F460659
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 535 | 335 | 505 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300013296|Ga0157374_10506044|Ga0157374_105060441 |
| Length | 270 |
| Sequence | VPHGENGLLRRFAPRHDERGNEEKKIMSDRLRGKRAFVTAAAVGIGRACAVAFAREGATVFATDIDEAKLAALKSEGIAEVARLDARDSAAVAAMAKRAGQTDILLNAAGFVHHGTVLDCSDEDFDFSFDLNVKSMHRTIRSFLPGMLENGRGSIVNIASAAGVFKAAPNRYVYGATKAAVAALTRSVATDFITRGVRCNCICPGTIETPSMLERAAAAGPNGREMFIARQPMGRLGTAEEIASLAVYLASDESAFTTGVAHVIDGGWTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 2 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 3 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 4 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 5 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 6 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 7 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 8 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 9 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 10 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 11 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 12 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 13 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 14 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 15 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 16 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 17 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 18 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 19 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 20 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 21 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 22 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 23 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 24 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 25 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 26 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 27 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 114 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 165 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 167 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 168 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 173 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 191 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 192 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 193 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 194 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 195 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 196 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 197 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 198 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 247 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 251 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 252 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 253 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 254 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 255 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 256 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 257 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 258 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 259 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 260 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 261 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 262 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 263 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 264 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 265 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 266 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 275 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 276 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 277 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 278 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 279 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 280 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 283 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 285 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 286 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 288 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 289 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 290 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 291 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 292 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 293 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 294 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 295 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 296 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 297 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 298 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 299 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 300 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 301 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 302 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 303 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 304 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 305 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 306 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 307 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 308 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 309 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 310 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 312 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 313 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 314 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 315 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 317 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 318 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 319 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 320 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 321 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 322 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 323 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 324 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 325 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 326 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 327 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 329 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 330 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 331 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 332 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 333 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 334 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 335 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.19 |
| Metatranscriptomes | 0.37 |
| Isolates | 5.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.5 |
| Nodule | 2.8 |
| Rhizoplane | 7.66 |
| Rhizosphere | 56.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1001367 | 3300002987 | Bacteria | 10181 |
| 2 | JGI25160J50197_1000034 | 3300003354 | Bacteria | 169670 |
| 3 | JGI25161J50226_1000019 | 3300003374 | Bacteria | 169670 |
| 4 | Ga0055543_1000018 | 3300004625 | Bacteria | 169708 |
| 5 | Ga0065165_1000121 | 3300005262 | Bacteria | 134128 |
| 6 | Ga0070658_10042588 | 3300005327 | Bacteria | 3668 |
| 7 | Ga0070683_100718298 | 3300005329 | Bacteria | 957 |
| 8 | Ga0070690_100040624 | 3300005330 | Bacteria | 2942 |
| 9 | Ga0070690_100143648 | 3300005330 | Bacteria | 1622 |
| 10 | Ga0068869_100131609 | 3300005334 | Bacteria | 1923 |
| 11 | Ga0068869_100641479 | 3300005334 | Bacteria | 901 |
| 12 | Ga0070680_100080116 | 3300005336 | Bacteria | 2693 |
| 13 | Ga0070682_100225490 | 3300005337 | Bacteria | 1337 |
| 14 | Ga0070682_100262890 | 3300005337 | Bacteria | 1250 |
| 15 | Ga0070660_100104431 | 3300005339 | Bacteria | 2248 |
| 16 | Ga0070689_100257795 | 3300005340 | Bacteria | 1441 |
| 17 | Ga0070668_100014095 | 3300005347 | Bacteria | 5976 |
| 18 | Ga0070669_100320831 | 3300005353 | Bacteria | 1251 |
| 19 | Ga0070675_100830450 | 3300005354 | Bacteria | 845 |
| 20 | Ga0070671_100065906 | 3300005355 | Bacteria | 3017 |
| 21 | Ga0070671_100308001 | 3300005355 | Bacteria | 1349 |
| 22 | Ga0070673_100227767 | 3300005364 | Bacteria | 1616 |
| 23 | Ga0070688_100095286 | 3300005365 | Bacteria | 1953 |
| 24 | Ga0070688_100290257 | 3300005365 | Bacteria | 1178 |
| 25 | Ga0070659_100243663 | 3300005366 | Bacteria | 1488 |
| 26 | Ga0070667_100004052 | 3300005367 | Bacteria | 12388 |
| 27 | Ga0070667_100698167 | 3300005367 | Bacteria | 939 |
| 28 | Ga0070710_10093963 | 3300005437 | Bacteria | 1773 |
| 29 | Ga0070663_100027800 | 3300005455 | Bacteria | 3844 |
| 30 | Ga0070663_100071769 | 3300005455 | Bacteria | 2520 |
| 31 | Ga0070678_100074298 | 3300005456 | Bacteria | 2554 |
| 32 | Ga0070662_100073159 | 3300005457 | Bacteria | 2532 |
| 33 | Ga0070681_10068876 | 3300005458 | Bacteria | 3505 |
| 34 | Ga0070685_10517574 | 3300005466 | Bacteria | 847 |
| 35 | Ga0070707_100126270 | 3300005468 | Bacteria | 2486 |
| 36 | Ga0070679_100056914 | 3300005530 | Bacteria | 3896 |
| 37 | Ga0070684_100248713 | 3300005535 | Bacteria | 1625 |
| 38 | Ga0068853_100112046 | 3300005539 | Bacteria | 2425 |
| 39 | Ga0070672_100157897 | 3300005543 | Bacteria | 1879 |
| 40 | Ga0070686_100123250 | 3300005544 | Bacteria | 1782 |
| 41 | Ga0070665_100116587 | 3300005548 | Bacteria | 2673 |
| 42 | Ga0070665_100141873 | 3300005548 | Bacteria | 2405 |
| 43 | Ga0070665_100303901 | 3300005548 | Bacteria | 1598 |
| 44 | Ga0070704_100491987 | 3300005549 | Bacteria | 1063 |
| 45 | Ga0068855_100015651 | 3300005563 | Bacteria | 9126 |
| 46 | Ga0070664_100113945 | 3300005564 | Bacteria | 2362 |
| 47 | Ga0070664_100274215 | 3300005564 | Bacteria | 1520 |
| 48 | Ga0068857_100072314 | 3300005577 | Bacteria | 3073 |
| 49 | Ga0068857_100794332 | 3300005577 | Bacteria | 903 |
| 50 | Ga0068854_100038548 | 3300005578 | Bacteria | 3362 |
| 51 | Ga0068854_100261468 | 3300005578 | Bacteria | 1386 |
| 52 | Ga0068856_100000020 | 3300005614 | Bacteria | 146775 |
| 53 | Ga0068856_100259254 | 3300005614 | Bacteria | 1754 |
| 54 | Ga0068856_100683424 | 3300005614 | Bacteria | 1047 |
| 55 | Ga0068856_100776358 | 3300005614 | Bacteria | 978 |
| 56 | Ga0068852_100010764 | 3300005616 | Bacteria | 6849 |
| 57 | Ga0068852_100039543 | 3300005616 | Bacteria | 3972 |
| 58 | Ga0068852_100310542 | 3300005616 | Bacteria | 1529 |
| 59 | Ga0068859_100139397 | 3300005617 | Bacteria | 2499 |
| 60 | Ga0068859_100153946 | 3300005617 | Bacteria | 2375 |
| 61 | Ga0068864_100039117 | 3300005618 | Bacteria | 4053 |
| 62 | Ga0068858_100077017 | 3300005842 | Bacteria | 3098 |
| 63 | Ga0068858_100229680 | 3300005842 | Bacteria | 1759 |
| 64 | Ga0068860_100406502 | 3300005843 | Bacteria | 1347 |
| 65 | Ga0068862_100302885 | 3300005844 | Bacteria | 1471 |
| 66 | Ga0068862_100428821 | 3300005844 | Bacteria | 1242 |
| 67 | Ga0081455_10006892 | 3300005937 | Bacteria | 12092 |
| 68 | Ga0081455_10009515 | 3300005937 | Bacteria | 9986 |
| 69 | Ga0081540_1010747 | 3300005983 | Bacteria | 6162 |
| 70 | Ga0081540_1026295 | 3300005983 | Bacteria | 3324 |
| 71 | Ga0081539_10000140 | 3300005985 | Bacteria | 166746 |
| 72 | Ga0070717_10013888 | 3300006028 | Bacteria | 6185 |
| 73 | Ga0075365_10125222 | 3300006038 | Bacteria | 1775 |
| 74 | Ga0075368_10074851 | 3300006042 | Bacteria | 1372 |
| 75 | Ga0075363_100018624 | 3300006048 | Bacteria | 3463 |
| 76 | Ga0075363_100033643 | 3300006048 | Bacteria | 2671 |
| 77 | Ga0075363_100065833 | 3300006048 | Bacteria | 1960 |
| 78 | Ga0075364_10290946 | 3300006051 | Bacteria | 1112 |
| 79 | Ga0075364_10414033 | 3300006051 | Bacteria | 920 |
| 80 | Ga0075362_10041023 | 3300006177 | Bacteria | 2039 |
| 81 | Ga0075362_10043018 | 3300006177 | Bacteria | 1999 |
| 82 | Ga0075367_10007260 | 3300006178 | Bacteria | 5664 |
| 83 | Ga0075367_10009081 | 3300006178 | Bacteria | 5178 |
| 84 | Ga0075367_10044514 | 3300006178 | Bacteria | 2602 |
| 85 | Ga0075367_10153925 | 3300006178 | Bacteria | 1428 |
| 86 | Ga0075369_10006421 | 3300006186 | Bacteria | 4442 |
| 87 | Ga0075369_10014572 | 3300006186 | Bacteria | 3144 |
| 88 | Ga0075366_10028470 | 3300006195 | Bacteria | 3279 |
| 89 | Ga0075366_10155224 | 3300006195 | Bacteria | 1386 |
| 90 | Ga0075370_10001906 | 3300006353 | Bacteria | 9384 |
| 91 | Ga0075370_10085208 | 3300006353 | Bacteria | 1819 |
| 92 | Ga0075370_10092005 | 3300006353 | Bacteria | 1750 |
| 93 | Ga0075370_10095033 | 3300006353 | Bacteria | 1721 |
| 94 | Ga0068871_100082771 | 3300006358 | Bacteria | 2661 |
| 95 | Ga0075433_10308092 | 3300006852 | Bacteria | 1402 |
| 96 | Ga0075434_100025857 | 3300006871 | Bacteria | 5746 |
| 97 | Ga0075434_100263368 | 3300006871 | Bacteria | 1743 |
| 98 | Ga0097620_100139389 | 3300006931 | Bacteria | 2499 |
| 99 | Ga0097620_100153959 | 3300006931 | Bacteria | 2375 |
| 100 | Ga0105240_10089792 | 3300009093 | Bacteria | 3757 |
| 101 | Ga0105245_10013893 | 3300009098 | Bacteria | 7013 |
| 102 | Ga0105247_10110377 | 3300009101 | Bacteria | 1770 |
| 103 | Ga0105243_10094312 | 3300009148 | Bacteria | 2471 |
| 104 | Ga0105242_10194426 | 3300009176 | Bacteria | 1798 |
| 105 | Ga0105242_10239148 | 3300009176 | Bacteria | 1631 |
| 106 | Ga0105248_10112704 | 3300009177 | Bacteria | 3067 |
| 107 | Ga0105248_11089428 | 3300009177 | Bacteria | 903 |
| 108 | Ga0105237_10023051 | 3300009545 | Bacteria | 6383 |
| 109 | Ga0105237_10174749 | 3300009545 | Bacteria | 2148 |
| 110 | Ga0105237_10207526 | 3300009545 | Bacteria | 1959 |
| 111 | Ga0105237_10255238 | 3300009545 | Bacteria | 1755 |
| 112 | Ga0105237_10383644 | 3300009545 | Bacteria | 1410 |
| 113 | Ga0105237_10829411 | 3300009545 | Bacteria | 931 |
| 114 | Ga0105238_10023178 | 3300009551 | Bacteria | 6330 |
| 115 | Ga0105238_10055219 | 3300009551 | Bacteria | 3988 |
| 116 | Ga0105238_10452128 | 3300009551 | Bacteria | 1281 |
| 117 | Ga0105239_10021983 | 3300010375 | Bacteria | 7031 |
| 118 | Ga0157370_10034359 | 3300013104 | Bacteria | 4939 |
| 119 | Ga0157370_10107534 | 3300013104 | Bacteria | 2609 |
| 120 | Ga0157369_10026279 | 3300013105 | Bacteria | 6459 |
| 121 | Ga0157369_10031264 | 3300013105 | Bacteria | 5864 |
| 122 | Ga0157374_10506044 | 3300013296 | Bacteria | 1213 |
| 123 | Ga0157378_10017318 | 3300013297 | Bacteria | 6321 |
| 124 | Ga0157378_10513358 | 3300013297 | Bacteria | 1199 |
| 125 | Ga0157378_10526439 | 3300013297 | Bacteria | 1184 |
| 126 | Ga0157378_10962067 | 3300013297 | Bacteria | 887 |
| 127 | Ga0163162_10040586 | 3300013306 | Bacteria | 4654 |
| 128 | Ga0163162_10254813 | 3300013306 | Bacteria | 1887 |
| 129 | Ga0157375_10048477 | 3300013308 | Bacteria | 4156 |
| 130 | Ga0157375_10053711 | 3300013308 | Bacteria | 3965 |
| 131 | Ga0163163_10025783 | 3300014325 | Bacteria | 5608 |
| 132 | Ga0163163_10103078 | 3300014325 | Bacteria | 2878 |
| 133 | Ga0157380_10400053 | 3300014326 | Bacteria | 1303 |
| 134 | Ga0182008_10000949 | 3300014497 | Bacteria | 20195 |
| 135 | Ga0182008_10131686 | 3300014497 | Unclassified | 1247 |
| 136 | Ga0157377_10144508 | 3300014745 | Bacteria | 1465 |
| 137 | Ga0157379_10085510 | 3300014968 | Bacteria | 2827 |
| 138 | Ga0157376_10065491 | 3300014969 | Bacteria | 3069 |
| 139 | Ga0163161_10004994 | 3300017792 | Bacteria | 9229 |
| 140 | Ga0163161_10017594 | 3300017792 | Bacteria | 5004 |
| 141 | Ga0163161_10139174 | 3300017792 | Bacteria | 1837 |
| 142 | Ga0163161_10146625 | 3300017792 | Bacteria | 1791 |
| 143 | Ga0197907_10885475 | 3300020069 | Bacteria | 1704 |
| 144 | Ga0206354_11326341 | 3300020081 | Bacteria | 924 |
| 145 | Ga0213872_10090103 | 3300021361 | Bacteria | 1373 |
| 146 | Ga0213871_10021672 | 3300021441 | Bacteria | 1603 |
| 147 | Ga0209677_101344 | 3300025253 | Bacteria | 10806 |
| 148 | Ga0209455_1002715 | 3300025272 | Bacteria | 6646 |
| 149 | Ga0209130_1000077 | 3300025284 | Bacteria | 169722 |
| 150 | Ga0207426_1000054 | 3300025302 | Bacteria | 384435 |
| 151 | Ga0207692_10186786 | 3300025898 | Bacteria | 1211 |
| 152 | Ga0207642_10190762 | 3300025899 | Bacteria | 1124 |
| 153 | Ga0207647_10145063 | 3300025904 | Bacteria | 1390 |
| 154 | Ga0207645_10015221 | 3300025907 | Bacteria | 5120 |
| 155 | Ga0207705_10031820 | 3300025909 | Bacteria | 3768 |
| 156 | Ga0207707_10222147 | 3300025912 | Bacteria | 1644 |
| 157 | Ga0207695_10045380 | 3300025913 | Bacteria | 4665 |
| 158 | Ga0207695_10153996 | 3300025913 | Bacteria | 2235 |
| 159 | Ga0207671_10035838 | 3300025914 | Bacteria | 3679 |
| 160 | Ga0207671_10120721 | 3300025914 | Bacteria | 2003 |
| 161 | Ga0207671_10222145 | 3300025914 | Bacteria | 1480 |
| 162 | Ga0207671_10363264 | 3300025914 | Bacteria | 1149 |
| 163 | Ga0207671_10367513 | 3300025914 | Bacteria | 1142 |
| 164 | Ga0207671_10569226 | 3300025914 | Bacteria | 903 |
| 165 | Ga0207693_10092177 | 3300025915 | Bacteria | 2375 |
| 166 | Ga0207693_10144885 | 3300025915 | Bacteria | 1868 |
| 167 | Ga0207663_10045255 | 3300025916 | Bacteria | 2706 |
| 168 | Ga0207660_10130470 | 3300025917 | Bacteria | 1912 |
| 169 | Ga0207652_10023496 | 3300025921 | Bacteria | 5108 |
| 170 | Ga0207681_10420820 | 3300025923 | Bacteria | 1082 |
| 171 | Ga0207659_10559258 | 3300025926 | Bacteria | 973 |
| 172 | Ga0207687_10135313 | 3300025927 | Bacteria | 1863 |
| 173 | Ga0207700_10091012 | 3300025928 | Bacteria | 2409 |
| 174 | Ga0207700_10870900 | 3300025928 | Bacteria | 806 |
| 175 | Ga0207644_10073826 | 3300025931 | Bacteria | 2502 |
| 176 | Ga0207706_10011412 | 3300025933 | Bacteria | 8094 |
| 177 | Ga0207706_10088283 | 3300025933 | Bacteria | 2726 |
| 178 | Ga0207706_10091551 | 3300025933 | Bacteria | 2673 |
| 179 | Ga0207686_10197363 | 3300025934 | Bacteria | 1439 |
| 180 | Ga0207709_10076157 | 3300025935 | Bacteria | 2147 |
| 181 | Ga0207709_10114206 | 3300025935 | Bacteria | 1812 |
| 182 | Ga0207670_10034272 | 3300025936 | Bacteria | 3279 |
| 183 | Ga0207669_10081818 | 3300025937 | Bacteria | 2070 |
| 184 | Ga0207665_10062883 | 3300025939 | Bacteria | 2519 |
| 185 | Ga0207665_10506905 | 3300025939 | Bacteria | 933 |
| 186 | Ga0207691_10158025 | 3300025940 | Bacteria | 1990 |
| 187 | Ga0207689_10074522 | 3300025942 | Bacteria | 2789 |
| 188 | Ga0207689_10074676 | 3300025942 | Bacteria | 2786 |
| 189 | Ga0207689_10336765 | 3300025942 | Bacteria | 1253 |
| 190 | Ga0207661_10291056 | 3300025944 | Bacteria | 1462 |
| 191 | Ga0207661_10305267 | 3300025944 | Bacteria | 1428 |
| 192 | Ga0207679_10166363 | 3300025945 | Bacteria | 1811 |
| 193 | Ga0207679_10401794 | 3300025945 | Bacteria | 1205 |
| 194 | Ga0207667_10013915 | 3300025949 | Bacteria | 9192 |
| 195 | Ga0207712_10104690 | 3300025961 | Bacteria | 2110 |
| 196 | Ga0207668_10451259 | 3300025972 | Bacteria | 1097 |
| 197 | Ga0207640_10134168 | 3300025981 | Bacteria | 1794 |
| 198 | Ga0207640_10205629 | 3300025981 | Bacteria | 1495 |
| 199 | Ga0207658_10188243 | 3300025986 | Bacteria | 1713 |
| 200 | Ga0207658_10191844 | 3300025986 | Bacteria | 1699 |
| 201 | Ga0207658_10644475 | 3300025986 | Bacteria | 954 |
| 202 | Ga0207677_10111598 | 3300026023 | Bacteria | 2038 |
| 203 | Ga0207703_10196776 | 3300026035 | Bacteria | 1789 |
| 204 | Ga0207639_10277629 | 3300026041 | Bacteria | 1472 |
| 205 | Ga0207678_10017094 | 3300026067 | Bacteria | 6370 |
| 206 | Ga0207678_10137111 | 3300026067 | Bacteria | 2088 |
| 207 | Ga0207702_10000126 | 3300026078 | Bacteria | 90550 |
| 208 | Ga0207702_10773872 | 3300026078 | Bacteria | 948 |
| 209 | Ga0207648_10160447 | 3300026089 | Bacteria | 1986 |
| 210 | Ga0207676_10734868 | 3300026095 | Bacteria | 959 |
| 211 | Ga0207674_10018123 | 3300026116 | Bacteria | 7660 |
| 212 | Ga0207674_10565589 | 3300026116 | Bacteria | 1098 |
| 213 | Ga0207683_10021946 | 3300026121 | Bacteria | 5476 |
| 214 | Ga0207683_10312945 | 3300026121 | Bacteria | 1437 |
| 215 | Ga0207698_10209134 | 3300026142 | Bacteria | 1754 |
| 216 | Ga0207698_10403512 | 3300026142 | Bacteria | 1307 |
| 217 | Ga0268266_10002410 | 3300028379 | Bacteria | 20158 |
| 218 | Ga0268266_10053434 | 3300028379 | Bacteria | 3470 |
| 219 | Ga0268266_10296161 | 3300028379 | Bacteria | 1508 |
| 220 | Ga0268266_10699148 | 3300028379 | Bacteria | 977 |
| 221 | Ga0268264_10546557 | 3300028381 | Bacteria | 1135 |
| 222 | Ga0265337_1002708 | 3300028556 | Bacteria | 7954 |
| 223 | Ga0265326_10002939 | 3300028558 | Bacteria | 5693 |
| 224 | Ga0265319_1017774 | 3300028563 | Bacteria | 2696 |
| 225 | Ga0265318_10059818 | 3300028577 | Bacteria | 1420 |
| 226 | Ga0265323_10001443 | 3300028653 | Bacteria | 11682 |
| 227 | Ga0307517_10133837 | 3300028786 | Bacteria | 1772 |
| 228 | Ga0307515_10007623 | 3300028794 | Bacteria | 21350 |
| 229 | Ga0307515_10103560 | 3300028794 | Bacteria | 3410 |
| 230 | Ga0307515_10157370 | 3300028794 | Bacteria | 2337 |
| 231 | Ga0307515_10300873 | 3300028794 | Bacteria | 1289 |
| 232 | Ga0265338_10000321 | 3300028800 | Bacteria | 87046 |
| 233 | Ga0265324_10002307 | 3300029957 | Bacteria | 9895 |
| 234 | Ga0307513_10006015 | 3300031456 | Bacteria | 15930 |
| 235 | Ga0307513_10064249 | 3300031456 | Bacteria | 3869 |
| 236 | Ga0307509_10040164 | 3300031507 | Bacteria | 5090 |
| 237 | Ga0307508_10086959 | 3300031616 | Bacteria | 2710 |
| 238 | Ga0265314_10009423 | 3300031711 | Bacteria | 8236 |
| 239 | Ga0307516_10159623 | 3300031730 | Bacteria | 2006 |
| 240 | Ga0307405_10194984 | 3300031731 | Bacteria | 1466 |
| 241 | Ga0307410_10614587 | 3300031852 | Bacteria | 908 |
| 242 | Ga0307411_10401616 | 3300032005 | Bacteria | 1133 |
| 243 | Ga0307411_10574057 | 3300032005 | Bacteria | 966 |
| 244 | Ga0307415_100264156 | 3300032126 | Bacteria | 1406 |
| 245 | Ga0307510_10116462 | 3300033180 | Bacteria | 2393 |
| 246 | Ga0373944_0103922 | 3300035089 | Bacteria | 963 |
| 247 | Ga0316574_0180803 | 3300035398 | Bacteria | 1357 |
| 248 | Ga0373931_0095822 | 3300035691 | Bacteria | 1661 |
| 249 | Ga0373927_0240944 | 3300035695 | Bacteria | 1188 |
| 250 | Ga0373925_0027573 | 3300037068 | Bacteria | 4157 |
| 251 | Ga0373925_0192602 | 3300037068 | Bacteria | 1618 |
| 252 | Ga0373925_0281199 | 3300037068 | Bacteria | 1340 |
| 253 | Ga0395900_0084700 | 3300037418 | Bacteria | 3258 |
| 254 | Ga0395898_0020989 | 3300037466 | Bacteria | 6626 |
| 255 | Ga0395898_0483718 | 3300037466 | Bacteria | 1178 |
| 256 | Ga0395905_0004739 | 3300037471 | Bacteria | 14053 |
| 257 | Ga0436365_1781448 | 3300039437 | Bacteria | 1069 |
| 258 | Ga0436360_0420953 | 3300039438 | Bacteria | 3157 |
| 259 | Ga0436360_0440158 | 3300039438 | Bacteria | 878 |
| 260 | Ga0436360_0598841 | 3300039438 | Bacteria | 3001 |
| 261 | Ga0436360_0995601 | 3300039438 | Bacteria | 4066 |
| 262 | Ga0436361_0898569 | 3300039447 | Bacteria | 1831 |
| 263 | Ga0436363_1424999 | 3300039450 | Bacteria | 11027 |
| 264 | Ga0451853_3516041 | 3300041512 | Bacteria | 1439 |
| 265 | Ga0439445_0109846 | 3300042004 | Bacteria | 786 |
| 266 | Ga0466963_0465827 | 3300044694 | Bacteria | 892 |
| 267 | Ga0466964_0248605 | 3300044706 | Bacteria | 876 |
| 268 | Ga0466970_0078526 | 3300044765 | Bacteria | 1781 |
| 269 | Ga0451576_0003892 | 3300045051 | Bacteria | 19976 |
| 270 | Ga0466967_0193802 | 3300045976 | Bacteria | 1922 |
| 271 | Ga0495629_0159506 | 3300046459 | Bacteria | 1567 |
| 272 | Ga0495629_0328936 | 3300046459 | Bacteria | 1044 |
| 273 | Ga0495605_0001288 | 3300046474 | Bacteria | 16637 |
| 274 | Ga0495605_0064763 | 3300046474 | Bacteria | 1740 |
| 275 | Ga0495639_0190512 | 3300046475 | Bacteria | 1001 |
| 276 | Ga0495662_0260828 | 3300046476 | Bacteria | 853 |
| 277 | Ga0495664_0380873 | 3300046477 | Bacteria | 848 |
| 278 | Ga0495585_0013091 | 3300046492 | Bacteria | 4864 |
| 279 | Ga0495607_0207419 | 3300046501 | Bacteria | 966 |
| 280 | Ga0495583_0022115 | 3300046506 | Bacteria | 3253 |
| 281 | Ga0495606_0000070 | 3300046507 | Bacteria | 177343 |
| 282 | Ga0495606_0003646 | 3300046507 | Bacteria | 16154 |
| 283 | Ga0495606_0005352 | 3300046507 | Bacteria | 12323 |
| 284 | Ga0495606_0055335 | 3300046507 | Bacteria | 2566 |
| 285 | Ga0495606_0097847 | 3300046507 | Bacteria | 1792 |
| 286 | Ga0495610_0152758 | 3300046512 | Bacteria | 983 |
| 287 | Ga0495616_0102745 | 3300046513 | Bacteria | 1339 |
| 288 | Ga0495620_0015287 | 3300046515 | Bacteria | 3879 |
| 289 | Ga0495631_0001980 | 3300046518 | Bacteria | 11993 |
| 290 | Ga0495631_0153236 | 3300046518 | Bacteria | 989 |
| 291 | Ga0495632_0006772 | 3300046519 | Bacteria | 7318 |
| 292 | Ga0495632_0014187 | 3300046519 | Bacteria | 4518 |
| 293 | Ga0495637_0023384 | 3300046520 | Bacteria | 2810 |
| 294 | Ga0495637_0037786 | 3300046520 | Bacteria | 2094 |
| 295 | Ga0495644_0036643 | 3300046523 | Bacteria | 1850 |
| 296 | Ga0495648_0006022 | 3300046524 | Bacteria | 9959 |
| 297 | Ga0495648_0010085 | 3300046524 | Bacteria | 7236 |
| 298 | Ga0495648_0107067 | 3300046524 | Bacteria | 1529 |
| 299 | Ga0495642_0093648 | 3300046528 | Bacteria | 1273 |
| 300 | Ga0495654_0195216 | 3300046530 | Bacteria | 869 |
| 301 | Ga0495609_0027161 | 3300046538 | Bacteria | 2617 |
| 302 | Ga0495609_0151532 | 3300046538 | Bacteria | 986 |
| 303 | Ga0495622_0089273 | 3300046557 | Bacteria | 1416 |
| 304 | Ga0495633_0000204 | 3300046558 | Bacteria | 75182 |
| 305 | Ga0495633_0015753 | 3300046558 | Bacteria | 3917 |
| 306 | Ga0495656_0016618 | 3300046615 | Bacteria | 2795 |
| 307 | Ga0495656_0018780 | 3300046615 | Bacteria | 2661 |
| 308 | Ga0495656_0050035 | 3300046615 | Bacteria | 1782 |
| 309 | Ga0495668_0003287 | 3300046616 | Bacteria | 12267 |
| 310 | Ga0495611_0009602 | 3300046648 | Bacteria | 4088 |
| 311 | Ga0495625_0004637 | 3300046660 | Bacteria | 12914 |
| 312 | Ga0495625_0017619 | 3300046660 | Bacteria | 5589 |
| 313 | Ga0495625_0118036 | 3300046660 | Bacteria | 1808 |
| 314 | Ga0495625_0357819 | 3300046660 | Bacteria | 921 |
| 315 | Ga0495659_0017980 | 3300046664 | Bacteria | 2350 |
| 316 | Ga0495661_0013463 | 3300046665 | Bacteria | 5491 |
| 317 | Ga0495588_0226315 | 3300046674 | Bacteria | 987 |
| 318 | Ga0495669_0003974 | 3300046684 | Bacteria | 6085 |
| 319 | Ga0495649_0012827 | 3300046694 | Bacteria | 4859 |
| 320 | Ga0495649_0112433 | 3300046694 | Bacteria | 1444 |
| 321 | Ga0495589_0057700 | 3300046794 | Bacteria | 1909 |
| 322 | Ga0495589_0178350 | 3300046794 | Bacteria | 1008 |
| 323 | Ga0495660_0009927 | 3300046810 | Bacteria | 5541 |
| 324 | Ga0495604_0137270 | 3300047317 | Bacteria | 1751 |
| 325 | Ga0495636_0096232 | 3300047318 | Bacteria | 1290 |
| 326 | Ga0495672_0035815 | 3300047320 | Bacteria | 3054 |
| 327 | Ga0495672_0063547 | 3300047320 | Bacteria | 2118 |
| 328 | Ga0495672_0209499 | 3300047320 | Bacteria | 969 |
| 329 | Ga0495686_0070960 | 3300047472 | Bacteria | 2145 |
| 330 | Ga0495686_0118340 | 3300047472 | Bacteria | 1582 |
| 331 | Ga0495686_0123916 | 3300047472 | Bacteria | 1538 |
| 332 | Ga0495614_0171839 | 3300048089 | Bacteria | 973 |
| 333 | Ga0495615_0054803 | 3300048090 | Bacteria | 1036 |
| 334 | Ga0495626_0020550 | 3300048091 | Bacteria | 3288 |
| 335 | Ga0495626_0024532 | 3300048091 | Bacteria | 2956 |
| 336 | Ga0496100_0005504 | 3300048903 | Bacteria | 6830 |
| 337 | Ga0496101_0243958 | 3300048904 | Bacteria | 1398 |
| 338 | Ga0496101_0322283 | 3300048904 | Bacteria | 1212 |
| 339 | Ga0496101_0367951 | 3300048904 | Bacteria | 1130 |
| 340 | Ga0496102_0027789 | 3300048905 | Bacteria | 5052 |
| 341 | Ga0496102_0181130 | 3300048905 | Bacteria | 1985 |
| 342 | Ga0496103_0057188 | 3300048906 | Bacteria | 2421 |
| 343 | Ga0496104_0046593 | 3300048907 | Bacteria | 4083 |
| 344 | Ga0496104_0072689 | 3300048907 | Bacteria | 3270 |
| 345 | Ga0496104_0073802 | 3300048907 | Bacteria | 3246 |
| 346 | Ga0496104_0373977 | 3300048907 | Bacteria | 1337 |
| 347 | Ga0496106_0004195 | 3300048909 | Bacteria | 10741 |
| 348 | Ga0496106_0017519 | 3300048909 | Bacteria | 5301 |
| 349 | Ga0496106_0108902 | 3300048909 | Bacteria | 2155 |
| 350 | Ga0496106_0343214 | 3300048909 | Bacteria | 1199 |
| 351 | Ga0496106_0344620 | 3300048909 | Bacteria | 1197 |
| 352 | Ga0496107_0002006 | 3300048910 | Bacteria | 12986 |
| 353 | Ga0496107_0005355 | 3300048910 | Bacteria | 8778 |
| 354 | Ga0496107_0132749 | 3300048910 | Bacteria | 1839 |
| 355 | Ga0496108_0000515 | 3300048911 | Bacteria | 30277 |
| 356 | Ga0496108_0013623 | 3300048911 | Bacteria | 6639 |
| 357 | Ga0496108_0038368 | 3300048911 | Bacteria | 3990 |
| 358 | Ga0496108_0213391 | 3300048911 | Bacteria | 1676 |
| 359 | Ga0496109_0002891 | 3300048912 | Bacteria | 14365 |
| 360 | Ga0496109_0026725 | 3300048912 | Bacteria | 5148 |
| 361 | Ga0496109_0036450 | 3300048912 | Bacteria | 4439 |
| 362 | Ga0496110_0005701 | 3300048913 | Bacteria | 9777 |
| 363 | Ga0496110_0271297 | 3300048913 | Bacteria | 1544 |
| 364 | Ga0496110_0355549 | 3300048913 | Bacteria | 1335 |
| 365 | Ga0496111_0017931 | 3300048914 | Bacteria | 4896 |
| 366 | Ga0496112_0020326 | 3300048915 | Bacteria | 6291 |
| 367 | Ga0496112_0037801 | 3300048915 | Bacteria | 4713 |
| 368 | Ga0496112_0052978 | 3300048915 | Bacteria | 3984 |
| 369 | Ga0496113_0024908 | 3300048916 | Bacteria | 4260 |
| 370 | Ga0496113_0071685 | 3300048916 | Bacteria | 2635 |
| 371 | Ga0496114_0010127 | 3300048917 | Bacteria | 7500 |
| 372 | Ga0496115_0141901 | 3300048918 | Bacteria | 1982 |
| 373 | Ga0496115_0147056 | 3300048918 | Bacteria | 1945 |
| 374 | Ga0496116_0001829 | 3300048919 | Bacteria | 23026 |
| 375 | Ga0496117_0007856 | 3300048920 | Bacteria | 10264 |
| 376 | Ga0496117_0117202 | 3300048920 | Bacteria | 1644 |
| 377 | Ga0496117_0230339 | 3300048920 | Bacteria | 1024 |
| 378 | Ga0496118_0015402 | 3300048921 | Bacteria | 7079 |
| 379 | Ga0496118_0108024 | 3300048921 | Bacteria | 1856 |
| 380 | Ga0496118_0145757 | 3300048921 | Bacteria | 1491 |
| 381 | Ga0496118_0168263 | 3300048921 | Bacteria | 1343 |
| 382 | Ga0496118_0225040 | 3300048921 | Bacteria | 1088 |
| 383 | Ga0496119_0031271 | 3300048922 | Bacteria | 3574 |
| 384 | Ga0496119_0033429 | 3300048922 | Bacteria | 3408 |
| 385 | Ga0496119_0082850 | 3300048922 | Bacteria | 1844 |
| 386 | Ga0496120_0054282 | 3300048923 | Bacteria | 2272 |
| 387 | Ga0496120_0179084 | 3300048923 | Bacteria | 1042 |
| 388 | Ga0496121_0028099 | 3300048924 | Bacteria | 5244 |
| 389 | Ga0496121_0055004 | 3300048924 | Bacteria | 3320 |
| 390 | Ga0496121_0069807 | 3300048924 | Bacteria | 2833 |
| 391 | Ga0496121_0176744 | 3300048924 | Bacteria | 1545 |
| 392 | Ga0496121_0184353 | 3300048924 | Bacteria | 1503 |
| 393 | Ga0496121_0318592 | 3300048924 | Bacteria | 1048 |
| 394 | Ga0496121_0351124 | 3300048924 | Bacteria | 982 |
| 395 | Ga0496121_0431597 | 3300048924 | Bacteria | 854 |
| 396 | Ga0496122_0023924 | 3300048925 | Bacteria | 5364 |
| 397 | Ga0496122_0039811 | 3300048925 | Bacteria | 3743 |
| 398 | Ga0496122_0110163 | 3300048925 | Bacteria | 1810 |
| 399 | Ga0496123_0016479 | 3300048926 | Bacteria | 5998 |
| 400 | Ga0496124_0340615 | 3300048927 | Bacteria | 1065 |
| 401 | Ga0496125_0001496 | 3300048928 | Bacteria | 33472 |
| 402 | Ga0496125_0016993 | 3300048928 | Bacteria | 6956 |
| 403 | Ga0496125_0123130 | 3300048928 | Bacteria | 1844 |
| 404 | Ga0496125_0132736 | 3300048928 | Bacteria | 1749 |
| 405 | Ga0496125_0163466 | 3300048928 | Bacteria | 1508 |
| 406 | Ga0496126_0004659 | 3300048929 | Bacteria | 16215 |
| 407 | Ga0496126_0004802 | 3300048929 | Bacteria | 15878 |
| 408 | Ga0496126_0013697 | 3300048929 | Bacteria | 8231 |
| 409 | Ga0496126_0073382 | 3300048929 | Bacteria | 3042 |
| 410 | Ga0496126_0462120 | 3300048929 | Bacteria | 1020 |
| 411 | Ga0495678_011013 | 3300049459 | Bacteria | 4351 |
| 412 | Ga0495682_0003951 | 3300049460 | Bacteria | 6467 |
| 413 | Ga0501034_0460173 | 3300049571 | Bacteria | 1189 |
| 414 | Ga0501038_0525926 | 3300049574 | Bacteria | 902 |
| 415 | Ga0501047_0352505 | 3300049581 | Bacteria | 1308 |
| 416 | Ga0501070_0256107 | 3300049586 | Bacteria | 1431 |
| 417 | Ga0501044_0175170 | 3300049823 | Bacteria | 2114 |
| 418 | nmdc:mga03683_15025_c1 | 3300050489 | Bacteria | 2880 |
| 419 | nmdc:mga03683_27218_c1 | 3300050489 | Bacteria | 2262 |
| 420 | nmdc:mga03683_55947_c1 | 3300050489 | Bacteria | 1657 |
| 421 | nmdc:mga03n38_15412_c1 | 3300050490 | Bacteria | 2951 |
| 422 | nmdc:mga00v17_43269_c1 | 3300050491 | Bacteria | 2711 |
| 423 | nmdc:mga0yw44_17878_c1 | 3300050492 | Bacteria | 3870 |
| 424 | nmdc:mga0yw44_27450_c1 | 3300050492 | Bacteria | 3260 |
| 425 | nmdc:mga0k408_1383_c1 | 3300050493 | Bacteria | 13098 |
| 426 | nmdc:mga0k408_45622_c1 | 3300050493 | Bacteria | 2529 |
| 427 | nmdc:mga0k408_81990_c1 | 3300050493 | Bacteria | 1889 |
| 428 | nmdc:mga06z11_12083_c1 | 3300050494 | Bacteria | 3746 |
| 429 | nmdc:mga06z11_52034_c1 | 3300050494 | Bacteria | 2099 |
| 430 | nmdc:mga06z11_8396_c1 | 3300050494 | Bacteria | 4304 |
| 431 | nmdc:mga04h51_95979_c1 | 3300050495 | Bacteria | 1074 |
| 432 | nmdc:mga07m45_240719_c1 | 3300050496 | Bacteria | 1053 |
| 433 | nmdc:mga07m45_33009_c1 | 3300050496 | Bacteria | 2873 |
| 434 | nmdc:mga07m45_3676_c1 | 3300050496 | Bacteria | 7416 |
| 435 | nmdc:mga07m45_4796_c1 | 3300050496 | Bacteria | 6655 |
| 436 | nmdc:mga07m45_6783_c1 | 3300050496 | Bacteria | 5817 |
| 437 | nmdc:mga07m45_83717_c1 | 3300050496 | Bacteria | 1823 |
| 438 | nmdc:mga0n895_22907_c1 | 3300050512 | Bacteria | 5860 |
| 439 | nmdc:mga0sz30_12928_c1 | 3300050516 | Bacteria | 3258 |
| 440 | nmdc:mga0sz30_4699_c1 | 3300050516 | Bacteria | 4957 |
| 441 | nmdc:mga0sz30_5171_c1 | 3300050516 | Bacteria | 4138 |
| 442 | Ga0495601_0246013 | 3300053077 | Bacteria | 1168 |
| 443 | Ga0500610_0201791 | 3300053079 | Bacteria | 957 |
| 444 | Ga0500635_0017639 | 3300053080 | Bacteria | 2142 |
| 445 | Ga0495655_0024302 | 3300053083 | Bacteria | 1406 |
| 446 | Ga0500578_0293026 | 3300053086 | Bacteria | 967 |
| 447 | Ga0500643_011918 | 3300053087 | Bacteria | 3140 |
| 448 | Ga0500643_039277 | 3300053087 | Bacteria | 1399 |
| 449 | Ga0500644_0030134 | 3300053088 | Bacteria | 1713 |
| 450 | Ga0500646_0001906 | 3300053090 | Bacteria | 5461 |
| 451 | Ga0500583_0130008 | 3300053092 | Bacteria | 1249 |
| 452 | Ga0500651_0028017 | 3300053093 | Bacteria | 3543 |
| 453 | Ga0500651_0069697 | 3300053093 | Bacteria | 2189 |
| 454 | Ga0500651_0196491 | 3300053093 | Bacteria | 1192 |
| 455 | Ga0500566_0000006 | 3300053094 | Bacteria | 153632 |
| 456 | Ga0500566_0005667 | 3300053094 | Bacteria | 7423 |
| 457 | Ga0500566_0006660 | 3300053094 | Bacteria | 6842 |
| 458 | Ga0500640_007569 | 3300053095 | Bacteria | 4238 |
| 459 | Ga0500641_0003983 | 3300053096 | Bacteria | 5221 |
| 460 | Ga0500650_0000139 | 3300053098 | Bacteria | 18956 |
| 461 | Ga0500554_000916 | 3300053102 | Bacteria | 5756 |
| 462 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 463 | Ga0500556_0090189 | 3300053104 | Bacteria | 1170 |
| 464 | Ga0500557_000246 | 3300053105 | Bacteria | 7889 |
| 465 | Ga0500562_027170 | 3300053108 | Bacteria | 1501 |
| 466 | Ga0500569_002513 | 3300053109 | Bacteria | 3630 |
| 467 | Ga0500572_000674 | 3300053111 | Bacteria | 11241 |
| 468 | Ga0500580_055306 | 3300053113 | Bacteria | 1663 |
| 469 | Ga0500591_130165 | 3300053115 | Bacteria | 1016 |
| 470 | Ga0500593_060635 | 3300053117 | Bacteria | 1663 |
| 471 | Ga0500594_0038243 | 3300053118 | Bacteria | 1299 |
| 472 | Ga0500595_000152 | 3300053119 | Bacteria | 45452 |
| 473 | Ga0500608_000349 | 3300053122 | Bacteria | 17817 |
| 474 | Ga0500614_001760 | 3300053123 | Bacteria | 5030 |
| 475 | Ga0500618_000309 | 3300053125 | Bacteria | 36059 |
| 476 | Ga0500618_024219 | 3300053125 | Bacteria | 1463 |
| 477 | Ga0500642_0000016 | 3300053130 | Bacteria | 176560 |
| 478 | Ga0500652_000646 | 3300053131 | Bacteria | 11892 |
| 479 | Ga0500658_0101795 | 3300053134 | Bacteria | 1254 |
| 480 | Ga0500559_0000699 | 3300053136 | Bacteria | 22064 |
| 481 | Ga0500559_0010680 | 3300053136 | Bacteria | 3935 |
| 482 | Ga0500564_172151 | 3300053138 | Bacteria | 909 |
| 483 | Ga0500568_0000109 | 3300053139 | Bacteria | 76714 |
| 484 | Ga0500568_0002572 | 3300053139 | Bacteria | 10565 |
| 485 | Ga0500568_0011765 | 3300053139 | Bacteria | 4044 |
| 486 | Ga0500577_0002860 | 3300053142 | Bacteria | 4441 |
| 487 | Ga0500588_0046197 | 3300053146 | Bacteria | 1337 |
| 488 | Ga0500590_128939 | 3300053148 | Bacteria | 1173 |
| 489 | Ga0500604_0023561 | 3300053151 | Bacteria | 1756 |
| 490 | Ga0500616_0000061 | 3300053153 | Bacteria | 249158 |
| 491 | Ga0500616_0000472 | 3300053153 | Bacteria | 52191 |
| 492 | Ga0500622_0000916 | 3300053156 | Bacteria | 25118 |
| 493 | Ga0500622_0164846 | 3300053156 | Bacteria | 1036 |
| 494 | Ga0500630_000571 | 3300053159 | Bacteria | 16714 |
| 495 | Ga0500633_0013107 | 3300053160 | Bacteria | 2312 |
| 496 | Ga0500638_000086 | 3300053162 | Bacteria | 16892 |
| 497 | Ga0500639_000016 | 3300053163 | Bacteria | 118099 |
| 498 | Ga0500636_0000963 | 3300053177 | Bacteria | 15483 |
| 499 | Ga0500636_0025991 | 3300053177 | Bacteria | 3461 |
| 500 | Ga0500636_0077317 | 3300053177 | Bacteria | 1923 |
| 501 | Ga0500636_0112898 | 3300053177 | Bacteria | 1533 |
| 502 | Ga0500636_0125447 | 3300053177 | Bacteria | 1436 |
| 503 | Ga0500645_039978 | 3300053730 | Bacteria | 1389 |
| 504 | Ga0500596_001348 | 3300053735 | Bacteria | 4940 |
| 505 | Ga0500661_000655 | 3300055283 | Bacteria | 6465 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053125 | Ga0500618_000309 | Ga0500618_000309_10_699 | 205 |
| 2 | 3300006028 | Ga0070717_10013888 | Ga0070717_100138882 | 217 |
| 3 | 3300046507 | Ga0495606_0000070 | Ga0495606_0000070_170604_171359 | 219 |
| 4 | 3300005468 | Ga0070707_100126270 | Ga0070707_1001262701 | 221 |
| 5 | 3300049571 | Ga0501034_0460173 | Ga0501034_0460173_183_917 | 221 |
| 6 | 3300049581 | Ga0501047_0352505 | Ga0501047_0352505_86_820 | 224 |
| 7 | 3300053094 | Ga0500566_0006660 | Ga0500566_0006660_1595_2329 | 224 |
| 8 | 3300053102 | Ga0500554_000916 | Ga0500554_000916_805_1539 | 224 |
| 9 | 3300053119 | Ga0500595_000152 | Ga0500595_000152_15526_16260 | 224 |
| 10 | 3300053162 | Ga0500638_000086 | Ga0500638_000086_12105_12839 | 224 |
| 11 | 3300055283 | Ga0500661_000655 | Ga0500661_000655_4170_4904 | 224 |
| 12 | 3300014497 | Ga0182008_10131686 | Ga0182008_101316862 | 226 |
| 13 | 3300025915 | Ga0207693_10144885 | Ga0207693_101448853 | 227 |
| 14 | 3300025928 | Ga0207700_10091012 | Ga0207700_100910122 | 227 |
| 15 | 3300025939 | Ga0207665_10506905 | Ga0207665_105069051 | 227 |
| 16 | 3300005844 | Ga0068862_100428821 | Ga0068862_1004288211 | 228 |
| 17 | 3300025898 | Ga0207692_10186786 | Ga0207692_101867862 | 228 |
| 18 | 3300025928 | Ga0207700_10870900 | Ga0207700_108709001 | 229 |
| 19 | 3300046492 | Ga0495585_0013091 | Ga0495585_0013091_2851_3540 | 229 |
| 20 | 3300046507 | Ga0495606_0003646 | Ga0495606_0003646_2627_3316 | 229 |
| 21 | 3300046507 | Ga0495606_0055335 | Ga0495606_0055335_1686_2375 | 229 |
| 22 | 3300046660 | Ga0495625_0357819 | Ga0495625_0357819_140_829 | 229 |
| 23 | 3300046694 | Ga0495649_0112433 | Ga0495649_0112433_358_1047 | 229 |
| 24 | 3300048923 | Ga0496120_0179084 | Ga0496120_0179084_289_978 | 229 |
| 25 | 3300048924 | Ga0496121_0431597 | Ga0496121_0431597_107_796 | 229 |
| 26 | 3300048928 | Ga0496125_0163466 | Ga0496125_0163466_676_1365 | 229 |
| 27 | 3300053105 | Ga0500557_000246 | Ga0500557_000246_5391_6080 | 229 |
| 28 | 3300009545 | Ga0105237_10383644 | Ga0105237_103836442 | 230 |
| 29 | 3300009551 | Ga0105238_10055219 | Ga0105238_100552192 | 230 |
| 30 | 3300046524 | Ga0495648_0107067 | Ga0495648_0107067_493_1284 | 231 |
| 31 | 3300046615 | Ga0495656_0050035 | Ga0495656_0050035_165_899 | 231 |
| 32 | 3300046794 | Ga0495589_0057700 | Ga0495589_0057700_1159_1893 | 231 |
| 33 | 3300005355 | Ga0070671_100065906 | Ga0070671_1000659062 | 233 |
| 34 | 3300005457 | Ga0070662_100073159 | Ga0070662_1000731592 | 233 |
| 35 | 3300005539 | Ga0068853_100112046 | Ga0068853_1001120462 | 233 |
| 36 | 3300005577 | Ga0068857_100072314 | Ga0068857_1000723143 | 233 |
| 37 | 3300005578 | Ga0068854_100038548 | Ga0068854_1000385483 | 233 |
| 38 | 3300005616 | Ga0068852_100039543 | Ga0068852_1000395432 | 233 |
| 39 | 3300005844 | Ga0068862_100302885 | Ga0068862_1003028851 | 233 |
| 40 | 3300006042 | Ga0075368_10074851 | Ga0075368_100748512 | 233 |
| 41 | 3300006048 | Ga0075363_100033643 | Ga0075363_1000336432 | 233 |
| 42 | 3300006177 | Ga0075362_10041023 | Ga0075362_100410232 | 233 |
| 43 | 3300006177 | Ga0075362_10043018 | Ga0075362_100430182 | 233 |
| 44 | 3300006178 | Ga0075367_10007260 | Ga0075367_100072603 | 233 |
| 45 | 3300006178 | Ga0075367_10153925 | Ga0075367_101539252 | 233 |
| 46 | 3300006186 | Ga0075369_10014572 | Ga0075369_100145723 | 233 |
| 47 | 3300006353 | Ga0075370_10001906 | Ga0075370_1000190611 | 233 |
| 48 | 3300006353 | Ga0075370_10085208 | Ga0075370_100852082 | 233 |
| 49 | 3300006353 | Ga0075370_10092005 | Ga0075370_100920052 | 233 |
| 50 | 3300006871 | Ga0075434_100025857 | Ga0075434_1000258573 | 233 |
| 51 | 3300009148 | Ga0105243_10094312 | Ga0105243_100943122 | 233 |
| 52 | 3300009545 | Ga0105237_10023051 | Ga0105237_100230514 | 233 |
| 53 | 3300010375 | Ga0105239_10021983 | Ga0105239_100219836 | 233 |
| 54 | 3300025913 | Ga0207695_10153996 | Ga0207695_101539963 | 233 |
| 55 | 3300025914 | Ga0207671_10035838 | Ga0207671_100358382 | 233 |
| 56 | 3300025931 | Ga0207644_10073826 | Ga0207644_100738262 | 233 |
| 57 | 3300025933 | Ga0207706_10091551 | Ga0207706_100915513 | 233 |
| 58 | 3300025935 | Ga0207709_10076157 | Ga0207709_100761573 | 233 |
| 59 | 3300025942 | Ga0207689_10074522 | Ga0207689_100745222 | 233 |
| 60 | 3300025981 | Ga0207640_10134168 | Ga0207640_101341682 | 233 |
| 61 | 3300025986 | Ga0207658_10191844 | Ga0207658_101918442 | 233 |
| 62 | 3300026041 | Ga0207639_10277629 | Ga0207639_102776292 | 233 |
| 63 | 3300026116 | Ga0207674_10018123 | Ga0207674_100181239 | 233 |
| 64 | 3300028794 | Ga0307515_10157370 | Ga0307515_101573702 | 233 |
| 65 | 3300028794 | Ga0307515_10300873 | Ga0307515_103008732 | 233 |
| 66 | 3300031616 | Ga0307508_10086959 | Ga0307508_100869592 | 233 |
| 67 | 3300031730 | Ga0307516_10159623 | Ga0307516_101596232 | 233 |
| 68 | 3300037418 | Ga0395900_0084700 | Ga0395900_0084700_2539_3240 | 233 |
| 69 | 3300046474 | Ga0495605_0064763 | Ga0495605_0064763_55_819 | 233 |
| 70 | 3300046512 | Ga0495610_0152758 | Ga0495610_0152758_82_846 | 233 |
| 71 | 3300046518 | Ga0495631_0153236 | Ga0495631_0153236_184_948 | 233 |
| 72 | 3300046519 | Ga0495632_0014187 | Ga0495632_0014187_3447_4244 | 233 |
| 73 | 3300046538 | Ga0495609_0151532 | Ga0495609_0151532_197_961 | 233 |
| 74 | 3300046660 | Ga0495625_0017619 | Ga0495625_0017619_917_1681 | 233 |
| 75 | 3300046694 | Ga0495649_0012827 | Ga0495649_0012827_3969_4733 | 233 |
| 76 | 3300048091 | Ga0495626_0020550 | Ga0495626_0020550_540_1304 | 233 |
| 77 | 3300050489 | nmdc:mga03683_15025_c1 | nmdc:mga03683_15025_c1_2050_2814 | 233 |
| 78 | 3300050489 | nmdc:mga03683_27218_c1 | nmdc:mga03683_27218_c1_923_1687 | 233 |
| 79 | 3300050493 | nmdc:mga0k408_1383_c1 | nmdc:mga0k408_1383_c1_9314_10078 | 233 |
| 80 | 3300050493 | nmdc:mga0k408_45622_c1 | nmdc:mga0k408_45622_c1_764_1543 | 233 |
| 81 | 3300050494 | nmdc:mga06z11_52034_c1 | nmdc:mga06z11_52034_c1_309_1073 | 233 |
| 82 | 3300050494 | nmdc:mga06z11_8396_c1 | nmdc:mga06z11_8396_c1_2205_2969 | 233 |
| 83 | 3300050495 | nmdc:mga04h51_95979_c1 | nmdc:mga04h51_95979_c1_232_996 | 233 |
| 84 | 3300050496 | nmdc:mga07m45_3676_c1 | nmdc:mga07m45_3676_c1_4455_5219 | 233 |
| 85 | 3300050496 | nmdc:mga07m45_4796_c1 | nmdc:mga07m45_4796_c1_5382_6161 | 233 |
| 86 | 3300050496 | nmdc:mga07m45_6783_c1 | nmdc:mga07m45_6783_c1_3973_4737 | 233 |
| 87 | 3300050512 | nmdc:mga0n895_22907_c1 | nmdc:mga0n895_22907_c1_2659_3393 | 233 |
| 88 | 3300050516 | nmdc:mga0sz30_4699_c1 | nmdc:mga0sz30_4699_c1_2882_3646 | 233 |
| 89 | 3300050516 | nmdc:mga0sz30_5171_c1 | nmdc:mga0sz30_5171_c1_2230_2994 | 233 |
| 90 | 3300053086 | Ga0500578_0293026 | Ga0500578_0293026_50_814 | 233 |
| 91 | 3300053093 | Ga0500651_0196491 | Ga0500651_0196491_151_915 | 233 |
| 92 | 3300053139 | Ga0500568_0011765 | Ga0500568_0011765_2904_3683 | 233 |
| 93 | 3300006048 | Ga0075363_100065833 | Ga0075363_1000658332 | 234 |
| 94 | 3300006178 | Ga0075367_10044514 | Ga0075367_100445142 | 234 |
| 95 | 3300006195 | Ga0075366_10028470 | Ga0075366_100284703 | 234 |
| 96 | 3300013297 | Ga0157378_10513358 | Ga0157378_105133582 | 234 |
| 97 | 3300005548 | Ga0070665_100141873 | Ga0070665_1001418732 | 237 |
| 98 | 3300031507 | Ga0307509_10040164 | Ga0307509_100401642 | 237 |
| 99 | 3300033180 | Ga0307510_10116462 | Ga0307510_101164623 | 237 |
| 100 | 3300046528 | Ga0495642_0093648 | Ga0495642_0093648_333_1109 | 237 |
| 101 | 3300046557 | Ga0495622_0089273 | Ga0495622_0089273_68_802 | 237 |
| 102 | 3300046558 | Ga0495633_0015753 | Ga0495633_0015753_13_789 | 237 |
| 103 | 3300046664 | Ga0495659_0017980 | Ga0495659_0017980_836_1612 | 237 |
| 104 | 3300047318 | Ga0495636_0096232 | Ga0495636_0096232_14_748 | 237 |
| 105 | 3300047320 | Ga0495672_0063547 | Ga0495672_0063547_535_1335 | 237 |
| 106 | 3300047320 | Ga0495672_0209499 | Ga0495672_0209499_143_877 | 237 |
| 107 | 3300048090 | Ga0495615_0054803 | Ga0495615_0054803_268_1002 | 237 |
| 108 | 3300031852 | Ga0307410_10614587 | Ga0307410_106145871 | 239 |
| 109 | iso_pu_bacteria | 2545555834 | 2545673538 | 239 |
| 110 | iso_pu_bacteria | 2667528175 | 2671121869 | 239 |
| 111 | iso_pu_bacteria | 2903748898 | 2903753393 | 239 |
| 112 | iso_pu_bacteria | 3003665799 | 3003669459 | 239 |
| 113 | iso_pu_bacteria | 641522639 | 641646110 | 239 |
| 114 | iso_pu_bacteria | 643348564 | 643604830 | 239 |
| 115 | iso_pu_bacteria | 8056681323 | 8056688311 | 239 |
| 116 | iso_pu_bacteria | 2513237098 | 2513674400 | 240 |
| 117 | iso_pu_bacteria | 2513237101 | 2513692867 | 240 |
| 118 | iso_pu_bacteria | 2513237141 | 2513890198 | 240 |
| 119 | iso_pu_bacteria | 2524023210 | 2524465794 | 240 |
| 120 | iso_pu_bacteria | 2602042107 | 2603856752 | 240 |
| 121 | iso_pu_bacteria | 2721755755 | 2723844766 | 240 |
| 122 | iso_pu_bacteria | 2791355199 | 2793079890 | 240 |
| 123 | iso_pu_bacteria | 2857524615 | 2857528230 | 240 |
| 124 | iso_pu_bacteria | 2874604998 | 2874605513 | 240 |
| 125 | iso_pu_bacteria | 2876808645 | 2876813053 | 240 |
| 126 | iso_pu_bacteria | 2879110137 | 2879115833 | 240 |
| 127 | iso_pu_bacteria | 2885383462 | 2885391303 | 240 |
| 128 | iso_pu_bacteria | 2889033259 | 2889039465 | 240 |
| 129 | iso_pu_bacteria | 2893066018 | 2893068671 | 240 |
| 130 | iso_pu_bacteria | 2903768456 | 2903773790 | 240 |
| 131 | iso_pu_bacteria | 2919073203 | 2919075653 | 240 |
| 132 | iso_pu_bacteria | 2922361189 | 2922365649 | 240 |
| 133 | iso_pu_bacteria | 2922386360 | 2922391264 | 240 |
| 134 | iso_pu_bacteria | 8006964411 | 8006967018 | 240 |
| 135 | 3300037466 | Ga0395898_0483718 | Ga0395898_0483718_193_936 | 242 |
| 136 | 3300045976 | Ga0466967_0193802 | Ga0466967_0193802_119_868 | 242 |
| 137 | 3300005577 | Ga0068857_100794332 | Ga0068857_1007943322 | 243 |
| 138 | 3300025914 | Ga0207671_10120721 | Ga0207671_101207212 | 243 |
| 139 | 3300026116 | Ga0207674_10565589 | Ga0207674_105655891 | 243 |
| 140 | 3300042004 | Ga0439445_0109846 | Ga0439445_0109846_44_775 | 243 |
| 141 | iso_pu_bacteria | 2582581306 | 2585268618 | 243 |
| 142 | iso_pu_bacteria | 2765235802 | 2765468745 | 243 |
| 143 | iso_pu_bacteria | 2839993093 | 2839998155 | 243 |
| 144 | iso_pu_bacteria | 8054002106 | 8054008055 | 243 |
| 145 | 3300005327 | Ga0070658_10042588 | Ga0070658_100425884 | 244 |
| 146 | 3300005329 | Ga0070683_100718298 | Ga0070683_1007182981 | 244 |
| 147 | 3300005330 | Ga0070690_100143648 | Ga0070690_1001436482 | 244 |
| 148 | 3300005334 | Ga0068869_100131609 | Ga0068869_1001316093 | 244 |
| 149 | 3300005334 | Ga0068869_100641479 | Ga0068869_1006414791 | 244 |
| 150 | 3300005336 | Ga0070680_100080116 | Ga0070680_1000801162 | 244 |
| 151 | 3300005337 | Ga0070682_100225490 | Ga0070682_1002254903 | 244 |
| 152 | 3300005337 | Ga0070682_100262890 | Ga0070682_1002628902 | 244 |
| 153 | 3300005339 | Ga0070660_100104431 | Ga0070660_1001044312 | 244 |
| 154 | 3300005340 | Ga0070689_100257795 | Ga0070689_1002577952 | 244 |
| 155 | 3300005347 | Ga0070668_100014095 | Ga0070668_1000140952 | 244 |
| 156 | 3300005353 | Ga0070669_100320831 | Ga0070669_1003208311 | 244 |
| 157 | 3300005354 | Ga0070675_100830450 | Ga0070675_1008304501 | 244 |
| 158 | 3300005355 | Ga0070671_100308001 | Ga0070671_1003080011 | 244 |
| 159 | 3300005364 | Ga0070673_100227767 | Ga0070673_1002277672 | 244 |
| 160 | 3300005365 | Ga0070688_100095286 | Ga0070688_1000952862 | 244 |
| 161 | 3300005365 | Ga0070688_100290257 | Ga0070688_1002902572 | 244 |
| 162 | 3300005366 | Ga0070659_100243663 | Ga0070659_1002436632 | 244 |
| 163 | 3300005367 | Ga0070667_100698167 | Ga0070667_1006981671 | 244 |
| 164 | 3300005437 | Ga0070710_10093963 | Ga0070710_100939632 | 244 |
| 165 | 3300005455 | Ga0070663_100027800 | Ga0070663_1000278004 | 244 |
| 166 | 3300005455 | Ga0070663_100071769 | Ga0070663_1000717692 | 244 |
| 167 | 3300005456 | Ga0070678_100074298 | Ga0070678_1000742982 | 244 |
| 168 | 3300005458 | Ga0070681_10068876 | Ga0070681_100688762 | 244 |
| 169 | 3300005466 | Ga0070685_10517574 | Ga0070685_105175741 | 244 |
| 170 | 3300005530 | Ga0070679_100056914 | Ga0070679_1000569142 | 244 |
| 171 | 3300005535 | Ga0070684_100248713 | Ga0070684_1002487132 | 244 |
| 172 | 3300005543 | Ga0070672_100157897 | Ga0070672_1001578972 | 244 |
| 173 | 3300005544 | Ga0070686_100123250 | Ga0070686_1001232503 | 244 |
| 174 | 3300005548 | Ga0070665_100116587 | Ga0070665_1001165872 | 244 |
| 175 | 3300005548 | Ga0070665_100303901 | Ga0070665_1003039012 | 244 |
| 176 | 3300005549 | Ga0070704_100491987 | Ga0070704_1004919872 | 244 |
| 177 | 3300005563 | Ga0068855_100015651 | Ga0068855_1000156514 | 244 |
| 178 | 3300005564 | Ga0070664_100113945 | Ga0070664_1001139452 | 244 |
| 179 | 3300005564 | Ga0070664_100274215 | Ga0070664_1002742152 | 244 |
| 180 | 3300005578 | Ga0068854_100261468 | Ga0068854_1002614682 | 244 |
| 181 | 3300005614 | Ga0068856_100000020 | Ga0068856_10000002077 | 244 |
| 182 | 3300005614 | Ga0068856_100259254 | Ga0068856_1002592542 | 244 |
| 183 | 3300005614 | Ga0068856_100683424 | Ga0068856_1006834242 | 244 |
| 184 | 3300005614 | Ga0068856_100776358 | Ga0068856_1007763581 | 244 |
| 185 | 3300005616 | Ga0068852_100010764 | Ga0068852_1000107649 | 244 |
| 186 | 3300005616 | Ga0068852_100310542 | Ga0068852_1003105422 | 244 |
| 187 | 3300005617 | Ga0068859_100139397 | Ga0068859_1001393971 | 244 |
| 188 | 3300005617 | Ga0068859_100153946 | Ga0068859_1001539462 | 244 |
| 189 | 3300005618 | Ga0068864_100039117 | Ga0068864_1000391172 | 244 |
| 190 | 3300005842 | Ga0068858_100077017 | Ga0068858_1000770171 | 244 |
| 191 | 3300005842 | Ga0068858_100229680 | Ga0068858_1002296802 | 244 |
| 192 | 3300005843 | Ga0068860_100406502 | Ga0068860_1004065022 | 244 |
| 193 | 3300005937 | Ga0081455_10006892 | Ga0081455_100068925 | 244 |
| 194 | 3300005937 | Ga0081455_10009515 | Ga0081455_100095153 | 244 |
| 195 | 3300005983 | Ga0081540_1010747 | Ga0081540_10107472 | 244 |
| 196 | 3300005983 | Ga0081540_1026295 | Ga0081540_10262954 | 244 |
| 197 | 3300005985 | Ga0081539_10000140 | Ga0081539_1000014019 | 244 |
| 198 | 3300006038 | Ga0075365_10125222 | Ga0075365_101252222 | 244 |
| 199 | 3300006048 | Ga0075363_100018624 | Ga0075363_1000186242 | 244 |
| 200 | 3300006051 | Ga0075364_10290946 | Ga0075364_102909462 | 244 |
| 201 | 3300006051 | Ga0075364_10414033 | Ga0075364_104140331 | 244 |
| 202 | 3300006178 | Ga0075367_10009081 | Ga0075367_100090814 | 244 |
| 203 | 3300006186 | Ga0075369_10006421 | Ga0075369_100064214 | 244 |
| 204 | 3300006195 | Ga0075366_10155224 | Ga0075366_101552242 | 244 |
| 205 | 3300006353 | Ga0075370_10095033 | Ga0075370_100950331 | 244 |
| 206 | 3300006358 | Ga0068871_100082771 | Ga0068871_1000827712 | 244 |
| 207 | 3300006852 | Ga0075433_10308092 | Ga0075433_103080922 | 244 |
| 208 | 3300006871 | Ga0075434_100263368 | Ga0075434_1002633682 | 244 |
| 209 | 3300006931 | Ga0097620_100139389 | Ga0097620_1001393891 | 244 |
| 210 | 3300006931 | Ga0097620_100153959 | Ga0097620_1001539592 | 244 |
| 211 | 3300009093 | Ga0105240_10089792 | Ga0105240_100897924 | 244 |
| 212 | 3300009098 | Ga0105245_10013893 | Ga0105245_100138937 | 244 |
| 213 | 3300009101 | Ga0105247_10110377 | Ga0105247_101103772 | 244 |
| 214 | 3300009176 | Ga0105242_10239148 | Ga0105242_102391482 | 244 |
| 215 | 3300009545 | Ga0105237_10174749 | Ga0105237_101747492 | 244 |
| 216 | 3300009545 | Ga0105237_10207526 | Ga0105237_102075262 | 244 |
| 217 | 3300009545 | Ga0105237_10255238 | Ga0105237_102552382 | 244 |
| 218 | 3300009545 | Ga0105237_10829411 | Ga0105237_108294112 | 244 |
| 219 | 3300009551 | Ga0105238_10023178 | Ga0105238_100231789 | 244 |
| 220 | 3300009551 | Ga0105238_10452128 | Ga0105238_104521282 | 244 |
| 221 | 3300013104 | Ga0157370_10034359 | Ga0157370_100343596 | 244 |
| 222 | 3300013104 | Ga0157370_10107534 | Ga0157370_101075343 | 244 |
| 223 | 3300013105 | Ga0157369_10026279 | Ga0157369_100262792 | 244 |
| 224 | 3300013105 | Ga0157369_10031264 | Ga0157369_100312646 | 244 |
| 225 | 3300013296 | Ga0157374_10506044 | Ga0157374_105060441 | 244 |
| 226 | 3300013297 | Ga0157378_10017318 | Ga0157378_100173183 | 244 |
| 227 | 3300013297 | Ga0157378_10526439 | Ga0157378_105264392 | 244 |
| 228 | 3300013297 | Ga0157378_10962067 | Ga0157378_109620672 | 244 |
| 229 | 3300013306 | Ga0163162_10040586 | Ga0163162_100405862 | 244 |
| 230 | 3300013306 | Ga0163162_10254813 | Ga0163162_102548132 | 244 |
| 231 | 3300013308 | Ga0157375_10048477 | Ga0157375_100484773 | 244 |
| 232 | 3300014325 | Ga0163163_10025783 | Ga0163163_100257832 | 244 |
| 233 | 3300014325 | Ga0163163_10103078 | Ga0163163_101030782 | 244 |
| 234 | 3300014326 | Ga0157380_10400053 | Ga0157380_104000532 | 244 |
| 235 | 3300014745 | Ga0157377_10144508 | Ga0157377_101445082 | 244 |
| 236 | 3300014968 | Ga0157379_10085510 | Ga0157379_100855102 | 244 |
| 237 | 3300014969 | Ga0157376_10065491 | Ga0157376_100654912 | 244 |
| 238 | 3300017792 | Ga0163161_10004994 | Ga0163161_1000499410 | 244 |
| 239 | 3300017792 | Ga0163161_10139174 | Ga0163161_101391741 | 244 |
| 240 | 3300017792 | Ga0163161_10146625 | Ga0163161_101466252 | 244 |
| 241 | 3300020069 | Ga0197907_10885475 | Ga0197907_108854751 | 244 |
| 242 | 3300020081 | Ga0206354_11326341 | Ga0206354_113263411 | 244 |
| 243 | 3300021361 | Ga0213872_10090103 | Ga0213872_100901032 | 244 |
| 244 | 3300021441 | Ga0213871_10021672 | Ga0213871_100216722 | 244 |
| 245 | 3300025253 | Ga0209677_101344 | Ga0209677_1013446 | 244 |
| 246 | 3300025272 | Ga0209455_1002715 | Ga0209455_10027153 | 244 |
| 247 | 3300025904 | Ga0207647_10145063 | Ga0207647_101450632 | 244 |
| 248 | 3300025907 | Ga0207645_10015221 | Ga0207645_100152212 | 244 |
| 249 | 3300025909 | Ga0207705_10031820 | Ga0207705_100318202 | 244 |
| 250 | 3300025912 | Ga0207707_10222147 | Ga0207707_102221472 | 244 |
| 251 | 3300025913 | Ga0207695_10045380 | Ga0207695_100453804 | 244 |
| 252 | 3300025914 | Ga0207671_10222145 | Ga0207671_102221452 | 244 |
| 253 | 3300025914 | Ga0207671_10363264 | Ga0207671_103632642 | 244 |
| 254 | 3300025914 | Ga0207671_10367513 | Ga0207671_103675132 | 244 |
| 255 | 3300025914 | Ga0207671_10569226 | Ga0207671_105692261 | 244 |
| 256 | 3300025915 | Ga0207693_10092177 | Ga0207693_100921771 | 244 |
| 257 | 3300025916 | Ga0207663_10045255 | Ga0207663_100452552 | 244 |
| 258 | 3300025917 | Ga0207660_10130470 | Ga0207660_101304702 | 244 |
| 259 | 3300025921 | Ga0207652_10023496 | Ga0207652_100234962 | 244 |
| 260 | 3300025923 | Ga0207681_10420820 | Ga0207681_104208201 | 244 |
| 261 | 3300025926 | Ga0207659_10559258 | Ga0207659_105592582 | 244 |
| 262 | 3300025927 | Ga0207687_10135313 | Ga0207687_101353132 | 244 |
| 263 | 3300025933 | Ga0207706_10011412 | Ga0207706_1001141210 | 244 |
| 264 | 3300025933 | Ga0207706_10088283 | Ga0207706_100882832 | 244 |
| 265 | 3300025934 | Ga0207686_10197363 | Ga0207686_101973632 | 244 |
| 266 | 3300025935 | Ga0207709_10114206 | Ga0207709_101142062 | 244 |
| 267 | 3300025936 | Ga0207670_10034272 | Ga0207670_100342721 | 244 |
| 268 | 3300025937 | Ga0207669_10081818 | Ga0207669_100818184 | 244 |
| 269 | 3300025939 | Ga0207665_10062883 | Ga0207665_100628832 | 244 |
| 270 | 3300025940 | Ga0207691_10158025 | Ga0207691_101580252 | 244 |
| 271 | 3300025942 | Ga0207689_10074676 | Ga0207689_100746762 | 244 |
| 272 | 3300025942 | Ga0207689_10336765 | Ga0207689_103367653 | 244 |
| 273 | 3300025944 | Ga0207661_10291056 | Ga0207661_102910562 | 244 |
| 274 | 3300025944 | Ga0207661_10305267 | Ga0207661_103052672 | 244 |
| 275 | 3300025945 | Ga0207679_10166363 | Ga0207679_101663632 | 244 |
| 276 | 3300025945 | Ga0207679_10401794 | Ga0207679_104017941 | 244 |
| 277 | 3300025949 | Ga0207667_10013915 | Ga0207667_100139156 | 244 |
| 278 | 3300025961 | Ga0207712_10104690 | Ga0207712_101046902 | 244 |
| 279 | 3300025972 | Ga0207668_10451259 | Ga0207668_104512591 | 244 |
| 280 | 3300025981 | Ga0207640_10205629 | Ga0207640_102056292 | 244 |
| 281 | 3300025986 | Ga0207658_10644475 | Ga0207658_106444751 | 244 |
| 282 | 3300026023 | Ga0207677_10111598 | Ga0207677_101115983 | 244 |
| 283 | 3300026035 | Ga0207703_10196776 | Ga0207703_101967762 | 244 |
| 284 | 3300026067 | Ga0207678_10017094 | Ga0207678_100170944 | 244 |
| 285 | 3300026067 | Ga0207678_10137111 | Ga0207678_101371112 | 244 |
| 286 | 3300026078 | Ga0207702_10000126 | Ga0207702_1000012671 | 244 |
| 287 | 3300026078 | Ga0207702_10773872 | Ga0207702_107738721 | 244 |
| 288 | 3300026089 | Ga0207648_10160447 | Ga0207648_101604473 | 244 |
| 289 | 3300026121 | Ga0207683_10021946 | Ga0207683_100219463 | 244 |
| 290 | 3300026121 | Ga0207683_10312945 | Ga0207683_103129452 | 244 |
| 291 | 3300026142 | Ga0207698_10209134 | Ga0207698_102091342 | 244 |
| 292 | 3300026142 | Ga0207698_10403512 | Ga0207698_104035122 | 244 |
| 293 | 3300028379 | Ga0268266_10002410 | Ga0268266_1000241018 | 244 |
| 294 | 3300028379 | Ga0268266_10053434 | Ga0268266_100534342 | 244 |
| 295 | 3300028379 | Ga0268266_10296161 | Ga0268266_102961612 | 244 |
| 296 | 3300028379 | Ga0268266_10699148 | Ga0268266_106991481 | 244 |
| 297 | 3300028381 | Ga0268264_10546557 | Ga0268264_105465571 | 244 |
| 298 | 3300028556 | Ga0265337_1002708 | Ga0265337_10027085 | 244 |
| 299 | 3300028558 | Ga0265326_10002939 | Ga0265326_100029398 | 244 |
| 300 | 3300028563 | Ga0265319_1017774 | Ga0265319_10177742 | 244 |
| 301 | 3300028577 | Ga0265318_10059818 | Ga0265318_100598182 | 244 |
| 302 | 3300028653 | Ga0265323_10001443 | Ga0265323_100014432 | 244 |
| 303 | 3300028794 | Ga0307515_10103560 | Ga0307515_101035601 | 244 |
| 304 | 3300028800 | Ga0265338_10000321 | Ga0265338_1000032115 | 244 |
| 305 | 3300029957 | Ga0265324_10002307 | Ga0265324_100023072 | 244 |
| 306 | 3300031711 | Ga0265314_10009423 | Ga0265314_100094233 | 244 |
| 307 | 3300031731 | Ga0307405_10194984 | Ga0307405_101949842 | 244 |
| 308 | 3300032005 | Ga0307411_10574057 | Ga0307411_105740571 | 244 |
| 309 | 3300032126 | Ga0307415_100264156 | Ga0307415_1002641562 | 244 |
| 310 | 3300035691 | Ga0373931_0095822 | Ga0373931_0095822_592_1326 | 244 |
| 311 | 3300035695 | Ga0373927_0240944 | Ga0373927_0240944_107_865 | 244 |
| 312 | 3300037068 | Ga0373925_0192602 | Ga0373925_0192602_148_882 | 244 |
| 313 | 3300037466 | Ga0395898_0020989 | Ga0395898_0020989_2493_3227 | 244 |
| 314 | 3300037471 | Ga0395905_0004739 | Ga0395905_0004739_13027_13761 | 244 |
| 315 | 3300039437 | Ga0436365_1781448 | Ga0436365_1781448_234_968 | 244 |
| 316 | 3300039438 | Ga0436360_0440158 | Ga0436360_0440158_98_832 | 244 |
| 317 | 3300039438 | Ga0436360_0598841 | Ga0436360_0598841_1701_2435 | 244 |
| 318 | 3300039438 | Ga0436360_0995601 | Ga0436360_0995601_1795_2529 | 244 |
| 319 | 3300039447 | Ga0436361_0898569 | Ga0436361_0898569_402_1136 | 244 |
| 320 | 3300039450 | Ga0436363_1424999 | Ga0436363_1424999_435_1169 | 244 |
| 321 | 3300041512 | Ga0451853_3516041 | Ga0451853_3516041_610_1356 | 244 |
| 322 | 3300044694 | Ga0466963_0465827 | Ga0466963_0465827_20_754 | 244 |
| 323 | 3300044706 | Ga0466964_0248605 | Ga0466964_0248605_50_784 | 244 |
| 324 | 3300044765 | Ga0466970_0078526 | Ga0466970_0078526_206_940 | 244 |
| 325 | 3300046459 | Ga0495629_0159506 | Ga0495629_0159506_472_1206 | 244 |
| 326 | 3300046459 | Ga0495629_0328936 | Ga0495629_0328936_241_987 | 244 |
| 327 | 3300046475 | Ga0495639_0190512 | Ga0495639_0190512_109_843 | 244 |
| 328 | 3300046477 | Ga0495664_0380873 | Ga0495664_0380873_67_801 | 244 |
| 329 | 3300046501 | Ga0495607_0207419 | Ga0495607_0207419_134_868 | 244 |
| 330 | 3300046507 | Ga0495606_0097847 | Ga0495606_0097847_99_833 | 244 |
| 331 | 3300046513 | Ga0495616_0102745 | Ga0495616_0102745_408_1142 | 244 |
| 332 | 3300046520 | Ga0495637_0037786 | Ga0495637_0037786_726_1460 | 244 |
| 333 | 3300046523 | Ga0495644_0036643 | Ga0495644_0036643_348_1082 | 244 |
| 334 | 3300046524 | Ga0495648_0006022 | Ga0495648_0006022_3138_3872 | 244 |
| 335 | 3300046524 | Ga0495648_0010085 | Ga0495648_0010085_949_1683 | 244 |
| 336 | 3300046530 | Ga0495654_0195216 | Ga0495654_0195216_104_838 | 244 |
| 337 | 3300046615 | Ga0495656_0016618 | Ga0495656_0016618_1850_2650 | 244 |
| 338 | 3300046615 | Ga0495656_0018780 | Ga0495656_0018780_1398_2132 | 244 |
| 339 | 3300046665 | Ga0495661_0013463 | Ga0495661_0013463_2130_2864 | 244 |
| 340 | 3300046674 | Ga0495588_0226315 | Ga0495588_0226315_153_899 | 244 |
| 341 | 3300046684 | Ga0495669_0003974 | Ga0495669_0003974_310_1044 | 244 |
| 342 | 3300046794 | Ga0495589_0178350 | Ga0495589_0178350_115_849 | 244 |
| 343 | 3300047317 | Ga0495604_0137270 | Ga0495604_0137270_952_1686 | 244 |
| 344 | 3300047472 | Ga0495686_0070960 | Ga0495686_0070960_217_951 | 244 |
| 345 | 3300047472 | Ga0495686_0118340 | Ga0495686_0118340_20_754 | 244 |
| 346 | 3300047472 | Ga0495686_0123916 | Ga0495686_0123916_345_1079 | 244 |
| 347 | 3300048089 | Ga0495614_0171839 | Ga0495614_0171839_105_839 | 244 |
| 348 | 3300048091 | Ga0495626_0024532 | Ga0495626_0024532_271_1005 | 244 |
| 349 | 3300048903 | Ga0496100_0005504 | Ga0496100_0005504_5997_6743 | 244 |
| 350 | 3300048904 | Ga0496101_0243958 | Ga0496101_0243958_123_857 | 244 |
| 351 | 3300048904 | Ga0496101_0322283 | Ga0496101_0322283_94_828 | 244 |
| 352 | 3300048904 | Ga0496101_0367951 | Ga0496101_0367951_226_972 | 244 |
| 353 | 3300048905 | Ga0496102_0027789 | Ga0496102_0027789_3802_4548 | 244 |
| 354 | 3300048905 | Ga0496102_0181130 | Ga0496102_0181130_1070_1804 | 244 |
| 355 | 3300048906 | Ga0496103_0057188 | Ga0496103_0057188_104_850 | 244 |
| 356 | 3300048907 | Ga0496104_0046593 | Ga0496104_0046593_64_798 | 244 |
| 357 | 3300048907 | Ga0496104_0072689 | Ga0496104_0072689_2274_3020 | 244 |
| 358 | 3300048907 | Ga0496104_0373977 | Ga0496104_0373977_46_780 | 244 |
| 359 | 3300048909 | Ga0496106_0004195 | Ga0496106_0004195_3478_4212 | 244 |
| 360 | 3300048909 | Ga0496106_0017519 | Ga0496106_0017519_478_1224 | 244 |
| 361 | 3300048909 | Ga0496106_0108902 | Ga0496106_0108902_1085_1819 | 244 |
| 362 | 3300048909 | Ga0496106_0343214 | Ga0496106_0343214_108_842 | 244 |
| 363 | 3300048909 | Ga0496106_0344620 | Ga0496106_0344620_367_1101 | 244 |
| 364 | 3300048910 | Ga0496107_0002006 | Ga0496107_0002006_2497_3243 | 244 |
| 365 | 3300048910 | Ga0496107_0005355 | Ga0496107_0005355_7146_7880 | 244 |
| 366 | 3300048910 | Ga0496107_0132749 | Ga0496107_0132749_1006_1740 | 244 |
| 367 | 3300048911 | Ga0496108_0000515 | Ga0496108_0000515_9692_10426 | 244 |
| 368 | 3300048911 | Ga0496108_0013623 | Ga0496108_0013623_4839_5573 | 244 |
| 369 | 3300048911 | Ga0496108_0038368 | Ga0496108_0038368_136_882 | 244 |
| 370 | 3300048911 | Ga0496108_0213391 | Ga0496108_0213391_480_1292 | 244 |
| 371 | 3300048912 | Ga0496109_0002891 | Ga0496109_0002891_8859_9593 | 244 |
| 372 | 3300048912 | Ga0496109_0026725 | Ga0496109_0026725_4206_4952 | 244 |
| 373 | 3300048912 | Ga0496109_0036450 | Ga0496109_0036450_3676_4410 | 244 |
| 374 | 3300048913 | Ga0496110_0005701 | Ga0496110_0005701_7260_8006 | 244 |
| 375 | 3300048913 | Ga0496110_0271297 | Ga0496110_0271297_299_1033 | 244 |
| 376 | 3300048913 | Ga0496110_0355549 | Ga0496110_0355549_243_1055 | 244 |
| 377 | 3300048914 | Ga0496111_0017931 | Ga0496111_0017931_3992_4738 | 244 |
| 378 | 3300048915 | Ga0496112_0020326 | Ga0496112_0020326_3399_4145 | 244 |
| 379 | 3300048915 | Ga0496112_0037801 | Ga0496112_0037801_324_1058 | 244 |
| 380 | 3300048915 | Ga0496112_0052978 | Ga0496112_0052978_534_1268 | 244 |
| 381 | 3300048916 | Ga0496113_0024908 | Ga0496113_0024908_2824_3558 | 244 |
| 382 | 3300048916 | Ga0496113_0071685 | Ga0496113_0071685_1728_2474 | 244 |
| 383 | 3300048917 | Ga0496114_0010127 | Ga0496114_0010127_6565_7311 | 244 |
| 384 | 3300048918 | Ga0496115_0141901 | Ga0496115_0141901_1005_1739 | 244 |
| 385 | 3300048918 | Ga0496115_0147056 | Ga0496115_0147056_1115_1849 | 244 |
| 386 | 3300048919 | Ga0496116_0001829 | Ga0496116_0001829_10279_11013 | 244 |
| 387 | 3300048920 | Ga0496117_0007856 | Ga0496117_0007856_2190_2924 | 244 |
| 388 | 3300048920 | Ga0496117_0117202 | Ga0496117_0117202_885_1619 | 244 |
| 389 | 3300048920 | Ga0496117_0230339 | Ga0496117_0230339_264_998 | 244 |
| 390 | 3300048921 | Ga0496118_0015402 | Ga0496118_0015402_2937_3671 | 244 |
| 391 | 3300048921 | Ga0496118_0108024 | Ga0496118_0108024_99_833 | 244 |
| 392 | 3300048921 | Ga0496118_0145757 | Ga0496118_0145757_62_796 | 244 |
| 393 | 3300048921 | Ga0496118_0168263 | Ga0496118_0168263_425_1159 | 244 |
| 394 | 3300048921 | Ga0496118_0225040 | Ga0496118_0225040_116_850 | 244 |
| 395 | 3300048922 | Ga0496119_0033429 | Ga0496119_0033429_832_1566 | 244 |
| 396 | 3300048922 | Ga0496119_0082850 | Ga0496119_0082850_61_795 | 244 |
| 397 | 3300048923 | Ga0496120_0054282 | Ga0496120_0054282_995_1729 | 244 |
| 398 | 3300048924 | Ga0496121_0028099 | Ga0496121_0028099_3634_4368 | 244 |
| 399 | 3300048924 | Ga0496121_0055004 | Ga0496121_0055004_259_993 | 244 |
| 400 | 3300048924 | Ga0496121_0176744 | Ga0496121_0176744_691_1452 | 244 |
| 401 | 3300048924 | Ga0496121_0184353 | Ga0496121_0184353_440_1174 | 244 |
| 402 | 3300048924 | Ga0496121_0318592 | Ga0496121_0318592_25_759 | 244 |
| 403 | 3300048924 | Ga0496121_0351124 | Ga0496121_0351124_132_866 | 244 |
| 404 | 3300048925 | Ga0496122_0039811 | Ga0496122_0039811_1077_1811 | 244 |
| 405 | 3300048926 | Ga0496123_0016479 | Ga0496123_0016479_3141_3875 | 244 |
| 406 | 3300048927 | Ga0496124_0340615 | Ga0496124_0340615_77_838 | 244 |
| 407 | 3300048928 | Ga0496125_0001496 | Ga0496125_0001496_24902_25636 | 244 |
| 408 | 3300048928 | Ga0496125_0016993 | Ga0496125_0016993_5684_6418 | 244 |
| 409 | 3300048928 | Ga0496125_0123130 | Ga0496125_0123130_241_1002 | 244 |
| 410 | 3300048928 | Ga0496125_0132736 | Ga0496125_0132736_240_974 | 244 |
| 411 | 3300048929 | Ga0496126_0004659 | Ga0496126_0004659_12548_13282 | 244 |
| 412 | 3300048929 | Ga0496126_0004802 | Ga0496126_0004802_1612_2346 | 244 |
| 413 | 3300048929 | Ga0496126_0013697 | Ga0496126_0013697_3310_4044 | 244 |
| 414 | 3300048929 | Ga0496126_0073382 | Ga0496126_0073382_1473_2207 | 244 |
| 415 | 3300048929 | Ga0496126_0462120 | Ga0496126_0462120_239_973 | 244 |
| 416 | 3300049574 | Ga0501038_0525926 | Ga0501038_0525926_116_865 | 244 |
| 417 | 3300049586 | Ga0501070_0256107 | Ga0501070_0256107_77_811 | 244 |
| 418 | 3300049823 | Ga0501044_0175170 | Ga0501044_0175170_1220_1969 | 244 |
| 419 | 3300050489 | nmdc:mga03683_55947_c1 | nmdc:mga03683_55947_c1_738_1472 | 244 |
| 420 | 3300050490 | nmdc:mga03n38_15412_c1 | nmdc:mga03n38_15412_c1_1709_2443 | 244 |
| 421 | 3300050491 | nmdc:mga00v17_43269_c1 | nmdc:mga00v17_43269_c1_1361_2095 | 244 |
| 422 | 3300050492 | nmdc:mga0yw44_17878_c1 | nmdc:mga0yw44_17878_c1_696_1430 | 244 |
| 423 | 3300050492 | nmdc:mga0yw44_27450_c1 | nmdc:mga0yw44_27450_c1_184_978 | 244 |
| 424 | 3300050493 | nmdc:mga0k408_81990_c1 | nmdc:mga0k408_81990_c1_992_1726 | 244 |
| 425 | 3300050494 | nmdc:mga06z11_12083_c1 | nmdc:mga06z11_12083_c1_1764_2498 | 244 |
| 426 | 3300050496 | nmdc:mga07m45_240719_c1 | nmdc:mga07m45_240719_c1_77_811 | 244 |
| 427 | 3300050496 | nmdc:mga07m45_33009_c1 | nmdc:mga07m45_33009_c1_1521_2315 | 244 |
| 428 | 3300050496 | nmdc:mga07m45_83717_c1 | nmdc:mga07m45_83717_c1_10_744 | 244 |
| 429 | 3300050516 | nmdc:mga0sz30_12928_c1 | nmdc:mga0sz30_12928_c1_875_1609 | 244 |
| 430 | 3300053077 | Ga0495601_0246013 | Ga0495601_0246013_420_1154 | 244 |
| 431 | 3300053080 | Ga0500635_0017639 | Ga0500635_0017639_1299_2063 | 244 |
| 432 | 3300053083 | Ga0495655_0024302 | Ga0495655_0024302_37_771 | 244 |
| 433 | 3300053087 | Ga0500643_011918 | Ga0500643_011918_2349_3083 | 244 |
| 434 | 3300053087 | Ga0500643_039277 | Ga0500643_039277_16_750 | 244 |
| 435 | 3300053088 | Ga0500644_0030134 | Ga0500644_0030134_169_903 | 244 |
| 436 | 3300053090 | Ga0500646_0001906 | Ga0500646_0001906_639_1373 | 244 |
| 437 | 3300053092 | Ga0500583_0130008 | Ga0500583_0130008_426_1160 | 244 |
| 438 | 3300053093 | Ga0500651_0028017 | Ga0500651_0028017_1700_2434 | 244 |
| 439 | 3300053093 | Ga0500651_0069697 | Ga0500651_0069697_1079_1813 | 244 |
| 440 | 3300053094 | Ga0500566_0000006 | Ga0500566_0000006_85321_86055 | 244 |
| 441 | 3300053094 | Ga0500566_0005667 | Ga0500566_0005667_3983_4717 | 244 |
| 442 | 3300053095 | Ga0500640_007569 | Ga0500640_007569_2183_2917 | 244 |
| 443 | 3300053096 | Ga0500641_0003983 | Ga0500641_0003983_1997_2731 | 244 |
| 444 | 3300053098 | Ga0500650_0000139 | Ga0500650_0000139_1646_2380 | 244 |
| 445 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_410355_411089 | 244 |
| 446 | 3300053109 | Ga0500569_002513 | Ga0500569_002513_2593_3327 | 244 |
| 447 | 3300053111 | Ga0500572_000674 | Ga0500572_000674_7718_8452 | 244 |
| 448 | 3300053113 | Ga0500580_055306 | Ga0500580_055306_271_1005 | 244 |
| 449 | 3300053115 | Ga0500591_130165 | Ga0500591_130165_162_896 | 244 |
| 450 | 3300053117 | Ga0500593_060635 | Ga0500593_060635_696_1430 | 244 |
| 451 | 3300053122 | Ga0500608_000349 | Ga0500608_000349_14619_15353 | 244 |
| 452 | 3300053123 | Ga0500614_001760 | Ga0500614_001760_3332_4066 | 244 |
| 453 | 3300053125 | Ga0500618_024219 | Ga0500618_024219_392_1126 | 244 |
| 454 | 3300053130 | Ga0500642_0000016 | Ga0500642_0000016_123198_123932 | 244 |
| 455 | 3300053131 | Ga0500652_000646 | Ga0500652_000646_2911_3645 | 244 |
| 456 | 3300053134 | Ga0500658_0101795 | Ga0500658_0101795_184_918 | 244 |
| 457 | 3300053136 | Ga0500559_0000699 | Ga0500559_0000699_18642_19376 | 244 |
| 458 | 3300053136 | Ga0500559_0010680 | Ga0500559_0010680_1576_2310 | 244 |
| 459 | 3300053138 | Ga0500564_172151 | Ga0500564_172151_69_803 | 244 |
| 460 | 3300053139 | Ga0500568_0002572 | Ga0500568_0002572_4619_5353 | 244 |
| 461 | 3300053142 | Ga0500577_0002860 | Ga0500577_0002860_2657_3391 | 244 |
| 462 | 3300053148 | Ga0500590_128939 | Ga0500590_128939_67_831 | 244 |
| 463 | 3300053151 | Ga0500604_0023561 | Ga0500604_0023561_816_1550 | 244 |
| 464 | 3300053153 | Ga0500616_0000061 | Ga0500616_0000061_218837_219571 | 244 |
| 465 | 3300053156 | Ga0500622_0000916 | Ga0500622_0000916_8173_8907 | 244 |
| 466 | 3300053159 | Ga0500630_000571 | Ga0500630_000571_10622_11356 | 244 |
| 467 | 3300053160 | Ga0500633_0013107 | Ga0500633_0013107_1474_2208 | 244 |
| 468 | 3300053163 | Ga0500639_000016 | Ga0500639_000016_68911_69645 | 244 |
| 469 | 3300053177 | Ga0500636_0000963 | Ga0500636_0000963_10600_11334 | 244 |
| 470 | 3300053177 | Ga0500636_0025991 | Ga0500636_0025991_1190_1924 | 244 |
| 471 | 3300053177 | Ga0500636_0077317 | Ga0500636_0077317_263_1030 | 244 |
| 472 | 3300053177 | Ga0500636_0112898 | Ga0500636_0112898_63_797 | 244 |
| 473 | 3300053177 | Ga0500636_0125447 | Ga0500636_0125447_379_1113 | 244 |
| 474 | 3300053730 | Ga0500645_039978 | Ga0500645_039978_26_760 | 244 |
| 475 | 3300053735 | Ga0500596_001348 | Ga0500596_001348_3571_4305 | 244 |
| 476 | 3300005367 | Ga0070667_100004052 | Ga0070667_10000405212 | 245 |
| 477 | 3300009177 | Ga0105248_11089428 | Ga0105248_110894281 | 245 |
| 478 | 3300013308 | Ga0157375_10053711 | Ga0157375_100537113 | 245 |
| 479 | 3300025899 | Ga0207642_10190762 | Ga0207642_101907621 | 245 |
| 480 | 3300025986 | Ga0207658_10188243 | Ga0207658_101882432 | 245 |
| 481 | 3300026095 | Ga0207676_10734868 | Ga0207676_107348682 | 245 |
| 482 | 3300035398 | Ga0316574_0180803 | Ga0316574_0180803_77_826 | 245 |
| 483 | 3300037068 | Ga0373925_0027573 | Ga0373925_0027573_2790_3557 | 245 |
| 484 | 3300045051 | Ga0451576_0003892 | Ga0451576_0003892_15633_16370 | 245 |
| 485 | 3300005330 | Ga0070690_100040624 | Ga0070690_1000406241 | 246 |
| 486 | 3300009176 | Ga0105242_10194426 | Ga0105242_101944262 | 246 |
| 487 | 3300009177 | Ga0105248_10112704 | Ga0105248_101127042 | 246 |
| 488 | 3300014497 | Ga0182008_10000949 | Ga0182008_1000094917 | 246 |
| 489 | 3300017792 | Ga0163161_10017594 | Ga0163161_100175944 | 246 |
| 490 | 3300028786 | Ga0307517_10133837 | Ga0307517_101338372 | 246 |
| 491 | 3300032005 | Ga0307411_10401616 | Ga0307411_104016162 | 246 |
| 492 | 3300035089 | Ga0373944_0103922 | Ga0373944_0103922_35_799 | 246 |
| 493 | 3300037068 | Ga0373925_0281199 | Ga0373925_0281199_165_929 | 246 |
| 494 | 3300039438 | Ga0436360_0420953 | Ga0436360_0420953_696_1436 | 246 |
| 495 | 3300046476 | Ga0495662_0260828 | Ga0495662_0260828_44_808 | 246 |
| 496 | 3300046520 | Ga0495637_0023384 | Ga0495637_0023384_94_849 | 246 |
| 497 | 3300046558 | Ga0495633_0000204 | Ga0495633_0000204_8181_8936 | 246 |
| 498 | 3300048907 | Ga0496104_0073802 | Ga0496104_0073802_364_1128 | 246 |
| 499 | 3300048925 | Ga0496122_0023924 | Ga0496122_0023924_1117_1872 | 246 |
| 500 | 3300049460 | Ga0495682_0003951 | Ga0495682_0003951_5685_6440 | 246 |
| 501 | 3300002987 | JGI25159J45721_1001367 | JGI25159J45721_10013679 | 247 |
| 502 | 3300003354 | JGI25160J50197_1000034 | JGI25160J50197_1000034105 | 247 |
| 503 | 3300003374 | JGI25161J50226_1000019 | JGI25161J50226_100001972 | 247 |
| 504 | 3300004625 | Ga0055543_1000018 | Ga0055543_1000018105 | 247 |
| 505 | 3300005262 | Ga0065165_1000121 | Ga0065165_1000121105 | 247 |
| 506 | 3300025284 | Ga0209130_1000077 | Ga0209130_1000077102 | 247 |
| 507 | 3300025302 | Ga0207426_1000054 | Ga0207426_1000054102 | 247 |
| 508 | 3300028794 | Ga0307515_10007623 | Ga0307515_1000762317 | 247 |
| 509 | 3300031456 | Ga0307513_10006015 | Ga0307513_100060157 | 247 |
| 510 | 3300031456 | Ga0307513_10064249 | Ga0307513_100642493 | 247 |
| 511 | 3300046474 | Ga0495605_0001288 | Ga0495605_0001288_6776_7519 | 247 |
| 512 | 3300046506 | Ga0495583_0022115 | Ga0495583_0022115_1370_2113 | 247 |
| 513 | 3300046507 | Ga0495606_0005352 | Ga0495606_0005352_7905_8648 | 247 |
| 514 | 3300046515 | Ga0495620_0015287 | Ga0495620_0015287_1245_1988 | 247 |
| 515 | 3300046518 | Ga0495631_0001980 | Ga0495631_0001980_10097_10840 | 247 |
| 516 | 3300046519 | Ga0495632_0006772 | Ga0495632_0006772_1380_2123 | 247 |
| 517 | 3300046538 | Ga0495609_0027161 | Ga0495609_0027161_1333_2076 | 247 |
| 518 | 3300046616 | Ga0495668_0003287 | Ga0495668_0003287_2647_3390 | 247 |
| 519 | 3300046648 | Ga0495611_0009602 | Ga0495611_0009602_1484_2227 | 247 |
| 520 | 3300046660 | Ga0495625_0004637 | Ga0495625_0004637_9588_10331 | 247 |
| 521 | 3300046660 | Ga0495625_0118036 | Ga0495625_0118036_494_1237 | 247 |
| 522 | 3300046810 | Ga0495660_0009927 | Ga0495660_0009927_1312_2055 | 247 |
| 523 | 3300047320 | Ga0495672_0035815 | Ga0495672_0035815_2134_2877 | 247 |
| 524 | 3300048922 | Ga0496119_0031271 | Ga0496119_0031271_2525_3268 | 247 |
| 525 | 3300048924 | Ga0496121_0069807 | Ga0496121_0069807_1187_1930 | 247 |
| 526 | 3300048925 | Ga0496122_0110163 | Ga0496122_0110163_514_1257 | 247 |
| 527 | 3300049459 | Ga0495678_011013 | Ga0495678_011013_1068_1811 | 247 |
| 528 | 3300053079 | Ga0500610_0201791 | Ga0500610_0201791_171_914 | 247 |
| 529 | 3300053104 | Ga0500556_0090189 | Ga0500556_0090189_350_1093 | 247 |
| 530 | 3300053108 | Ga0500562_027170 | Ga0500562_027170_169_912 | 247 |
| 531 | 3300053118 | Ga0500594_0038243 | Ga0500594_0038243_322_1065 | 247 |
| 532 | 3300053139 | Ga0500568_0000109 | Ga0500568_0000109_43407_44150 | 247 |
| 533 | 3300053146 | Ga0500588_0046197 | Ga0500588_0046197_44_787 | 247 |
| 534 | 3300053153 | Ga0500616_0000472 | Ga0500616_0000472_41294_42037 | 247 |
| 535 | 3300053156 | Ga0500622_0164846 | Ga0500622_0164846_153_896 | 247 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ag5-assembly1.cif.gz_D | crystal structure of human dhrs6 | 0.979 | 4 | 245 |
| 2ag5-assembly1.cif.gz_D | crystal structure of human dhrs6 | 0.9672 | 4 | 245 |
| 4yqz-assembly1.cif.gz_B | crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form | 0.9578 | 4 | 243 |
| 4yqz-assembly1.cif.gz_D | crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form | 0.9566 | 4 | 243 |
| 5t2u-assembly1.cif.gz_B | short chain dehydrogenase/reductase family protein | 0.9494 | 4 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ag5D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.979 | 4 | 245 | 3.40.50.720 |
| 2ag5D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9672 | 4 | 245 | 3.40.50.720 |
| 4yqzB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9553 | 5 | 243 | 3.40.50.720 |
| 5t2uB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9494 | 4 | 243 | 3.40.50.720 |
| 5jc8D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9473 | 4 | 247 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519GZL5-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9908 | 4 | 183 |
GO:0016491
|
| AF-A0A091D5V5-F1-model_v4 | Dehydrogenase/reductase SDR family member 6 (EC 1.1.1.104) (EC 1.1.1.30) ((R)-beta-hydroxybutyrate dehydrogenase) (3-hydroxybutyrate dehydrogenase type 2) (4-oxo-L-proline reductase) (Oxidoreductase UCPA) (Short chain dehydrogenase/reductase family 15C member 1) | 0.9905 | 4 | 179 |
GO:0003858
GO:0005737 GO:0019290 |
| AF-A0A3Q7V0S1-F1-model_v4 | deleted | 0.9903 | 4 | 120 |
|
| AF-Z4YIQ5-F1-model_v4 | deleted | 0.9887 | 4 | 178 |
|
| AF-A0A091TZD9-F1-model_v4 | Dehydrogenase/reductase SDR family member 6 (EC 1.1.1.104) (EC 1.1.1.30) ((R)-beta-hydroxybutyrate dehydrogenase) (3-hydroxybutyrate dehydrogenase type 2) (4-oxo-L-proline reductase) (Oxidoreductase UCPA) (Short chain dehydrogenase/reductase family 15C member 1) | 0.9867 | 27 | 179 |
GO:0003858
GO:0005737 GO:0019290 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar