| 512 | Ga0500611_005677 | 3300053727 | Bacteria | 1771 |
| 513 | Ga0500645_001725 | 3300053730 | Bacteria | 10611 |
| 514 | Ga0500645_002985 | 3300053730 | Bacteria | 7167 |
| 515 | Ga0500645_008934 | 3300053730 | Bacteria | 3389 |
| 516 | Ga0500645_040527 | 3300053730 | Bacteria | 1377 |
| 517 | Ga0500552_017582 | 3300053733 | Bacteria | 981 |
| 518 | Ga0500596_001181 | 3300053735 | Bacteria | 5267 |
| 519 | Ga0501082_0373939 | 3300060353 | Bacteria | 1243 |
| 520 | 2585146975 | 2582581279 | Bacteria | 4980720 |
| 521 | 2587919362 | 2585428106 | Bacteria | 5179711 |
| 522 | 2644000633 | 2643221598 | Bacteria | 4578346 |
| 523 | 2644088540 | 2643221614 | Bacteria | 4260023 |
| 524 | 2644225191 | 2643221640 | Bacteria | 5258820 |
| 525 | 2644232499 | 2643221642 | Bacteria | 5357871 |
| 526 | 2644343776 | 2643221661 | Bacteria | 4267604 |
| 527 | 2644368746 | 2643221666 | Bacteria | 4265935 |
| 528 | 2739793535 | 2739367756 | Bacteria | 4553612 |
| 529 | 2792460209 | 2791355048 | Bacteria | 5832535 |
| 530 | 2843746779 | 2843744320 | Bacteria | 5659202 |
| 531 | 2849560856 | 2849560528 | Bacteria | 5393480 |
| 532 | 2849576712 | 2849573788 | Bacteria | 5421256 |
| 533 | 2851154061 | 2851153111 | Bacteria | 5542585 |
| 534 | 2884965199 | 2884960567 | Bacteria | 5437054 |
| 535 | 2898333327 | 2898329390 | Bacteria | 5168154 |
| 536 | Ga0157373_10000483 | |||
| 537 | JGI25153J46596_10082870 | |||
| 538 | rootH1_10010331 | |||
| 539 | rootL2_10104603 | |||
| 540 | Ga0055536_1000271 | |||
| 541 | Ga0055536_1000307 | |||
| 542 | Ga0055530_10000026 | |||
| 543 | Ga0055530_10016026 | |||
| 544 | Ga0055540_1034941 | |||
| 545 | Ga0055531_10000899 | |||
| 546 | Ga0055531_10001385 | |||
| 547 | Ga0055531_10002897 | |||
| 548 | Ga0055531_10036234 | |||
| 549 | Ga0055531_10045156 | |||
| 550 | Ga0065165_1001058 | |||
| 551 | Ga0070670_100019351 | |||
| 552 | Ga0070670_101095779 | |||
| 553 | Ga0070666_10004481 | |||
| 554 | Ga0070666_10316287 | |||
| 555 | Ga0070680_100090930 | |||
| 556 | Ga0070680_100116049 | |||
| 557 | Ga0070660_100025252 | |||
| 558 | Ga0070660_100038099 | |||
| 559 | Ga0070691_10148878 | |||
| 560 | Ga0070668_100000733 | |||
| 561 | Ga0070668_100001360 | |||
| 562 | Ga0070668_100003875 | |||
| 563 | Ga0070668_100022966 | |||
| 564 | Ga0070668_100052603 | |||
| 565 | Ga0070669_100014242 | |||
| 566 | Ga0070669_100339889 | |||
| 567 | Ga0070669_101093842 | |||
| 568 | Ga0070671_100001866 | |||
| 569 | Ga0070671_100115923 | |||
| 570 | Ga0070671_100430173 | |||
| 571 | Ga0070671_100462822 | |||
| 572 | Ga0070659_100000143 | |||
| 573 | Ga0070659_100005171 | |||
| 574 | Ga0070659_100033290 | |||
| 575 | Ga0070667_100000146 | |||
| 576 | Ga0070667_100007034 | |||
| 577 | Ga0070667_100008886 | |||
| 578 | Ga0070667_100020951 | |||
| 579 | Ga0070663_100416060 | |||
| 580 | Ga0070681_10019225 | |||
| 581 | Ga0070681_10056881 | |||
| 582 | Ga0070681_10371719 | |||
| 583 | Ga0070685_10011937 | |||
| 584 | Ga0070679_100142727 | |||
| 585 | Ga0070679_100243060 | |||
| 586 | Ga0068853_100010326 | |||
| 587 | Ga0068853_100178453 | |||
| 588 | Ga0070665_100000144 | |||
| 589 | Ga0070665_100001180 | |||
| 590 | Ga0070665_100002958 | |||
| 591 | Ga0070665_100020082 | |||
| 592 | Ga0068855_100035613 | |||
| 593 | Ga0068855_100044018 | |||
| 594 | Ga0068855_100094249 | |||
| 595 | Ga0070664_100034800 | |||
| 596 | Ga0070664_100491603 | |||
| 597 | Ga0070664_100578948 | |||
| 598 | Ga0068857_100719809 | |||
| 599 | Ga0068854_100634187 | |||
| 600 | Ga0068856_100532527 | |||
| 601 | Ga0068856_100836017 | |||
| 602 | Ga0068856_100928254 | |||
| 603 | Ga0068852_101047648 | |||
| 604 | Ga0068859_100000437 | |||
| 605 | Ga0068859_100006364 | |||
| 606 | Ga0068859_100374165 | |||
| 607 | Ga0068859_100604081 | |||
| 608 | Ga0068864_100000313 | |||
| 609 | Ga0068864_100000503 | |||
| 610 | Ga0068864_100054401 | |||
| 611 | Ga0068864_100078305 | |||
| 612 | Ga0068864_100117042 | |||
| 613 | Ga0068864_100824166 | |||
| 614 | Ga0068864_101287707 | |||
| 615 | Ga0068861_100271154 | |||
| 616 | Ga0068863_100000158 | |||
| 617 | Ga0068863_100000253 | |||
| 618 | Ga0068863_100002531 | |||
| 619 | Ga0068863_100018754 | |||
| 620 | Ga0068863_100023756 | |||
| 621 | Ga0068863_100093271 | |||
| 622 | Ga0068863_100288099 | |||
| 623 | Ga0068858_100000746 | |||
| 624 | Ga0068858_100003737 | |||
| 625 | Ga0068858_100028444 | |||
| 626 | Ga0068858_100277338 | |||
| 627 | Ga0068860_100000234 | |||
| 628 | Ga0068860_100000308 | |||
| 629 | Ga0068860_100005340 | |||
| 630 | Ga0068860_100032620 | |||
| 631 | Ga0068860_101566425 | |||
| 632 | Ga0068862_100000129 | |||
| 633 | Ga0068862_100003825 | |||
| 634 | Ga0068862_100209629 | |||
| 635 | Ga0070717_11186826 | |||
| 636 | Ga0075365_10412176 | |||
| 637 | Ga0075363_100063502 | |||
| 638 | Ga0075364_10000411 | |||
| 639 | Ga0075367_10037498 | |||
| 640 | Ga0075369_10013650 | |||
| 641 | Ga0075369_10050924 | |||
| 642 | Ga0075366_10146406 | |||
| 643 | Ga0097621_100951954 | |||
| 644 | Ga0075370_10058310 | |||
| 645 | Ga0075370_10397428 | |||
| 646 | Ga0068871_100722356 | |||
| 647 | Ga0068865_100034685 | |||
| 648 | Ga0097620_100000437 | |||
| 649 | Ga0097620_100006364 | |||
| 650 | Ga0097620_100374163 | |||
| 651 | Ga0097620_100604029 | |||
| 652 | Ga0079104_1015810 | |||
| 653 | Ga0105240_10022612 | |||
| 654 | Ga0105240_10071568 | |||
| 655 | Ga0105240_10102063 | |||
| 656 | Ga0105240_11564385 | |||
| 657 | Ga0105247_10258579 | |||
| 658 | Ga0105248_10000489 | |||
| 659 | Ga0105248_10011458 | |||
| 660 | Ga0105248_10036925 | |||
| 661 | Ga0105248_10046013 | |||
| 662 | Ga0105248_10065826 | |||
| 663 | Ga0105248_10368099 | |||
| 664 | Ga0105237_10346428 | |||
| 665 | Ga0105238_10033188 | |||
| 666 | Ga0105238_10039857 | |||
| 667 | Ga0105238_10248466 | |||
| 668 | Ga0105238_10290071 | |||
| 669 | Ga0105238_10887696 | |||
| 670 | Ga0105238_11545175 | |||
| 671 | Ga0105249_10009776 | |||
| 672 | Ga0105249_10102394 | |||
| 673 | Ga0105249_10157395 | |||
| 674 | Ga0105249_10674899 | |||
| 675 | Ga0105239_10070776 | |||
| 676 | Ga0105239_10436328 | |||
| 677 | Ga0105239_10474680 | |||
| 678 | Ga0157373_10000482 | |||
| 679 | Ga0157370_10249794 | |||
| 680 | Ga0157369_10499209 | |||
| 681 | Ga0157374_10234511 | |||
| 682 | Ga0163162_10240161 | |||
| 683 | Ga0163162_10267262 | |||
| 684 | Ga0157372_10477738 | |||
| 685 | Ga0157375_10036236 | |||
| 686 | Ga0163163_10026201 | |||
| 687 | Ga0163163_10071631 | |||
| 688 | Ga0163163_10156347 | |||
| 689 | Ga0163163_10188185 | |||
| 690 | Ga0163163_10277552 | |||
| 691 | Ga0163163_10534393 | |||
| 692 | Ga0157380_10182384 | |||
| 693 | Ga0157377_10312658 | |||
| 694 | Ga0157379_10000967 | |||
| 695 | Ga0157379_10068713 | |||
| 696 | Ga0157379_10101168 | |||
| 697 | Ga0213876_10101676 | |||
| 698 | Ga0213875_10191657 | |||
| 699 | Ga0209026_1032207 | |||
| 700 | Ga0209026_1040267 | |||
| 701 | Ga0209148_1004982 | |||
| 702 | Ga0209676_1000224 | |||
| 703 | Ga0209676_1000422 | |||
| 704 | Ga0209758_1002891 | |||
| 705 | Ga0209050_1000029 | |||
| 706 | Ga0209050_1000463 | |||
| 707 | Ga0209050_1001193 | |||
| 708 | Ga0209050_1001204 | |||
| 709 | Ga0209256_1010255 | |||
| 710 | Ga0209051_1008867 | |||
| 711 | Ga0209257_1000152 | |||
| 712 | Ga0209257_1000512 | |||
| 713 | Ga0209257_1001271 | |||
| 714 | Ga0209257_1026554 | |||
| 715 | Ga0207710_10133530 | |||
| 716 | Ga0207680_10003990 | |||
| 717 | Ga0207680_10072151 | |||
| 718 | Ga0207680_10104166 | |||
| 719 | Ga0207705_10010119 | |||
| 720 | Ga0207705_10134293 | |||
| 721 | Ga0207654_10026762 | |||
| 722 | Ga0207707_10021262 | |||
| 723 | Ga0207707_10197451 | |||
| 724 | Ga0207695_10001763 | |||
| 725 | Ga0207695_10005400 | |||
| 726 | Ga0207695_10010025 | |||
| 727 | Ga0207695_10091696 | |||
| 728 | Ga0207695_10448088 | |||
| 729 | Ga0207695_10453311 | |||
| 730 | Ga0207695_11059629 | |||
| 731 | Ga0207660_10065045 | |||
| 732 | Ga0207660_10077752 | |||
| 733 | Ga0207657_10010954 | |||
| 734 | Ga0207657_10048620 | |||
| 735 | Ga0207657_10584929 | |||
| 736 | Ga0207649_10895664 | |||
| 737 | Ga0207652_10049193 | |||
| 738 | Ga0207681_10019464 | |||
| 739 | Ga0207681_10317829 | |||
| 740 | Ga0207681_10961036 | |||
| 741 | Ga0207694_10013384 | |||
| 742 | Ga0207694_10037272 | |||
| 743 | Ga0207694_10131137 | |||
| 744 | Ga0207694_10173450 | |||
| 745 | Ga0207694_10196787 | |||
| 746 | Ga0207694_10781388 | |||
| 747 | Ga0207694_10895722 | |||
| 748 | Ga0207650_10000064 | |||
| 749 | Ga0207650_10011859 | |||
| 750 | Ga0207650_10012174 | |||
| 751 | Ga0207650_10432680 | |||
| 752 | Ga0207650_10603840 | |||
| 753 | Ga0207687_10109059 | |||
| 754 | Ga0207644_10001126 | |||
| 755 | Ga0207644_10044081 | |||
| 756 | Ga0207644_10047989 | |||
| 757 | Ga0207644_10904597 | |||
| 758 | Ga0207644_10921842 | |||
| 759 | Ga0207690_10010748 | |||
| 760 | Ga0207690_10060693 | |||
| 761 | Ga0207690_10120154 | |||
| 762 | Ga0207706_10502381 | |||
| 763 | Ga0207704_10002245 | |||
| 764 | Ga0207704_11061664 | |||
| 765 | Ga0207711_10001700 | |||
| 766 | Ga0207711_10002832 | |||
| 767 | Ga0207711_10004706 | |||
| 768 | Ga0207711_10035666 | |||
| 769 | Ga0207711_10047787 | |||
| 770 | Ga0207711_10548793 | |||
| 771 | Ga0207679_10001519 | |||
| 772 | Ga0207679_10526318 | |||
| 773 | Ga0207667_10021083 | |||
| 774 | Ga0207667_10024032 | |||
| 775 | Ga0207667_10024243 | |||
| 776 | Ga0207667_10048194 | |||
| 777 | Ga0207667_10112218 | |||
| 778 | Ga0207667_10265930 | |||
| 779 | Ga0207667_10789991 | |||
| 780 | Ga0207651_10035437 | |||
| 781 | Ga0207712_10002582 | |||
| 782 | Ga0207712_10123258 | |||
| 783 | Ga0207668_10000154 | |||
| 784 | Ga0207668_10000379 | |||
| 785 | Ga0207668_10024993 | |||
| 786 | Ga0207668_10067921 | |||
| 787 | Ga0207668_10306512 | |||
| 788 | Ga0207640_10533573 | |||
| 789 | Ga0207640_10533705 | |||
| 790 | Ga0207658_10001071 | |||
| 791 | Ga0207658_10002901 | |||
| 792 | Ga0207658_10009216 | |||
| 793 | Ga0207658_10559439 | |||
| 794 | Ga0207703_10000598 | |||
| 795 | Ga0207703_10008480 | |||
| 796 | Ga0207703_10022519 | |||
| 797 | Ga0207703_10040750 | |||
| 798 | Ga0207703_10363726 | |||
| 799 | Ga0207639_10007364 | |||
| 800 | Ga0207639_10107998 | |||
| 801 | Ga0207639_10535913 | |||
| 802 | Ga0207639_11029634 | |||
| 803 | Ga0207678_10414111 | |||
| 804 | Ga0207702_10438312 | |||
| 805 | Ga0207702_10656129 | |||
| 806 | Ga0207641_10000634 | |||
| 807 | Ga0207641_10000687 | |||
| 808 | Ga0207641_10013816 | |||
| 809 | Ga0207641_10031521 | |||
| 810 | Ga0207641_10089677 | |||
| 811 | Ga0207641_10411472 | |||
| 812 | Ga0207676_10000131 | |||
| 813 | Ga0207676_10001356 | |||
| 814 | Ga0207676_10016556 | |||
| 815 | Ga0207676_10317426 | |||
| 816 | Ga0207675_100250571 | |||
| 817 | Ga0207683_10519105 | |||
| 818 | Ga0207698_11315540 | |||
| 819 | Ga0209281_1020179 | |||
| 820 | Ga0209999_1005526 | |||
| 821 | Ga0209983_1006282 | |||
| 822 | Ga0209813_10021188 | |||
| 823 | Ga0268266_10000003 | |||
| 824 | Ga0268266_10000812 | |||
| 825 | Ga0268266_10010701 | |||
| 826 | Ga0268266_10021721 | |||
| 827 | Ga0268265_10005471 | |||
| 828 | Ga0268265_10007810 | |||
| 829 | Ga0268265_10010074 | |||
| 830 | Ga0268265_10019747 | |||
| 831 | Ga0268264_10000008 | |||
| 832 | Ga0268264_10000360 | |||
| 833 | Ga0268264_10009444 | |||
| 834 | Ga0268264_10027358 | |||
| 835 | Ga0268264_11115257 | |||
| 836 | Ga0307517_10001670 | |||
| 837 | Ga0307517_10319785 | |||
| 838 | Ga0307515_10080529 | |||
| 839 | Ga0307511_10081846 | |||
| 840 | Ga0265320_10040362 | |||
| 841 | Ga0265327_10001234 | |||
| 842 | Ga0265327_10001963 | |||
| 843 | Ga0307513_10002302 | |||
| 844 | Ga0307513_10004456 | |||
| 845 | Ga0307513_10008813 | |||
| 846 | Ga0307513_10013285 | |||
| 847 | Ga0307408_100326063 | |||
| 848 | Ga0307408_100524683 | |||
| 849 | Ga0307508_10186371 | |||
| 850 | Ga0307516_10000002 | |||
| 851 | Ga0307405_11196128 | |||
| 852 | Ga0307412_11129131 | |||
| 853 | Ga0307409_101297984 | |||
| 854 | Ga0307510_10024786 | |||
| 855 | Ga0307510_10099020 | |||
| 856 | Ga0307510_10293312 | |||
| 857 | Ga0373944_0018453 | |||
| 858 | Ga0373936_0000516 | |||
| 859 | Ga0373935_0009585 | |||
| 860 | Ga0373927_0000155 | |||
| 861 | Ga0373925_0000032 | |||
| 862 | Ga0395899_0000018 | |||
| 863 | Ga0395899_0455146 | |||
| 864 | Ga0395900_0297431 | |||
| 865 | Ga0395898_0167800 | |||
| 866 | Ga0395898_0181550 | |||
| 867 | Ga0395905_0039392 | |||
| 868 | Ga0395905_0114341 | |||
| 869 | Ga0395905_0191014 | |||
| 870 | Ga0395905_0511372 | |||
| 871 | Ga0395905_0534517 | |||
| 872 | Ga0395905_0947091 | |||
| 873 | Ga0436364_0492243 | |||
| 874 | Ga0395901_0479689 | |||
| 875 | Ga0395901_0917891 | |||
| 876 | Ga0436365_1003114 | |||
| 877 | Ga0436365_1903966 | |||
| 878 | Ga0436360_0825270 | |||
| 879 | Ga0451849_1285073 | |||
| 880 | Ga0466969_0098025 | |||
| 881 | Ga0466965_0186397 | |||
| 882 | Ga0466966_0048377 | |||
| 883 | Ga0453684_0284929 | |||
| 884 | Ga0466967_1004503 | |||
| 885 | Ga0495638_0000387 | |||
| 886 | Ga0495650_0053984 | |||
| 887 | Ga0495639_0087693 | |||
| 888 | Ga0495585_0073113 | |||
| 889 | Ga0495585_0346020 | |||
| 890 | Ga0495606_0084795 | |||
| 891 | Ga0495606_0387029 | |||
| 892 | Ga0495610_0008207 | |||
| 893 | Ga0495628_0567309 | |||
| 894 | Ga0495631_0024702 | |||
| 895 | Ga0495637_0053805 | |||
| 896 | Ga0495643_0037753 | |||
| 897 | Ga0495648_0000130 | |||
| 898 | Ga0495642_0008312 | |||
| 899 | Ga0495642_0050744 | |||
| 900 | Ga0495642_0058164 | |||
| 901 | Ga0495642_0146935 | |||
| 902 | Ga0495654_0058620 | |||
| 903 | Ga0495665_0118504 | |||
| 904 | Ga0495609_0029574 | |||
| 905 | Ga0495597_0011104 | |||
| 906 | Ga0495645_0182157 | |||
| 907 | Ga0495622_0001260 | |||
| 908 | Ga0495633_0385759 | |||
| 909 | Ga0495668_0000060 | |||
| 910 | Ga0495668_0006917 | |||
| 911 | Ga0495668_0009979 | |||
| 912 | Ga0495668_0057638 | |||
| 913 | Ga0495668_0058492 | |||
| 914 | Ga0495668_0118677 | |||
| 915 | Ga0495668_0121672 | |||
| 916 | Ga0495668_0519649 | |||
| 917 | Ga0495611_0052845 | |||
| 918 | Ga0495625_0115670 | |||
| 919 | Ga0495625_0277026 | |||
| 920 | Ga0495625_0284918 | |||
| 921 | Ga0495669_0000020 | |||
| 922 | Ga0495669_0000449 | |||
| 923 | Ga0495669_0365580 | |||
| 924 | Ga0495581_0259614 | |||
| 925 | Ga0495636_0022590 | |||
| 926 | Ga0495672_0094555 | |||
| 927 | Ga0495672_0178016 | |||
| 928 | Ga0495677_0101930 | |||
| 929 | Ga0495673_0000397 | |||
| 930 | Ga0495686_0003413 | |||
| 931 | Ga0495686_0006846 | |||
| 932 | Ga0495686_0022922 | |||
| 933 | Ga0495686_0027185 | |||
| 934 | Ga0495593_0048021 | |||
| 935 | Ga0495602_1030366 | |||
| 936 | Ga0496101_0677998 | |||
| 937 | Ga0496101_0755736 | |||
| 938 | Ga0496102_0127445 | |||
| 939 | Ga0496102_0736931 | |||
| 940 | Ga0496104_0300365 | |||
| 941 | Ga0496105_0416605 | |||
| 942 | Ga0496106_0194821 | |||
| 943 | Ga0496107_0202677 | |||
| 944 | Ga0496108_0457796 | |||
| 945 | Ga0496109_0008454 | |||
| 946 | Ga0496110_0063516 | |||
| 947 | Ga0496111_0356062 | |||
| 948 | Ga0496112_0096047 | |||
| 949 | Ga0496112_0404157 | |||
| 950 | Ga0496112_0566275 | |||
| 951 | Ga0496113_0129757 | |||
| 952 | Ga0496115_0001272 | |||
| 953 | Ga0496115_0001892 | |||
| 954 | Ga0496115_0049114 | |||
| 955 | Ga0496115_0112706 | |||
| 956 | Ga0496116_0145196 | |||
| 957 | Ga0496118_0006963 | |||
| 958 | Ga0496119_0024095 | |||
| 959 | Ga0496121_0000059 | |||
| 960 | Ga0496121_0459648 | |||
| 961 | Ga0496124_0031509 | |||
| 962 | Ga0496125_0054108 | |||
| 963 | Ga0496126_0002857 | |||
| 964 | Ga0495678_010667 | |||
| 965 | Ga0501032_0123187 | |||
| 966 | Ga0501034_0111449 | |||
| 967 | Ga0501038_0669470 | |||
| 968 | Ga0501038_1099885 | |||
| 969 | Ga0501041_0420412 | |||
| 970 | Ga0501043_0649516 | |||
| 971 | Ga0501043_0829225 | |||
| 972 | Ga0501047_0011838 | |||
| 973 | Ga0501047_0110346 | |||
| 974 | Ga0501047_1123564 | |||
| 975 | Ga0501073_0417036 | |||
| 976 | Ga0501035_0222185 | |||
| 977 | Ga0501035_0290560 | |||
| 978 | Ga0501035_1064125 | |||
| 979 | Ga0501044_0007104 | |||
| 980 | Ga0501044_0406252 | |||
| 981 | nmdc:mga00v17_528_c1 | |||
| 982 | nmdc:mga0k408_153012_c1 | |||
| 983 | nmdc:mga0k408_172319_c1 | |||
| 984 | nmdc:mga0k408_40701_c1 | |||
| 985 | nmdc:mga04h51_94948_c1 | |||
| 986 | nmdc:mga07m45_23460_c1 | |||
| 987 | nmdc:mga07m45_326376_c1 | |||
| 988 | nmdc:mga07m45_365970_c1 | |||
| 989 | nmdc:mga07m45_7027_c1 | |||
| 990 | nmdc:mga0sz30_14908_c1 | |||
| 991 | nmdc:mga0sz30_40080_c1 | |||
| 992 | Ga0500635_0000231 | |||
| 993 | Ga0500578_0000377 | |||
| 994 | Ga0500578_0308811 | |||
| 995 | Ga0500643_001547 | |||
| 996 | Ga0500643_005330 | |||
| 997 | Ga0500643_008562 | |||
| 998 | Ga0500643_041617 | |||
| 999 | Ga0500644_0000037 | |||
| 1000 | Ga0500647_0102980 | |||
| 1001 | Ga0500566_0012647 | |||
| 1002 | Ga0500641_0005016 | |||
| 1003 | Ga0500641_0033204 | |||
| 1004 | Ga0500556_0001589 | |||
| 1005 | Ga0500556_0018139 | |||
| 1006 | Ga0500556_0076320 | |||
| 1007 | Ga0500562_002621 | |||
| 1008 | Ga0500562_006226 | |||
| 1009 | Ga0500562_007092 | |||
| 1010 | Ga0500562_033260 | |||
| 1011 | Ga0500572_000763 | |||
| 1012 | Ga0500572_069024 | |||
| 1013 | Ga0500594_0000422 | |||
| 1014 | Ga0500595_001465 | |||
| 1015 | Ga0500595_002355 | |||
| 1016 | Ga0500595_017715 | |||
| 1017 | Ga0500595_141140 | |||
| 1018 | Ga0500607_108023 | |||
| 1019 | Ga0500608_000007 | |||
| 1020 | Ga0500608_001035 | |||
| 1021 | Ga0500608_043862 | |||
| 1022 | Ga0500614_002506 | |||
| 1023 | Ga0500655_021135 | |||
| 1024 | Ga0500655_033234 | |||
| 1025 | Ga0500658_0023138 | |||
| 1026 | Ga0500559_0007905 | |||
| 1027 | Ga0500559_0094655 | |||
| 1028 | Ga0500559_0106168 | |||
| 1029 | Ga0500564_000009 | |||
| 1030 | Ga0500568_0214608 | |||
| 1031 | Ga0500590_024734 | |||
| 1032 | Ga0500590_031802 | |||
| 1033 | Ga0500616_0056284 | |||
| 1034 | Ga0500616_0082029 | |||
| 1035 | Ga0500616_0090439 | |||
| 1036 | Ga0500619_045480 | |||
| 1037 | Ga0500620_161169 | |||
| 1038 | Ga0500622_0000234 | |||
| 1039 | Ga0500622_0010533 | |||
| 1040 | Ga0500639_229291 | |||
| 1041 | Ga0500636_0040609 | |||
| 1042 | Ga0500636_0115677 | |||
| 1043 | Ga0500636_0354114 | |||
| 1044 | Ga0500637_0017588 | |||
| 1045 | Ga0500637_0075175 | |||
| 1046 | Ga0500576_099193 | |||
| 1047 | Ga0500611_005677 | |||
| 1048 | Ga0500645_001725 | |||
| 1049 | Ga0500645_002985 | |||
| 1050 | Ga0500645_008934 | |||
| 1051 | Ga0500645_040527 | |||
| 1052 | Ga0500552_017582 | |||
| 1053 | Ga0500596_001181 | |||
| 1054 | Ga0501082_0373939 | |||
| 1055 | 2585146975 | |||
| 1056 | 2587919362 | |||
| 1057 | 2644000633 | |||
| 1058 | 2644088540 | |||
| 1059 | 2644225191 | |||
| 1060 | 2644232499 | |||
| 1061 | 2644343776 | |||
| 1062 | 2644368746 | |||
| 1063 | 2739793535 | |||
| 1064 | 2792460209 | |||
| 1065 | 2843746779 | |||
| 1066 | 2849560856 | |||
| 1067 | 2849576712 | |||
| 1068 | 2851154061 | |||
| 1069 | 2884965199 | |||
| 1070 | 2898333327 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qri-assembly1.cif.gz_A | 2.35 angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130 | 0.9436 | 6 | 174 |
| 4qri-assembly1.cif.gz_B | 2.35 angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130 | 0.9407 | 6 | 174 |
| 3ohp-assembly1.cif.gz_D | crystal structure of hgprt from vibrio cholerae | 0.9391 | 6 | 174 |
| 4rht-assembly3.cif.gz_D | crystal structures of mycobacterium tuberculosis 6-oxopurine phosphoribosyltransferase which is a potential target for drug development against this disease | 0.9373 | 8 | 176 |
| 4rqa-assembly1.cif.gz_A | crystal structure of a hypoxanthine phosphoribosyltransferase (target id nysgrc-029686) from staphylococcus aureus (orthorhombic space group) | 0.9357 | 9 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qriB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9407 | 6 | 174 | 3.40.50.2020 |
| 4rhtD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9373 | 8 | 176 | 3.40.50.2020 |
| 4rhtD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9098 | 8 | 176 | 3.40.50.2020 |
| af_P0A717_198_307_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9094 | 86 | 132 | 3.40.50.2020 |
| 4qriB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8997 | 6 | 174 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258FHE4-F1-model_v4 | Hypoxanthine phosphoribosyltransferase | 0.9816 | 5 | 176 |
GO:0000166
GO:0000287 GO:0004422 GO:0005829 GO:0006178 GO:0032263 GO:0032264 GO:0046100 |
| AF-A0A3B9EGX0-F1-model_v4 | Hypoxanthine phosphoribosyltransferase | 0.9658 | 47 | 176 |
GO:0000166
GO:0000287 GO:0004422 GO:0005829 GO:0006178 GO:0032263 GO:0032264 GO:0046100 |
| AF-B0T2U1-F1-model_v4 | Phosphoribosyltransferase | 0.9636 | 1 | 176 |
GO:0000166
GO:0000287 GO:0004422 GO:0005829 GO:0006178 GO:0032263 GO:0032264 GO:0046100 |
| AF-A0A2E3ERH6-F1-model_v4 | Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) | 0.9631 | 6 | 174 |
GO:0000166
GO:0000287 GO:0004422 GO:0005829 GO:0006166 GO:0006178 GO:0032263 GO:0032264 GO:0046100 GO:0052657 |
| AF-A0A162JLN3-F1-model_v4 | Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) | 0.9612 | 6 | 176 |
GO:0000166
GO:0000287 GO:0004422 GO:0005829 GO:0006166 GO:0006178 GO:0032263 GO:0032264 GO:0046100 GO:0052657 |