F460659

General Info

Members Datasets Scaffolds Average Seq Length
535 335 505 244

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10506044|Ga0157374_105060441
Length 270
Sequence VPHGENGLLRRFAPRHDERGNEEKKIMSDRLRGKRAFVTAAAVGIGRACAVAFAREGATVFATDIDEAKLAALKSEGIAEVARLDARDSAAVAAMAKRAGQTDILLNAAGFVHHGTVLDCSDEDFDFSFDLNVKSMHRTIRSFLPGMLENGRGSIVNIASAAGVFKAAPNRYVYGATKAAVAALTRSVATDFITRGVRCNCICPGTIETPSMLERAAAAGPNGREMFIARQPMGRLGTAEEIASLAVYLASDESAFTTGVAHVIDGGWTL

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
5 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
6 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
7 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
8 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
9 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
10 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
11 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
12 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
13 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
14 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
15 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
16 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
17 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
18 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
19 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
20 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
21 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
22 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
23 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
24 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
114 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
163 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
164 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
167 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
182 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
215 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
239 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
262 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
267 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
279 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
280 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
285 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
286 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
287 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
288 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
289 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
290 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
291 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
292 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
293 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
294 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
295 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
296 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
297 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
298 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
299 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
300 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
301 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
302 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
303 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
304 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
305 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
306 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
307 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
308 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
309 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
310 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
311 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
312 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
313 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
314 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
315 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
316 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
317 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
318 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
319 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
320 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
323 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
324 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
325 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
326 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
327 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
328 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
329 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
330 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
331 641522639 Methylobacterium sp. 4-46 Isolate Nodule
332 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
333 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
334 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
335 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.19
Metatranscriptomes 0.37
Isolates 5.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.5
Nodule 2.8
Rhizoplane 7.66
Rhizosphere 56.45
Stem 0
Stem Tuber 0
Unclassified 11.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1001367 3300002987 Bacteria 10181
2 JGI25160J50197_1000034 3300003354 Bacteria 169670
3 JGI25161J50226_1000019 3300003374 Bacteria 169670
4 Ga0055543_1000018 3300004625 Bacteria 169708
5 Ga0065165_1000121 3300005262 Bacteria 134128
6 Ga0070658_10042588 3300005327 Bacteria 3668
7 Ga0070683_100718298 3300005329 Bacteria 957
8 Ga0070690_100040624 3300005330 Bacteria 2942
9 Ga0070690_100143648 3300005330 Bacteria 1622
10 Ga0068869_100131609 3300005334 Bacteria 1923
11 Ga0068869_100641479 3300005334 Bacteria 901
12 Ga0070680_100080116 3300005336 Bacteria 2693
13 Ga0070682_100225490 3300005337 Bacteria 1337
14 Ga0070682_100262890 3300005337 Bacteria 1250
15 Ga0070660_100104431 3300005339 Bacteria 2248
16 Ga0070689_100257795 3300005340 Bacteria 1441
17 Ga0070668_100014095 3300005347 Bacteria 5976
18 Ga0070669_100320831 3300005353 Bacteria 1251
19 Ga0070675_100830450 3300005354 Bacteria 845
20 Ga0070671_100065906 3300005355 Bacteria 3017
21 Ga0070671_100308001 3300005355 Bacteria 1349
22 Ga0070673_100227767 3300005364 Bacteria 1616
23 Ga0070688_100095286 3300005365 Bacteria 1953
24 Ga0070688_100290257 3300005365 Bacteria 1178
25 Ga0070659_100243663 3300005366 Bacteria 1488
26 Ga0070667_100004052 3300005367 Bacteria 12388
27 Ga0070667_100698167 3300005367 Bacteria 939
28 Ga0070710_10093963 3300005437 Bacteria 1773
29 Ga0070663_100027800 3300005455 Bacteria 3844
30 Ga0070663_100071769 3300005455 Bacteria 2520
31 Ga0070678_100074298 3300005456 Bacteria 2554
32 Ga0070662_100073159 3300005457 Bacteria 2532
33 Ga0070681_10068876 3300005458 Bacteria 3505
34 Ga0070685_10517574 3300005466 Bacteria 847
35 Ga0070707_100126270 3300005468 Bacteria 2486
36 Ga0070679_100056914 3300005530 Bacteria 3896
37 Ga0070684_100248713 3300005535 Bacteria 1625
38 Ga0068853_100112046 3300005539 Bacteria 2425
39 Ga0070672_100157897 3300005543 Bacteria 1879
40 Ga0070686_100123250 3300005544 Bacteria 1782
41 Ga0070665_100116587 3300005548 Bacteria 2673
42 Ga0070665_100141873 3300005548 Bacteria 2405
43 Ga0070665_100303901 3300005548 Bacteria 1598
44 Ga0070704_100491987 3300005549 Bacteria 1063
45 Ga0068855_100015651 3300005563 Bacteria 9126
46 Ga0070664_100113945 3300005564 Bacteria 2362
47 Ga0070664_100274215 3300005564 Bacteria 1520
48 Ga0068857_100072314 3300005577 Bacteria 3073
49 Ga0068857_100794332 3300005577 Bacteria 903
50 Ga0068854_100038548 3300005578 Bacteria 3362
51 Ga0068854_100261468 3300005578 Bacteria 1386
52 Ga0068856_100000020 3300005614 Bacteria 146775
53 Ga0068856_100259254 3300005614 Bacteria 1754
54 Ga0068856_100683424 3300005614 Bacteria 1047
55 Ga0068856_100776358 3300005614 Bacteria 978
56 Ga0068852_100010764 3300005616 Bacteria 6849
57 Ga0068852_100039543 3300005616 Bacteria 3972
58 Ga0068852_100310542 3300005616 Bacteria 1529
59 Ga0068859_100139397 3300005617 Bacteria 2499
60 Ga0068859_100153946 3300005617 Bacteria 2375
61 Ga0068864_100039117 3300005618 Bacteria 4053
62 Ga0068858_100077017 3300005842 Bacteria 3098
63 Ga0068858_100229680 3300005842 Bacteria 1759
64 Ga0068860_100406502 3300005843 Bacteria 1347
65 Ga0068862_100302885 3300005844 Bacteria 1471
66 Ga0068862_100428821 3300005844 Bacteria 1242
67 Ga0081455_10006892 3300005937 Bacteria 12092
68 Ga0081455_10009515 3300005937 Bacteria 9986
69 Ga0081540_1010747 3300005983 Bacteria 6162
70 Ga0081540_1026295 3300005983 Bacteria 3324
71 Ga0081539_10000140 3300005985 Bacteria 166746
72 Ga0070717_10013888 3300006028 Bacteria 6185
73 Ga0075365_10125222 3300006038 Bacteria 1775
74 Ga0075368_10074851 3300006042 Bacteria 1372
75 Ga0075363_100018624 3300006048 Bacteria 3463
76 Ga0075363_100033643 3300006048 Bacteria 2671
77 Ga0075363_100065833 3300006048 Bacteria 1960
78 Ga0075364_10290946 3300006051 Bacteria 1112
79 Ga0075364_10414033 3300006051 Bacteria 920
80 Ga0075362_10041023 3300006177 Bacteria 2039
81 Ga0075362_10043018 3300006177 Bacteria 1999
82 Ga0075367_10007260 3300006178 Bacteria 5664
83 Ga0075367_10009081 3300006178 Bacteria 5178
84 Ga0075367_10044514 3300006178 Bacteria 2602
85 Ga0075367_10153925 3300006178 Bacteria 1428
86 Ga0075369_10006421 3300006186 Bacteria 4442
87 Ga0075369_10014572 3300006186 Bacteria 3144
88 Ga0075366_10028470 3300006195 Bacteria 3279
89 Ga0075366_10155224 3300006195 Bacteria 1386
90 Ga0075370_10001906 3300006353 Bacteria 9384
91 Ga0075370_10085208 3300006353 Bacteria 1819
92 Ga0075370_10092005 3300006353 Bacteria 1750
93 Ga0075370_10095033 3300006353 Bacteria 1721
94 Ga0068871_100082771 3300006358 Bacteria 2661
95 Ga0075433_10308092 3300006852 Bacteria 1402
96 Ga0075434_100025857 3300006871 Bacteria 5746
97 Ga0075434_100263368 3300006871 Bacteria 1743
98 Ga0097620_100139389 3300006931 Bacteria 2499
99 Ga0097620_100153959 3300006931 Bacteria 2375
100 Ga0105240_10089792 3300009093 Bacteria 3757
101 Ga0105245_10013893 3300009098 Bacteria 7013
102 Ga0105247_10110377 3300009101 Bacteria 1770
103 Ga0105243_10094312 3300009148 Bacteria 2471
104 Ga0105242_10194426 3300009176 Bacteria 1798
105 Ga0105242_10239148 3300009176 Bacteria 1631
106 Ga0105248_10112704 3300009177 Bacteria 3067
107 Ga0105248_11089428 3300009177 Bacteria 903
108 Ga0105237_10023051 3300009545 Bacteria 6383
109 Ga0105237_10174749 3300009545 Bacteria 2148
110 Ga0105237_10207526 3300009545 Bacteria 1959
111 Ga0105237_10255238 3300009545 Bacteria 1755
112 Ga0105237_10383644 3300009545 Bacteria 1410
113 Ga0105237_10829411 3300009545 Bacteria 931
114 Ga0105238_10023178 3300009551 Bacteria 6330
115 Ga0105238_10055219 3300009551 Bacteria 3988
116 Ga0105238_10452128 3300009551 Bacteria 1281
117 Ga0105239_10021983 3300010375 Bacteria 7031
118 Ga0157370_10034359 3300013104 Bacteria 4939
119 Ga0157370_10107534 3300013104 Bacteria 2609
120 Ga0157369_10026279 3300013105 Bacteria 6459
121 Ga0157369_10031264 3300013105 Bacteria 5864
122 Ga0157374_10506044 3300013296 Bacteria 1213
123 Ga0157378_10017318 3300013297 Bacteria 6321
124 Ga0157378_10513358 3300013297 Bacteria 1199
125 Ga0157378_10526439 3300013297 Bacteria 1184
126 Ga0157378_10962067 3300013297 Bacteria 887
127 Ga0163162_10040586 3300013306 Bacteria 4654
128 Ga0163162_10254813 3300013306 Bacteria 1887
129 Ga0157375_10048477 3300013308 Bacteria 4156
130 Ga0157375_10053711 3300013308 Bacteria 3965
131 Ga0163163_10025783 3300014325 Bacteria 5608
132 Ga0163163_10103078 3300014325 Bacteria 2878
133 Ga0157380_10400053 3300014326 Bacteria 1303
134 Ga0182008_10000949 3300014497 Bacteria 20195
135 Ga0182008_10131686 3300014497 Unclassified 1247
136 Ga0157377_10144508 3300014745 Bacteria 1465
137 Ga0157379_10085510 3300014968 Bacteria 2827
138 Ga0157376_10065491 3300014969 Bacteria 3069
139 Ga0163161_10004994 3300017792 Bacteria 9229
140 Ga0163161_10017594 3300017792 Bacteria 5004
141 Ga0163161_10139174 3300017792 Bacteria 1837
142 Ga0163161_10146625 3300017792 Bacteria 1791
143 Ga0197907_10885475 3300020069 Bacteria 1704
144 Ga0206354_11326341 3300020081 Bacteria 924
145 Ga0213872_10090103 3300021361 Bacteria 1373
146 Ga0213871_10021672 3300021441 Bacteria 1603
147 Ga0209677_101344 3300025253 Bacteria 10806
148 Ga0209455_1002715 3300025272 Bacteria 6646
149 Ga0209130_1000077 3300025284 Bacteria 169722
150 Ga0207426_1000054 3300025302 Bacteria 384435
151 Ga0207692_10186786 3300025898 Bacteria 1211
152 Ga0207642_10190762 3300025899 Bacteria 1124
153 Ga0207647_10145063 3300025904 Bacteria 1390
154 Ga0207645_10015221 3300025907 Bacteria 5120
155 Ga0207705_10031820 3300025909 Bacteria 3768
156 Ga0207707_10222147 3300025912 Bacteria 1644
157 Ga0207695_10045380 3300025913 Bacteria 4665
158 Ga0207695_10153996 3300025913 Bacteria 2235
159 Ga0207671_10035838 3300025914 Bacteria 3679
160 Ga0207671_10120721 3300025914 Bacteria 2003
161 Ga0207671_10222145 3300025914 Bacteria 1480
162 Ga0207671_10363264 3300025914 Bacteria 1149
163 Ga0207671_10367513 3300025914 Bacteria 1142
164 Ga0207671_10569226 3300025914 Bacteria 903
165 Ga0207693_10092177 3300025915 Bacteria 2375
166 Ga0207693_10144885 3300025915 Bacteria 1868
167 Ga0207663_10045255 3300025916 Bacteria 2706
168 Ga0207660_10130470 3300025917 Bacteria 1912
169 Ga0207652_10023496 3300025921 Bacteria 5108
170 Ga0207681_10420820 3300025923 Bacteria 1082
171 Ga0207659_10559258 3300025926 Bacteria 973
172 Ga0207687_10135313 3300025927 Bacteria 1863
173 Ga0207700_10091012 3300025928 Bacteria 2409
174 Ga0207700_10870900 3300025928 Bacteria 806
175 Ga0207644_10073826 3300025931 Bacteria 2502
176 Ga0207706_10011412 3300025933 Bacteria 8094
177 Ga0207706_10088283 3300025933 Bacteria 2726
178 Ga0207706_10091551 3300025933 Bacteria 2673
179 Ga0207686_10197363 3300025934 Bacteria 1439
180 Ga0207709_10076157 3300025935 Bacteria 2147
181 Ga0207709_10114206 3300025935 Bacteria 1812
182 Ga0207670_10034272 3300025936 Bacteria 3279
183 Ga0207669_10081818 3300025937 Bacteria 2070
184 Ga0207665_10062883 3300025939 Bacteria 2519
185 Ga0207665_10506905 3300025939 Bacteria 933
186 Ga0207691_10158025 3300025940 Bacteria 1990
187 Ga0207689_10074522 3300025942 Bacteria 2789
188 Ga0207689_10074676 3300025942 Bacteria 2786
189 Ga0207689_10336765 3300025942 Bacteria 1253
190 Ga0207661_10291056 3300025944 Bacteria 1462
191 Ga0207661_10305267 3300025944 Bacteria 1428
192 Ga0207679_10166363 3300025945 Bacteria 1811
193 Ga0207679_10401794 3300025945 Bacteria 1205
194 Ga0207667_10013915 3300025949 Bacteria 9192
195 Ga0207712_10104690 3300025961 Bacteria 2110
196 Ga0207668_10451259 3300025972 Bacteria 1097
197 Ga0207640_10134168 3300025981 Bacteria 1794
198 Ga0207640_10205629 3300025981 Bacteria 1495
199 Ga0207658_10188243 3300025986 Bacteria 1713
200 Ga0207658_10191844 3300025986 Bacteria 1699
201 Ga0207658_10644475 3300025986 Bacteria 954
202 Ga0207677_10111598 3300026023 Bacteria 2038
203 Ga0207703_10196776 3300026035 Bacteria 1789
204 Ga0207639_10277629 3300026041 Bacteria 1472
205 Ga0207678_10017094 3300026067 Bacteria 6370
206 Ga0207678_10137111 3300026067 Bacteria 2088
207 Ga0207702_10000126 3300026078 Bacteria 90550
208 Ga0207702_10773872 3300026078 Bacteria 948
209 Ga0207648_10160447 3300026089 Bacteria 1986
210 Ga0207676_10734868 3300026095 Bacteria 959
211 Ga0207674_10018123 3300026116 Bacteria 7660
212 Ga0207674_10565589 3300026116 Bacteria 1098
213 Ga0207683_10021946 3300026121 Bacteria 5476
214 Ga0207683_10312945 3300026121 Bacteria 1437
215 Ga0207698_10209134 3300026142 Bacteria 1754
216 Ga0207698_10403512 3300026142 Bacteria 1307
217 Ga0268266_10002410 3300028379 Bacteria 20158
218 Ga0268266_10053434 3300028379 Bacteria 3470
219 Ga0268266_10296161 3300028379 Bacteria 1508
220 Ga0268266_10699148 3300028379 Bacteria 977
221 Ga0268264_10546557 3300028381 Bacteria 1135
222 Ga0265337_1002708 3300028556 Bacteria 7954
223 Ga0265326_10002939 3300028558 Bacteria 5693
224 Ga0265319_1017774 3300028563 Bacteria 2696
225 Ga0265318_10059818 3300028577 Bacteria 1420
226 Ga0265323_10001443 3300028653 Bacteria 11682
227 Ga0307517_10133837 3300028786 Bacteria 1772
228 Ga0307515_10007623 3300028794 Bacteria 21350
229 Ga0307515_10103560 3300028794 Bacteria 3410
230 Ga0307515_10157370 3300028794 Bacteria 2337
231 Ga0307515_10300873 3300028794 Bacteria 1289
232 Ga0265338_10000321 3300028800 Bacteria 87046
233 Ga0265324_10002307 3300029957 Bacteria 9895
234 Ga0307513_10006015 3300031456 Bacteria 15930
235 Ga0307513_10064249 3300031456 Bacteria 3869
236 Ga0307509_10040164 3300031507 Bacteria 5090
237 Ga0307508_10086959 3300031616 Bacteria 2710
238 Ga0265314_10009423 3300031711 Bacteria 8236
239 Ga0307516_10159623 3300031730 Bacteria 2006
240 Ga0307405_10194984 3300031731 Bacteria 1466
241 Ga0307410_10614587 3300031852 Bacteria 908
242 Ga0307411_10401616 3300032005 Bacteria 1133
243 Ga0307411_10574057 3300032005 Bacteria 966
244 Ga0307415_100264156 3300032126 Bacteria 1406
245 Ga0307510_10116462 3300033180 Bacteria 2393
246 Ga0373944_0103922 3300035089 Bacteria 963
247 Ga0316574_0180803 3300035398 Bacteria 1357
248 Ga0373931_0095822 3300035691 Bacteria 1661
249 Ga0373927_0240944 3300035695 Bacteria 1188
250 Ga0373925_0027573 3300037068 Bacteria 4157
251 Ga0373925_0192602 3300037068 Bacteria 1618
252 Ga0373925_0281199 3300037068 Bacteria 1340
253 Ga0395900_0084700 3300037418 Bacteria 3258
254 Ga0395898_0020989 3300037466 Bacteria 6626
255 Ga0395898_0483718 3300037466 Bacteria 1178
256 Ga0395905_0004739 3300037471 Bacteria 14053
257 Ga0436365_1781448 3300039437 Bacteria 1069
258 Ga0436360_0420953 3300039438 Bacteria 3157
259 Ga0436360_0440158 3300039438 Bacteria 878
260 Ga0436360_0598841 3300039438 Bacteria 3001
261 Ga0436360_0995601 3300039438 Bacteria 4066
262 Ga0436361_0898569 3300039447 Bacteria 1831
263 Ga0436363_1424999 3300039450 Bacteria 11027
264 Ga0451853_3516041 3300041512 Bacteria 1439
265 Ga0439445_0109846 3300042004 Bacteria 786
266 Ga0466963_0465827 3300044694 Bacteria 892
267 Ga0466964_0248605 3300044706 Bacteria 876
268 Ga0466970_0078526 3300044765 Bacteria 1781
269 Ga0451576_0003892 3300045051 Bacteria 19976
270 Ga0466967_0193802 3300045976 Bacteria 1922
271 Ga0495629_0159506 3300046459 Bacteria 1567
272 Ga0495629_0328936 3300046459 Bacteria 1044
273 Ga0495605_0001288 3300046474 Bacteria 16637
274 Ga0495605_0064763 3300046474 Bacteria 1740
275 Ga0495639_0190512 3300046475 Bacteria 1001
276 Ga0495662_0260828 3300046476 Bacteria 853
277 Ga0495664_0380873 3300046477 Bacteria 848
278 Ga0495585_0013091 3300046492 Bacteria 4864
279 Ga0495607_0207419 3300046501 Bacteria 966
280 Ga0495583_0022115 3300046506 Bacteria 3253
281 Ga0495606_0000070 3300046507 Bacteria 177343
282 Ga0495606_0003646 3300046507 Bacteria 16154
283 Ga0495606_0005352 3300046507 Bacteria 12323
284 Ga0495606_0055335 3300046507 Bacteria 2566
285 Ga0495606_0097847 3300046507 Bacteria 1792
286 Ga0495610_0152758 3300046512 Bacteria 983
287 Ga0495616_0102745 3300046513 Bacteria 1339
288 Ga0495620_0015287 3300046515 Bacteria 3879
289 Ga0495631_0001980 3300046518 Bacteria 11993
290 Ga0495631_0153236 3300046518 Bacteria 989
291 Ga0495632_0006772 3300046519 Bacteria 7318
292 Ga0495632_0014187 3300046519 Bacteria 4518
293 Ga0495637_0023384 3300046520 Bacteria 2810
294 Ga0495637_0037786 3300046520 Bacteria 2094
295 Ga0495644_0036643 3300046523 Bacteria 1850
296 Ga0495648_0006022 3300046524 Bacteria 9959
297 Ga0495648_0010085 3300046524 Bacteria 7236
298 Ga0495648_0107067 3300046524 Bacteria 1529
299 Ga0495642_0093648 3300046528 Bacteria 1273
300 Ga0495654_0195216 3300046530 Bacteria 869
301 Ga0495609_0027161 3300046538 Bacteria 2617
302 Ga0495609_0151532 3300046538 Bacteria 986
303 Ga0495622_0089273 3300046557 Bacteria 1416
304 Ga0495633_0000204 3300046558 Bacteria 75182
305 Ga0495633_0015753 3300046558 Bacteria 3917
306 Ga0495656_0016618 3300046615 Bacteria 2795
307 Ga0495656_0018780 3300046615 Bacteria 2661
308 Ga0495656_0050035 3300046615 Bacteria 1782
309 Ga0495668_0003287 3300046616 Bacteria 12267
310 Ga0495611_0009602 3300046648 Bacteria 4088
311 Ga0495625_0004637 3300046660 Bacteria 12914
312 Ga0495625_0017619 3300046660 Bacteria 5589
313 Ga0495625_0118036 3300046660 Bacteria 1808
314 Ga0495625_0357819 3300046660 Bacteria 921
315 Ga0495659_0017980 3300046664 Bacteria 2350
316 Ga0495661_0013463 3300046665 Bacteria 5491
317 Ga0495588_0226315 3300046674 Bacteria 987
318 Ga0495669_0003974 3300046684 Bacteria 6085
319 Ga0495649_0012827 3300046694 Bacteria 4859
320 Ga0495649_0112433 3300046694 Bacteria 1444
321 Ga0495589_0057700 3300046794 Bacteria 1909
322 Ga0495589_0178350 3300046794 Bacteria 1008
323 Ga0495660_0009927 3300046810 Bacteria 5541
324 Ga0495604_0137270 3300047317 Bacteria 1751
325 Ga0495636_0096232 3300047318 Bacteria 1290
326 Ga0495672_0035815 3300047320 Bacteria 3054
327 Ga0495672_0063547 3300047320 Bacteria 2118
328 Ga0495672_0209499 3300047320 Bacteria 969
329 Ga0495686_0070960 3300047472 Bacteria 2145
330 Ga0495686_0118340 3300047472 Bacteria 1582
331 Ga0495686_0123916 3300047472 Bacteria 1538
332 Ga0495614_0171839 3300048089 Bacteria 973
333 Ga0495615_0054803 3300048090 Bacteria 1036
334 Ga0495626_0020550 3300048091 Bacteria 3288
335 Ga0495626_0024532 3300048091 Bacteria 2956
336 Ga0496100_0005504 3300048903 Bacteria 6830
337 Ga0496101_0243958 3300048904 Bacteria 1398
338 Ga0496101_0322283 3300048904 Bacteria 1212
339 Ga0496101_0367951 3300048904 Bacteria 1130
340 Ga0496102_0027789 3300048905 Bacteria 5052
341 Ga0496102_0181130 3300048905 Bacteria 1985
342 Ga0496103_0057188 3300048906 Bacteria 2421
343 Ga0496104_0046593 3300048907 Bacteria 4083
344 Ga0496104_0072689 3300048907 Bacteria 3270
345 Ga0496104_0073802 3300048907 Bacteria 3246
346 Ga0496104_0373977 3300048907 Bacteria 1337
347 Ga0496106_0004195 3300048909 Bacteria 10741
348 Ga0496106_0017519 3300048909 Bacteria 5301
349 Ga0496106_0108902 3300048909 Bacteria 2155
350 Ga0496106_0343214 3300048909 Bacteria 1199
351 Ga0496106_0344620 3300048909 Bacteria 1197
352 Ga0496107_0002006 3300048910 Bacteria 12986
353 Ga0496107_0005355 3300048910 Bacteria 8778
354 Ga0496107_0132749 3300048910 Bacteria 1839
355 Ga0496108_0000515 3300048911 Bacteria 30277
356 Ga0496108_0013623 3300048911 Bacteria 6639
357 Ga0496108_0038368 3300048911 Bacteria 3990
358 Ga0496108_0213391 3300048911 Bacteria 1676
359 Ga0496109_0002891 3300048912 Bacteria 14365
360 Ga0496109_0026725 3300048912 Bacteria 5148
361 Ga0496109_0036450 3300048912 Bacteria 4439
362 Ga0496110_0005701 3300048913 Bacteria 9777
363 Ga0496110_0271297 3300048913 Bacteria 1544
364 Ga0496110_0355549 3300048913 Bacteria 1335
365 Ga0496111_0017931 3300048914 Bacteria 4896
366 Ga0496112_0020326 3300048915 Bacteria 6291
367 Ga0496112_0037801 3300048915 Bacteria 4713
368 Ga0496112_0052978 3300048915 Bacteria 3984
369 Ga0496113_0024908 3300048916 Bacteria 4260
370 Ga0496113_0071685 3300048916 Bacteria 2635
371 Ga0496114_0010127 3300048917 Bacteria 7500
372 Ga0496115_0141901 3300048918 Bacteria 1982
373 Ga0496115_0147056 3300048918 Bacteria 1945
374 Ga0496116_0001829 3300048919 Bacteria 23026
375 Ga0496117_0007856 3300048920 Bacteria 10264
376 Ga0496117_0117202 3300048920 Bacteria 1644
377 Ga0496117_0230339 3300048920 Bacteria 1024
378 Ga0496118_0015402 3300048921 Bacteria 7079
379 Ga0496118_0108024 3300048921 Bacteria 1856
380 Ga0496118_0145757 3300048921 Bacteria 1491
381 Ga0496118_0168263 3300048921 Bacteria 1343
382 Ga0496118_0225040 3300048921 Bacteria 1088
383 Ga0496119_0031271 3300048922 Bacteria 3574
384 Ga0496119_0033429 3300048922 Bacteria 3408
385 Ga0496119_0082850 3300048922 Bacteria 1844
386 Ga0496120_0054282 3300048923 Bacteria 2272
387 Ga0496120_0179084 3300048923 Bacteria 1042
388 Ga0496121_0028099 3300048924 Bacteria 5244
389 Ga0496121_0055004 3300048924 Bacteria 3320
390 Ga0496121_0069807 3300048924 Bacteria 2833
391 Ga0496121_0176744 3300048924 Bacteria 1545
392 Ga0496121_0184353 3300048924 Bacteria 1503
393 Ga0496121_0318592 3300048924 Bacteria 1048
394 Ga0496121_0351124 3300048924 Bacteria 982
395 Ga0496121_0431597 3300048924 Bacteria 854
396 Ga0496122_0023924 3300048925 Bacteria 5364
397 Ga0496122_0039811 3300048925 Bacteria 3743
398 Ga0496122_0110163 3300048925 Bacteria 1810
399 Ga0496123_0016479 3300048926 Bacteria 5998
400 Ga0496124_0340615 3300048927 Bacteria 1065
401 Ga0496125_0001496 3300048928 Bacteria 33472
402 Ga0496125_0016993 3300048928 Bacteria 6956
403 Ga0496125_0123130 3300048928 Bacteria 1844
404 Ga0496125_0132736 3300048928 Bacteria 1749
405 Ga0496125_0163466 3300048928 Bacteria 1508
406 Ga0496126_0004659 3300048929 Bacteria 16215
407 Ga0496126_0004802 3300048929 Bacteria 15878
408 Ga0496126_0013697 3300048929 Bacteria 8231
409 Ga0496126_0073382 3300048929 Bacteria 3042
410 Ga0496126_0462120 3300048929 Bacteria 1020
411 Ga0495678_011013 3300049459 Bacteria 4351
412 Ga0495682_0003951 3300049460 Bacteria 6467
413 Ga0501034_0460173 3300049571 Bacteria 1189
414 Ga0501038_0525926 3300049574 Bacteria 902
415 Ga0501047_0352505 3300049581 Bacteria 1308
416 Ga0501070_0256107 3300049586 Bacteria 1431
417 Ga0501044_0175170 3300049823 Bacteria 2114
418 nmdc:mga03683_15025_c1 3300050489 Bacteria 2880
419 nmdc:mga03683_27218_c1 3300050489 Bacteria 2262
420 nmdc:mga03683_55947_c1 3300050489 Bacteria 1657
421 nmdc:mga03n38_15412_c1 3300050490 Bacteria 2951
422 nmdc:mga00v17_43269_c1 3300050491 Bacteria 2711
423 nmdc:mga0yw44_17878_c1 3300050492 Bacteria 3870
424 nmdc:mga0yw44_27450_c1 3300050492 Bacteria 3260
425 nmdc:mga0k408_1383_c1 3300050493 Bacteria 13098
426 nmdc:mga0k408_45622_c1 3300050493 Bacteria 2529
427 nmdc:mga0k408_81990_c1 3300050493 Bacteria 1889
428 nmdc:mga06z11_12083_c1 3300050494 Bacteria 3746
429 nmdc:mga06z11_52034_c1 3300050494 Bacteria 2099
430 nmdc:mga06z11_8396_c1 3300050494 Bacteria 4304
431 nmdc:mga04h51_95979_c1 3300050495 Bacteria 1074
432 nmdc:mga07m45_240719_c1 3300050496 Bacteria 1053
433 nmdc:mga07m45_33009_c1 3300050496 Bacteria 2873
434 nmdc:mga07m45_3676_c1 3300050496 Bacteria 7416
435 nmdc:mga07m45_4796_c1 3300050496 Bacteria 6655
436 nmdc:mga07m45_6783_c1 3300050496 Bacteria 5817
437 nmdc:mga07m45_83717_c1 3300050496 Bacteria 1823
438 nmdc:mga0n895_22907_c1 3300050512 Bacteria 5860
439 nmdc:mga0sz30_12928_c1 3300050516 Bacteria 3258
440 nmdc:mga0sz30_4699_c1 3300050516 Bacteria 4957
441 nmdc:mga0sz30_5171_c1 3300050516 Bacteria 4138
442 Ga0495601_0246013 3300053077 Bacteria 1168
443 Ga0500610_0201791 3300053079 Bacteria 957
444 Ga0500635_0017639 3300053080 Bacteria 2142
445 Ga0495655_0024302 3300053083 Bacteria 1406
446 Ga0500578_0293026 3300053086 Bacteria 967
447 Ga0500643_011918 3300053087 Bacteria 3140
448 Ga0500643_039277 3300053087 Bacteria 1399
449 Ga0500644_0030134 3300053088 Bacteria 1713
450 Ga0500646_0001906 3300053090 Bacteria 5461
451 Ga0500583_0130008 3300053092 Bacteria 1249
452 Ga0500651_0028017 3300053093 Bacteria 3543
453 Ga0500651_0069697 3300053093 Bacteria 2189
454 Ga0500651_0196491 3300053093 Bacteria 1192
455 Ga0500566_0000006 3300053094 Bacteria 153632
456 Ga0500566_0005667 3300053094 Bacteria 7423
457 Ga0500566_0006660 3300053094 Bacteria 6842
458 Ga0500640_007569 3300053095 Bacteria 4238
459 Ga0500641_0003983 3300053096 Bacteria 5221
460 Ga0500650_0000139 3300053098 Bacteria 18956
461 Ga0500554_000916 3300053102 Bacteria 5756
462 Ga0500556_0000002 3300053104 Bacteria 773626
463 Ga0500556_0090189 3300053104 Bacteria 1170
464 Ga0500557_000246 3300053105 Bacteria 7889
465 Ga0500562_027170 3300053108 Bacteria 1501
466 Ga0500569_002513 3300053109 Bacteria 3630
467 Ga0500572_000674 3300053111 Bacteria 11241
468 Ga0500580_055306 3300053113 Bacteria 1663
469 Ga0500591_130165 3300053115 Bacteria 1016
470 Ga0500593_060635 3300053117 Bacteria 1663
471 Ga0500594_0038243 3300053118 Bacteria 1299
472 Ga0500595_000152 3300053119 Bacteria 45452
473 Ga0500608_000349 3300053122 Bacteria 17817
474 Ga0500614_001760 3300053123 Bacteria 5030
475 Ga0500618_000309 3300053125 Bacteria 36059
476 Ga0500618_024219 3300053125 Bacteria 1463
477 Ga0500642_0000016 3300053130 Bacteria 176560
478 Ga0500652_000646 3300053131 Bacteria 11892
479 Ga0500658_0101795 3300053134 Bacteria 1254
480 Ga0500559_0000699 3300053136 Bacteria 22064
481 Ga0500559_0010680 3300053136 Bacteria 3935
482 Ga0500564_172151 3300053138 Bacteria 909
483 Ga0500568_0000109 3300053139 Bacteria 76714
484 Ga0500568_0002572 3300053139 Bacteria 10565
485 Ga0500568_0011765 3300053139 Bacteria 4044
486 Ga0500577_0002860 3300053142 Bacteria 4441
487 Ga0500588_0046197 3300053146 Bacteria 1337
488 Ga0500590_128939 3300053148 Bacteria 1173
489 Ga0500604_0023561 3300053151 Bacteria 1756
490 Ga0500616_0000061 3300053153 Bacteria 249158
491 Ga0500616_0000472 3300053153 Bacteria 52191
492 Ga0500622_0000916 3300053156 Bacteria 25118
493 Ga0500622_0164846 3300053156 Bacteria 1036
494 Ga0500630_000571 3300053159 Bacteria 16714
495 Ga0500633_0013107 3300053160 Bacteria 2312
496 Ga0500638_000086 3300053162 Bacteria 16892
497 Ga0500639_000016 3300053163 Bacteria 118099
498 Ga0500636_0000963 3300053177 Bacteria 15483
499 Ga0500636_0025991 3300053177 Bacteria 3461
500 Ga0500636_0077317 3300053177 Bacteria 1923
501 Ga0500636_0112898 3300053177 Bacteria 1533
502 Ga0500636_0125447 3300053177 Bacteria 1436
503 Ga0500645_039978 3300053730 Bacteria 1389
504 Ga0500596_001348 3300053735 Bacteria 4940
505 Ga0500661_000655 3300055283 Bacteria 6465

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053125 Ga0500618_000309 Ga0500618_000309_10_699 205
2 3300006028 Ga0070717_10013888 Ga0070717_100138882 217
3 3300046507 Ga0495606_0000070 Ga0495606_0000070_170604_171359 219
4 3300005468 Ga0070707_100126270 Ga0070707_1001262701 221
5 3300049571 Ga0501034_0460173 Ga0501034_0460173_183_917 221
6 3300049581 Ga0501047_0352505 Ga0501047_0352505_86_820 224
7 3300053094 Ga0500566_0006660 Ga0500566_0006660_1595_2329 224
8 3300053102 Ga0500554_000916 Ga0500554_000916_805_1539 224
9 3300053119 Ga0500595_000152 Ga0500595_000152_15526_16260 224
10 3300053162 Ga0500638_000086 Ga0500638_000086_12105_12839 224
11 3300055283 Ga0500661_000655 Ga0500661_000655_4170_4904 224
12 3300014497 Ga0182008_10131686 Ga0182008_101316862 226
13 3300025915 Ga0207693_10144885 Ga0207693_101448853 227
14 3300025928 Ga0207700_10091012 Ga0207700_100910122 227
15 3300025939 Ga0207665_10506905 Ga0207665_105069051 227
16 3300005844 Ga0068862_100428821 Ga0068862_1004288211 228
17 3300025898 Ga0207692_10186786 Ga0207692_101867862 228
18 3300025928 Ga0207700_10870900 Ga0207700_108709001 229
19 3300046492 Ga0495585_0013091 Ga0495585_0013091_2851_3540 229
20 3300046507 Ga0495606_0003646 Ga0495606_0003646_2627_3316 229
21 3300046507 Ga0495606_0055335 Ga0495606_0055335_1686_2375 229
22 3300046660 Ga0495625_0357819 Ga0495625_0357819_140_829 229
23 3300046694 Ga0495649_0112433 Ga0495649_0112433_358_1047 229
24 3300048923 Ga0496120_0179084 Ga0496120_0179084_289_978 229
25 3300048924 Ga0496121_0431597 Ga0496121_0431597_107_796 229
26 3300048928 Ga0496125_0163466 Ga0496125_0163466_676_1365 229
27 3300053105 Ga0500557_000246 Ga0500557_000246_5391_6080 229
28 3300009545 Ga0105237_10383644 Ga0105237_103836442 230
29 3300009551 Ga0105238_10055219 Ga0105238_100552192 230
30 3300046524 Ga0495648_0107067 Ga0495648_0107067_493_1284 231
31 3300046615 Ga0495656_0050035 Ga0495656_0050035_165_899 231
32 3300046794 Ga0495589_0057700 Ga0495589_0057700_1159_1893 231
33 3300005355 Ga0070671_100065906 Ga0070671_1000659062 233
34 3300005457 Ga0070662_100073159 Ga0070662_1000731592 233
35 3300005539 Ga0068853_100112046 Ga0068853_1001120462 233
36 3300005577 Ga0068857_100072314 Ga0068857_1000723143 233
37 3300005578 Ga0068854_100038548 Ga0068854_1000385483 233
38 3300005616 Ga0068852_100039543 Ga0068852_1000395432 233
39 3300005844 Ga0068862_100302885 Ga0068862_1003028851 233
40 3300006042 Ga0075368_10074851 Ga0075368_100748512 233
41 3300006048 Ga0075363_100033643 Ga0075363_1000336432 233
42 3300006177 Ga0075362_10041023 Ga0075362_100410232 233
43 3300006177 Ga0075362_10043018 Ga0075362_100430182 233
44 3300006178 Ga0075367_10007260 Ga0075367_100072603 233
45 3300006178 Ga0075367_10153925 Ga0075367_101539252 233
46 3300006186 Ga0075369_10014572 Ga0075369_100145723 233
47 3300006353 Ga0075370_10001906 Ga0075370_1000190611 233
48 3300006353 Ga0075370_10085208 Ga0075370_100852082 233
49 3300006353 Ga0075370_10092005 Ga0075370_100920052 233
50 3300006871 Ga0075434_100025857 Ga0075434_1000258573 233
51 3300009148 Ga0105243_10094312 Ga0105243_100943122 233
52 3300009545 Ga0105237_10023051 Ga0105237_100230514 233
53 3300010375 Ga0105239_10021983 Ga0105239_100219836 233
54 3300025913 Ga0207695_10153996 Ga0207695_101539963 233
55 3300025914 Ga0207671_10035838 Ga0207671_100358382 233
56 3300025931 Ga0207644_10073826 Ga0207644_100738262 233
57 3300025933 Ga0207706_10091551 Ga0207706_100915513 233
58 3300025935 Ga0207709_10076157 Ga0207709_100761573 233
59 3300025942 Ga0207689_10074522 Ga0207689_100745222 233
60 3300025981 Ga0207640_10134168 Ga0207640_101341682 233
61 3300025986 Ga0207658_10191844 Ga0207658_101918442 233
62 3300026041 Ga0207639_10277629 Ga0207639_102776292 233
63 3300026116 Ga0207674_10018123 Ga0207674_100181239 233
64 3300028794 Ga0307515_10157370 Ga0307515_101573702 233
65 3300028794 Ga0307515_10300873 Ga0307515_103008732 233
66 3300031616 Ga0307508_10086959 Ga0307508_100869592 233
67 3300031730 Ga0307516_10159623 Ga0307516_101596232 233
68 3300037418 Ga0395900_0084700 Ga0395900_0084700_2539_3240 233
69 3300046474 Ga0495605_0064763 Ga0495605_0064763_55_819 233
70 3300046512 Ga0495610_0152758 Ga0495610_0152758_82_846 233
71 3300046518 Ga0495631_0153236 Ga0495631_0153236_184_948 233
72 3300046519 Ga0495632_0014187 Ga0495632_0014187_3447_4244 233
73 3300046538 Ga0495609_0151532 Ga0495609_0151532_197_961 233
74 3300046660 Ga0495625_0017619 Ga0495625_0017619_917_1681 233
75 3300046694 Ga0495649_0012827 Ga0495649_0012827_3969_4733 233
76 3300048091 Ga0495626_0020550 Ga0495626_0020550_540_1304 233
77 3300050489 nmdc:mga03683_15025_c1 nmdc:mga03683_15025_c1_2050_2814 233
78 3300050489 nmdc:mga03683_27218_c1 nmdc:mga03683_27218_c1_923_1687 233
79 3300050493 nmdc:mga0k408_1383_c1 nmdc:mga0k408_1383_c1_9314_10078 233
80 3300050493 nmdc:mga0k408_45622_c1 nmdc:mga0k408_45622_c1_764_1543 233
81 3300050494 nmdc:mga06z11_52034_c1 nmdc:mga06z11_52034_c1_309_1073 233
82 3300050494 nmdc:mga06z11_8396_c1 nmdc:mga06z11_8396_c1_2205_2969 233
83 3300050495 nmdc:mga04h51_95979_c1 nmdc:mga04h51_95979_c1_232_996 233
84 3300050496 nmdc:mga07m45_3676_c1 nmdc:mga07m45_3676_c1_4455_5219 233
85 3300050496 nmdc:mga07m45_4796_c1 nmdc:mga07m45_4796_c1_5382_6161 233
86 3300050496 nmdc:mga07m45_6783_c1 nmdc:mga07m45_6783_c1_3973_4737 233
87 3300050512 nmdc:mga0n895_22907_c1 nmdc:mga0n895_22907_c1_2659_3393 233
88 3300050516 nmdc:mga0sz30_4699_c1 nmdc:mga0sz30_4699_c1_2882_3646 233
89 3300050516 nmdc:mga0sz30_5171_c1 nmdc:mga0sz30_5171_c1_2230_2994 233
90 3300053086 Ga0500578_0293026 Ga0500578_0293026_50_814 233
91 3300053093 Ga0500651_0196491 Ga0500651_0196491_151_915 233
92 3300053139 Ga0500568_0011765 Ga0500568_0011765_2904_3683 233
93 3300006048 Ga0075363_100065833 Ga0075363_1000658332 234
94 3300006178 Ga0075367_10044514 Ga0075367_100445142 234
95 3300006195 Ga0075366_10028470 Ga0075366_100284703 234
96 3300013297 Ga0157378_10513358 Ga0157378_105133582 234
97 3300005548 Ga0070665_100141873 Ga0070665_1001418732 237
98 3300031507 Ga0307509_10040164 Ga0307509_100401642 237
99 3300033180 Ga0307510_10116462 Ga0307510_101164623 237
100 3300046528 Ga0495642_0093648 Ga0495642_0093648_333_1109 237
101 3300046557 Ga0495622_0089273 Ga0495622_0089273_68_802 237
102 3300046558 Ga0495633_0015753 Ga0495633_0015753_13_789 237
103 3300046664 Ga0495659_0017980 Ga0495659_0017980_836_1612 237
104 3300047318 Ga0495636_0096232 Ga0495636_0096232_14_748 237
105 3300047320 Ga0495672_0063547 Ga0495672_0063547_535_1335 237
106 3300047320 Ga0495672_0209499 Ga0495672_0209499_143_877 237
107 3300048090 Ga0495615_0054803 Ga0495615_0054803_268_1002 237
108 3300031852 Ga0307410_10614587 Ga0307410_106145871 239
109 iso_pu_bacteria 2545555834 2545673538 239
110 iso_pu_bacteria 2667528175 2671121869 239
111 iso_pu_bacteria 2903748898 2903753393 239
112 iso_pu_bacteria 3003665799 3003669459 239
113 iso_pu_bacteria 641522639 641646110 239
114 iso_pu_bacteria 643348564 643604830 239
115 iso_pu_bacteria 8056681323 8056688311 239
116 iso_pu_bacteria 2513237098 2513674400 240
117 iso_pu_bacteria 2513237101 2513692867 240
118 iso_pu_bacteria 2513237141 2513890198 240
119 iso_pu_bacteria 2524023210 2524465794 240
120 iso_pu_bacteria 2602042107 2603856752 240
121 iso_pu_bacteria 2721755755 2723844766 240
122 iso_pu_bacteria 2791355199 2793079890 240
123 iso_pu_bacteria 2857524615 2857528230 240
124 iso_pu_bacteria 2874604998 2874605513 240
125 iso_pu_bacteria 2876808645 2876813053 240
126 iso_pu_bacteria 2879110137 2879115833 240
127 iso_pu_bacteria 2885383462 2885391303 240
128 iso_pu_bacteria 2889033259 2889039465 240
129 iso_pu_bacteria 2893066018 2893068671 240
130 iso_pu_bacteria 2903768456 2903773790 240
131 iso_pu_bacteria 2919073203 2919075653 240
132 iso_pu_bacteria 2922361189 2922365649 240
133 iso_pu_bacteria 2922386360 2922391264 240
134 iso_pu_bacteria 8006964411 8006967018 240
135 3300037466 Ga0395898_0483718 Ga0395898_0483718_193_936 242
136 3300045976 Ga0466967_0193802 Ga0466967_0193802_119_868 242
137 3300005577 Ga0068857_100794332 Ga0068857_1007943322 243
138 3300025914 Ga0207671_10120721 Ga0207671_101207212 243
139 3300026116 Ga0207674_10565589 Ga0207674_105655891 243
140 3300042004 Ga0439445_0109846 Ga0439445_0109846_44_775 243
141 iso_pu_bacteria 2582581306 2585268618 243
142 iso_pu_bacteria 2765235802 2765468745 243
143 iso_pu_bacteria 2839993093 2839998155 243
144 iso_pu_bacteria 8054002106 8054008055 243
145 3300005327 Ga0070658_10042588 Ga0070658_100425884 244
146 3300005329 Ga0070683_100718298 Ga0070683_1007182981 244
147 3300005330 Ga0070690_100143648 Ga0070690_1001436482 244
148 3300005334 Ga0068869_100131609 Ga0068869_1001316093 244
149 3300005334 Ga0068869_100641479 Ga0068869_1006414791 244
150 3300005336 Ga0070680_100080116 Ga0070680_1000801162 244
151 3300005337 Ga0070682_100225490 Ga0070682_1002254903 244
152 3300005337 Ga0070682_100262890 Ga0070682_1002628902 244
153 3300005339 Ga0070660_100104431 Ga0070660_1001044312 244
154 3300005340 Ga0070689_100257795 Ga0070689_1002577952 244
155 3300005347 Ga0070668_100014095 Ga0070668_1000140952 244
156 3300005353 Ga0070669_100320831 Ga0070669_1003208311 244
157 3300005354 Ga0070675_100830450 Ga0070675_1008304501 244
158 3300005355 Ga0070671_100308001 Ga0070671_1003080011 244
159 3300005364 Ga0070673_100227767 Ga0070673_1002277672 244
160 3300005365 Ga0070688_100095286 Ga0070688_1000952862 244
161 3300005365 Ga0070688_100290257 Ga0070688_1002902572 244
162 3300005366 Ga0070659_100243663 Ga0070659_1002436632 244
163 3300005367 Ga0070667_100698167 Ga0070667_1006981671 244
164 3300005437 Ga0070710_10093963 Ga0070710_100939632 244
165 3300005455 Ga0070663_100027800 Ga0070663_1000278004 244
166 3300005455 Ga0070663_100071769 Ga0070663_1000717692 244
167 3300005456 Ga0070678_100074298 Ga0070678_1000742982 244
168 3300005458 Ga0070681_10068876 Ga0070681_100688762 244
169 3300005466 Ga0070685_10517574 Ga0070685_105175741 244
170 3300005530 Ga0070679_100056914 Ga0070679_1000569142 244
171 3300005535 Ga0070684_100248713 Ga0070684_1002487132 244
172 3300005543 Ga0070672_100157897 Ga0070672_1001578972 244
173 3300005544 Ga0070686_100123250 Ga0070686_1001232503 244
174 3300005548 Ga0070665_100116587 Ga0070665_1001165872 244
175 3300005548 Ga0070665_100303901 Ga0070665_1003039012 244
176 3300005549 Ga0070704_100491987 Ga0070704_1004919872 244
177 3300005563 Ga0068855_100015651 Ga0068855_1000156514 244
178 3300005564 Ga0070664_100113945 Ga0070664_1001139452 244
179 3300005564 Ga0070664_100274215 Ga0070664_1002742152 244
180 3300005578 Ga0068854_100261468 Ga0068854_1002614682 244
181 3300005614 Ga0068856_100000020 Ga0068856_10000002077 244
182 3300005614 Ga0068856_100259254 Ga0068856_1002592542 244
183 3300005614 Ga0068856_100683424 Ga0068856_1006834242 244
184 3300005614 Ga0068856_100776358 Ga0068856_1007763581 244
185 3300005616 Ga0068852_100010764 Ga0068852_1000107649 244
186 3300005616 Ga0068852_100310542 Ga0068852_1003105422 244
187 3300005617 Ga0068859_100139397 Ga0068859_1001393971 244
188 3300005617 Ga0068859_100153946 Ga0068859_1001539462 244
189 3300005618 Ga0068864_100039117 Ga0068864_1000391172 244
190 3300005842 Ga0068858_100077017 Ga0068858_1000770171 244
191 3300005842 Ga0068858_100229680 Ga0068858_1002296802 244
192 3300005843 Ga0068860_100406502 Ga0068860_1004065022 244
193 3300005937 Ga0081455_10006892 Ga0081455_100068925 244
194 3300005937 Ga0081455_10009515 Ga0081455_100095153 244
195 3300005983 Ga0081540_1010747 Ga0081540_10107472 244
196 3300005983 Ga0081540_1026295 Ga0081540_10262954 244
197 3300005985 Ga0081539_10000140 Ga0081539_1000014019 244
198 3300006038 Ga0075365_10125222 Ga0075365_101252222 244
199 3300006048 Ga0075363_100018624 Ga0075363_1000186242 244
200 3300006051 Ga0075364_10290946 Ga0075364_102909462 244
201 3300006051 Ga0075364_10414033 Ga0075364_104140331 244
202 3300006178 Ga0075367_10009081 Ga0075367_100090814 244
203 3300006186 Ga0075369_10006421 Ga0075369_100064214 244
204 3300006195 Ga0075366_10155224 Ga0075366_101552242 244
205 3300006353 Ga0075370_10095033 Ga0075370_100950331 244
206 3300006358 Ga0068871_100082771 Ga0068871_1000827712 244
207 3300006852 Ga0075433_10308092 Ga0075433_103080922 244
208 3300006871 Ga0075434_100263368 Ga0075434_1002633682 244
209 3300006931 Ga0097620_100139389 Ga0097620_1001393891 244
210 3300006931 Ga0097620_100153959 Ga0097620_1001539592 244
211 3300009093 Ga0105240_10089792 Ga0105240_100897924 244
212 3300009098 Ga0105245_10013893 Ga0105245_100138937 244
213 3300009101 Ga0105247_10110377 Ga0105247_101103772 244
214 3300009176 Ga0105242_10239148 Ga0105242_102391482 244
215 3300009545 Ga0105237_10174749 Ga0105237_101747492 244
216 3300009545 Ga0105237_10207526 Ga0105237_102075262 244
217 3300009545 Ga0105237_10255238 Ga0105237_102552382 244
218 3300009545 Ga0105237_10829411 Ga0105237_108294112 244
219 3300009551 Ga0105238_10023178 Ga0105238_100231789 244
220 3300009551 Ga0105238_10452128 Ga0105238_104521282 244
221 3300013104 Ga0157370_10034359 Ga0157370_100343596 244
222 3300013104 Ga0157370_10107534 Ga0157370_101075343 244
223 3300013105 Ga0157369_10026279 Ga0157369_100262792 244
224 3300013105 Ga0157369_10031264 Ga0157369_100312646 244
225 3300013296 Ga0157374_10506044 Ga0157374_105060441 244
226 3300013297 Ga0157378_10017318 Ga0157378_100173183 244
227 3300013297 Ga0157378_10526439 Ga0157378_105264392 244
228 3300013297 Ga0157378_10962067 Ga0157378_109620672 244
229 3300013306 Ga0163162_10040586 Ga0163162_100405862 244
230 3300013306 Ga0163162_10254813 Ga0163162_102548132 244
231 3300013308 Ga0157375_10048477 Ga0157375_100484773 244
232 3300014325 Ga0163163_10025783 Ga0163163_100257832 244
233 3300014325 Ga0163163_10103078 Ga0163163_101030782 244
234 3300014326 Ga0157380_10400053 Ga0157380_104000532 244
235 3300014745 Ga0157377_10144508 Ga0157377_101445082 244
236 3300014968 Ga0157379_10085510 Ga0157379_100855102 244
237 3300014969 Ga0157376_10065491 Ga0157376_100654912 244
238 3300017792 Ga0163161_10004994 Ga0163161_1000499410 244
239 3300017792 Ga0163161_10139174 Ga0163161_101391741 244
240 3300017792 Ga0163161_10146625 Ga0163161_101466252 244
241 3300020069 Ga0197907_10885475 Ga0197907_108854751 244
242 3300020081 Ga0206354_11326341 Ga0206354_113263411 244
243 3300021361 Ga0213872_10090103 Ga0213872_100901032 244
244 3300021441 Ga0213871_10021672 Ga0213871_100216722 244
245 3300025253 Ga0209677_101344 Ga0209677_1013446 244
246 3300025272 Ga0209455_1002715 Ga0209455_10027153 244
247 3300025904 Ga0207647_10145063 Ga0207647_101450632 244
248 3300025907 Ga0207645_10015221 Ga0207645_100152212 244
249 3300025909 Ga0207705_10031820 Ga0207705_100318202 244
250 3300025912 Ga0207707_10222147 Ga0207707_102221472 244
251 3300025913 Ga0207695_10045380 Ga0207695_100453804 244
252 3300025914 Ga0207671_10222145 Ga0207671_102221452 244
253 3300025914 Ga0207671_10363264 Ga0207671_103632642 244
254 3300025914 Ga0207671_10367513 Ga0207671_103675132 244
255 3300025914 Ga0207671_10569226 Ga0207671_105692261 244
256 3300025915 Ga0207693_10092177 Ga0207693_100921771 244
257 3300025916 Ga0207663_10045255 Ga0207663_100452552 244
258 3300025917 Ga0207660_10130470 Ga0207660_101304702 244
259 3300025921 Ga0207652_10023496 Ga0207652_100234962 244
260 3300025923 Ga0207681_10420820 Ga0207681_104208201 244
261 3300025926 Ga0207659_10559258 Ga0207659_105592582 244
262 3300025927 Ga0207687_10135313 Ga0207687_101353132 244
263 3300025933 Ga0207706_10011412 Ga0207706_1001141210 244
264 3300025933 Ga0207706_10088283 Ga0207706_100882832 244
265 3300025934 Ga0207686_10197363 Ga0207686_101973632 244
266 3300025935 Ga0207709_10114206 Ga0207709_101142062 244
267 3300025936 Ga0207670_10034272 Ga0207670_100342721 244
268 3300025937 Ga0207669_10081818 Ga0207669_100818184 244
269 3300025939 Ga0207665_10062883 Ga0207665_100628832 244
270 3300025940 Ga0207691_10158025 Ga0207691_101580252 244
271 3300025942 Ga0207689_10074676 Ga0207689_100746762 244
272 3300025942 Ga0207689_10336765 Ga0207689_103367653 244
273 3300025944 Ga0207661_10291056 Ga0207661_102910562 244
274 3300025944 Ga0207661_10305267 Ga0207661_103052672 244
275 3300025945 Ga0207679_10166363 Ga0207679_101663632 244
276 3300025945 Ga0207679_10401794 Ga0207679_104017941 244
277 3300025949 Ga0207667_10013915 Ga0207667_100139156 244
278 3300025961 Ga0207712_10104690 Ga0207712_101046902 244
279 3300025972 Ga0207668_10451259 Ga0207668_104512591 244
280 3300025981 Ga0207640_10205629 Ga0207640_102056292 244
281 3300025986 Ga0207658_10644475 Ga0207658_106444751 244
282 3300026023 Ga0207677_10111598 Ga0207677_101115983 244
283 3300026035 Ga0207703_10196776 Ga0207703_101967762 244
284 3300026067 Ga0207678_10017094 Ga0207678_100170944 244
285 3300026067 Ga0207678_10137111 Ga0207678_101371112 244
286 3300026078 Ga0207702_10000126 Ga0207702_1000012671 244
287 3300026078 Ga0207702_10773872 Ga0207702_107738721 244
288 3300026089 Ga0207648_10160447 Ga0207648_101604473 244
289 3300026121 Ga0207683_10021946 Ga0207683_100219463 244
290 3300026121 Ga0207683_10312945 Ga0207683_103129452 244
291 3300026142 Ga0207698_10209134 Ga0207698_102091342 244
292 3300026142 Ga0207698_10403512 Ga0207698_104035122 244
293 3300028379 Ga0268266_10002410 Ga0268266_1000241018 244
294 3300028379 Ga0268266_10053434 Ga0268266_100534342 244
295 3300028379 Ga0268266_10296161 Ga0268266_102961612 244
296 3300028379 Ga0268266_10699148 Ga0268266_106991481 244
297 3300028381 Ga0268264_10546557 Ga0268264_105465571 244
298 3300028556 Ga0265337_1002708 Ga0265337_10027085 244
299 3300028558 Ga0265326_10002939 Ga0265326_100029398 244
300 3300028563 Ga0265319_1017774 Ga0265319_10177742 244
301 3300028577 Ga0265318_10059818 Ga0265318_100598182 244
302 3300028653 Ga0265323_10001443 Ga0265323_100014432 244
303 3300028794 Ga0307515_10103560 Ga0307515_101035601 244
304 3300028800 Ga0265338_10000321 Ga0265338_1000032115 244
305 3300029957 Ga0265324_10002307 Ga0265324_100023072 244
306 3300031711 Ga0265314_10009423 Ga0265314_100094233 244
307 3300031731 Ga0307405_10194984 Ga0307405_101949842 244
308 3300032005 Ga0307411_10574057 Ga0307411_105740571 244
309 3300032126 Ga0307415_100264156 Ga0307415_1002641562 244
310 3300035691 Ga0373931_0095822 Ga0373931_0095822_592_1326 244
311 3300035695 Ga0373927_0240944 Ga0373927_0240944_107_865 244
312 3300037068 Ga0373925_0192602 Ga0373925_0192602_148_882 244
313 3300037466 Ga0395898_0020989 Ga0395898_0020989_2493_3227 244
314 3300037471 Ga0395905_0004739 Ga0395905_0004739_13027_13761 244
315 3300039437 Ga0436365_1781448 Ga0436365_1781448_234_968 244
316 3300039438 Ga0436360_0440158 Ga0436360_0440158_98_832 244
317 3300039438 Ga0436360_0598841 Ga0436360_0598841_1701_2435 244
318 3300039438 Ga0436360_0995601 Ga0436360_0995601_1795_2529 244
319 3300039447 Ga0436361_0898569 Ga0436361_0898569_402_1136 244
320 3300039450 Ga0436363_1424999 Ga0436363_1424999_435_1169 244
321 3300041512 Ga0451853_3516041 Ga0451853_3516041_610_1356 244
322 3300044694 Ga0466963_0465827 Ga0466963_0465827_20_754 244
323 3300044706 Ga0466964_0248605 Ga0466964_0248605_50_784 244
324 3300044765 Ga0466970_0078526 Ga0466970_0078526_206_940 244
325 3300046459 Ga0495629_0159506 Ga0495629_0159506_472_1206 244
326 3300046459 Ga0495629_0328936 Ga0495629_0328936_241_987 244
327 3300046475 Ga0495639_0190512 Ga0495639_0190512_109_843 244
328 3300046477 Ga0495664_0380873 Ga0495664_0380873_67_801 244
329 3300046501 Ga0495607_0207419 Ga0495607_0207419_134_868 244
330 3300046507 Ga0495606_0097847 Ga0495606_0097847_99_833 244
331 3300046513 Ga0495616_0102745 Ga0495616_0102745_408_1142 244
332 3300046520 Ga0495637_0037786 Ga0495637_0037786_726_1460 244
333 3300046523 Ga0495644_0036643 Ga0495644_0036643_348_1082 244
334 3300046524 Ga0495648_0006022 Ga0495648_0006022_3138_3872 244
335 3300046524 Ga0495648_0010085 Ga0495648_0010085_949_1683 244
336 3300046530 Ga0495654_0195216 Ga0495654_0195216_104_838 244
337 3300046615 Ga0495656_0016618 Ga0495656_0016618_1850_2650 244
338 3300046615 Ga0495656_0018780 Ga0495656_0018780_1398_2132 244
339 3300046665 Ga0495661_0013463 Ga0495661_0013463_2130_2864 244
340 3300046674 Ga0495588_0226315 Ga0495588_0226315_153_899 244
341 3300046684 Ga0495669_0003974 Ga0495669_0003974_310_1044 244
342 3300046794 Ga0495589_0178350 Ga0495589_0178350_115_849 244
343 3300047317 Ga0495604_0137270 Ga0495604_0137270_952_1686 244
344 3300047472 Ga0495686_0070960 Ga0495686_0070960_217_951 244
345 3300047472 Ga0495686_0118340 Ga0495686_0118340_20_754 244
346 3300047472 Ga0495686_0123916 Ga0495686_0123916_345_1079 244
347 3300048089 Ga0495614_0171839 Ga0495614_0171839_105_839 244
348 3300048091 Ga0495626_0024532 Ga0495626_0024532_271_1005 244
349 3300048903 Ga0496100_0005504 Ga0496100_0005504_5997_6743 244
350 3300048904 Ga0496101_0243958 Ga0496101_0243958_123_857 244
351 3300048904 Ga0496101_0322283 Ga0496101_0322283_94_828 244
352 3300048904 Ga0496101_0367951 Ga0496101_0367951_226_972 244
353 3300048905 Ga0496102_0027789 Ga0496102_0027789_3802_4548 244
354 3300048905 Ga0496102_0181130 Ga0496102_0181130_1070_1804 244
355 3300048906 Ga0496103_0057188 Ga0496103_0057188_104_850 244
356 3300048907 Ga0496104_0046593 Ga0496104_0046593_64_798 244
357 3300048907 Ga0496104_0072689 Ga0496104_0072689_2274_3020 244
358 3300048907 Ga0496104_0373977 Ga0496104_0373977_46_780 244
359 3300048909 Ga0496106_0004195 Ga0496106_0004195_3478_4212 244
360 3300048909 Ga0496106_0017519 Ga0496106_0017519_478_1224 244
361 3300048909 Ga0496106_0108902 Ga0496106_0108902_1085_1819 244
362 3300048909 Ga0496106_0343214 Ga0496106_0343214_108_842 244
363 3300048909 Ga0496106_0344620 Ga0496106_0344620_367_1101 244
364 3300048910 Ga0496107_0002006 Ga0496107_0002006_2497_3243 244
365 3300048910 Ga0496107_0005355 Ga0496107_0005355_7146_7880 244
366 3300048910 Ga0496107_0132749 Ga0496107_0132749_1006_1740 244
367 3300048911 Ga0496108_0000515 Ga0496108_0000515_9692_10426 244
368 3300048911 Ga0496108_0013623 Ga0496108_0013623_4839_5573 244
369 3300048911 Ga0496108_0038368 Ga0496108_0038368_136_882 244
370 3300048911 Ga0496108_0213391 Ga0496108_0213391_480_1292 244
371 3300048912 Ga0496109_0002891 Ga0496109_0002891_8859_9593 244
372 3300048912 Ga0496109_0026725 Ga0496109_0026725_4206_4952 244
373 3300048912 Ga0496109_0036450 Ga0496109_0036450_3676_4410 244
374 3300048913 Ga0496110_0005701 Ga0496110_0005701_7260_8006 244
375 3300048913 Ga0496110_0271297 Ga0496110_0271297_299_1033 244
376 3300048913 Ga0496110_0355549 Ga0496110_0355549_243_1055 244
377 3300048914 Ga0496111_0017931 Ga0496111_0017931_3992_4738 244
378 3300048915 Ga0496112_0020326 Ga0496112_0020326_3399_4145 244
379 3300048915 Ga0496112_0037801 Ga0496112_0037801_324_1058 244
380 3300048915 Ga0496112_0052978 Ga0496112_0052978_534_1268 244
381 3300048916 Ga0496113_0024908 Ga0496113_0024908_2824_3558 244
382 3300048916 Ga0496113_0071685 Ga0496113_0071685_1728_2474 244
383 3300048917 Ga0496114_0010127 Ga0496114_0010127_6565_7311 244
384 3300048918 Ga0496115_0141901 Ga0496115_0141901_1005_1739 244
385 3300048918 Ga0496115_0147056 Ga0496115_0147056_1115_1849 244
386 3300048919 Ga0496116_0001829 Ga0496116_0001829_10279_11013 244
387 3300048920 Ga0496117_0007856 Ga0496117_0007856_2190_2924 244
388 3300048920 Ga0496117_0117202 Ga0496117_0117202_885_1619 244
389 3300048920 Ga0496117_0230339 Ga0496117_0230339_264_998 244
390 3300048921 Ga0496118_0015402 Ga0496118_0015402_2937_3671 244
391 3300048921 Ga0496118_0108024 Ga0496118_0108024_99_833 244
392 3300048921 Ga0496118_0145757 Ga0496118_0145757_62_796 244
393 3300048921 Ga0496118_0168263 Ga0496118_0168263_425_1159 244
394 3300048921 Ga0496118_0225040 Ga0496118_0225040_116_850 244
395 3300048922 Ga0496119_0033429 Ga0496119_0033429_832_1566 244
396 3300048922 Ga0496119_0082850 Ga0496119_0082850_61_795 244
397 3300048923 Ga0496120_0054282 Ga0496120_0054282_995_1729 244
398 3300048924 Ga0496121_0028099 Ga0496121_0028099_3634_4368 244
399 3300048924 Ga0496121_0055004 Ga0496121_0055004_259_993 244
400 3300048924 Ga0496121_0176744 Ga0496121_0176744_691_1452 244
401 3300048924 Ga0496121_0184353 Ga0496121_0184353_440_1174 244
402 3300048924 Ga0496121_0318592 Ga0496121_0318592_25_759 244
403 3300048924 Ga0496121_0351124 Ga0496121_0351124_132_866 244
404 3300048925 Ga0496122_0039811 Ga0496122_0039811_1077_1811 244
405 3300048926 Ga0496123_0016479 Ga0496123_0016479_3141_3875 244
406 3300048927 Ga0496124_0340615 Ga0496124_0340615_77_838 244
407 3300048928 Ga0496125_0001496 Ga0496125_0001496_24902_25636 244
408 3300048928 Ga0496125_0016993 Ga0496125_0016993_5684_6418 244
409 3300048928 Ga0496125_0123130 Ga0496125_0123130_241_1002 244
410 3300048928 Ga0496125_0132736 Ga0496125_0132736_240_974 244
411 3300048929 Ga0496126_0004659 Ga0496126_0004659_12548_13282 244
412 3300048929 Ga0496126_0004802 Ga0496126_0004802_1612_2346 244
413 3300048929 Ga0496126_0013697 Ga0496126_0013697_3310_4044 244
414 3300048929 Ga0496126_0073382 Ga0496126_0073382_1473_2207 244
415 3300048929 Ga0496126_0462120 Ga0496126_0462120_239_973 244
416 3300049574 Ga0501038_0525926 Ga0501038_0525926_116_865 244
417 3300049586 Ga0501070_0256107 Ga0501070_0256107_77_811 244
418 3300049823 Ga0501044_0175170 Ga0501044_0175170_1220_1969 244
419 3300050489 nmdc:mga03683_55947_c1 nmdc:mga03683_55947_c1_738_1472 244
420 3300050490 nmdc:mga03n38_15412_c1 nmdc:mga03n38_15412_c1_1709_2443 244
421 3300050491 nmdc:mga00v17_43269_c1 nmdc:mga00v17_43269_c1_1361_2095 244
422 3300050492 nmdc:mga0yw44_17878_c1 nmdc:mga0yw44_17878_c1_696_1430 244
423 3300050492 nmdc:mga0yw44_27450_c1 nmdc:mga0yw44_27450_c1_184_978 244
424 3300050493 nmdc:mga0k408_81990_c1 nmdc:mga0k408_81990_c1_992_1726 244
425 3300050494 nmdc:mga06z11_12083_c1 nmdc:mga06z11_12083_c1_1764_2498 244
426 3300050496 nmdc:mga07m45_240719_c1 nmdc:mga07m45_240719_c1_77_811 244
427 3300050496 nmdc:mga07m45_33009_c1 nmdc:mga07m45_33009_c1_1521_2315 244
428 3300050496 nmdc:mga07m45_83717_c1 nmdc:mga07m45_83717_c1_10_744 244
429 3300050516 nmdc:mga0sz30_12928_c1 nmdc:mga0sz30_12928_c1_875_1609 244
430 3300053077 Ga0495601_0246013 Ga0495601_0246013_420_1154 244
431 3300053080 Ga0500635_0017639 Ga0500635_0017639_1299_2063 244
432 3300053083 Ga0495655_0024302 Ga0495655_0024302_37_771 244
433 3300053087 Ga0500643_011918 Ga0500643_011918_2349_3083 244
434 3300053087 Ga0500643_039277 Ga0500643_039277_16_750 244
435 3300053088 Ga0500644_0030134 Ga0500644_0030134_169_903 244
436 3300053090 Ga0500646_0001906 Ga0500646_0001906_639_1373 244
437 3300053092 Ga0500583_0130008 Ga0500583_0130008_426_1160 244
438 3300053093 Ga0500651_0028017 Ga0500651_0028017_1700_2434 244
439 3300053093 Ga0500651_0069697 Ga0500651_0069697_1079_1813 244
440 3300053094 Ga0500566_0000006 Ga0500566_0000006_85321_86055 244
441 3300053094 Ga0500566_0005667 Ga0500566_0005667_3983_4717 244
442 3300053095 Ga0500640_007569 Ga0500640_007569_2183_2917 244
443 3300053096 Ga0500641_0003983 Ga0500641_0003983_1997_2731 244
444 3300053098 Ga0500650_0000139 Ga0500650_0000139_1646_2380 244
445 3300053104 Ga0500556_0000002 Ga0500556_0000002_410355_411089 244
446 3300053109 Ga0500569_002513 Ga0500569_002513_2593_3327 244
447 3300053111 Ga0500572_000674 Ga0500572_000674_7718_8452 244
448 3300053113 Ga0500580_055306 Ga0500580_055306_271_1005 244
449 3300053115 Ga0500591_130165 Ga0500591_130165_162_896 244
450 3300053117 Ga0500593_060635 Ga0500593_060635_696_1430 244
451 3300053122 Ga0500608_000349 Ga0500608_000349_14619_15353 244
452 3300053123 Ga0500614_001760 Ga0500614_001760_3332_4066 244
453 3300053125 Ga0500618_024219 Ga0500618_024219_392_1126 244
454 3300053130 Ga0500642_0000016 Ga0500642_0000016_123198_123932 244
455 3300053131 Ga0500652_000646 Ga0500652_000646_2911_3645 244
456 3300053134 Ga0500658_0101795 Ga0500658_0101795_184_918 244
457 3300053136 Ga0500559_0000699 Ga0500559_0000699_18642_19376 244
458 3300053136 Ga0500559_0010680 Ga0500559_0010680_1576_2310 244
459 3300053138 Ga0500564_172151 Ga0500564_172151_69_803 244
460 3300053139 Ga0500568_0002572 Ga0500568_0002572_4619_5353 244
461 3300053142 Ga0500577_0002860 Ga0500577_0002860_2657_3391 244
462 3300053148 Ga0500590_128939 Ga0500590_128939_67_831 244
463 3300053151 Ga0500604_0023561 Ga0500604_0023561_816_1550 244
464 3300053153 Ga0500616_0000061 Ga0500616_0000061_218837_219571 244
465 3300053156 Ga0500622_0000916 Ga0500622_0000916_8173_8907 244
466 3300053159 Ga0500630_000571 Ga0500630_000571_10622_11356 244
467 3300053160 Ga0500633_0013107 Ga0500633_0013107_1474_2208 244
468 3300053163 Ga0500639_000016 Ga0500639_000016_68911_69645 244
469 3300053177 Ga0500636_0000963 Ga0500636_0000963_10600_11334 244
470 3300053177 Ga0500636_0025991 Ga0500636_0025991_1190_1924 244
471 3300053177 Ga0500636_0077317 Ga0500636_0077317_263_1030 244
472 3300053177 Ga0500636_0112898 Ga0500636_0112898_63_797 244
473 3300053177 Ga0500636_0125447 Ga0500636_0125447_379_1113 244
474 3300053730 Ga0500645_039978 Ga0500645_039978_26_760 244
475 3300053735 Ga0500596_001348 Ga0500596_001348_3571_4305 244
476 3300005367 Ga0070667_100004052 Ga0070667_10000405212 245
477 3300009177 Ga0105248_11089428 Ga0105248_110894281 245
478 3300013308 Ga0157375_10053711 Ga0157375_100537113 245
479 3300025899 Ga0207642_10190762 Ga0207642_101907621 245
480 3300025986 Ga0207658_10188243 Ga0207658_101882432 245
481 3300026095 Ga0207676_10734868 Ga0207676_107348682 245
482 3300035398 Ga0316574_0180803 Ga0316574_0180803_77_826 245
483 3300037068 Ga0373925_0027573 Ga0373925_0027573_2790_3557 245
484 3300045051 Ga0451576_0003892 Ga0451576_0003892_15633_16370 245
485 3300005330 Ga0070690_100040624 Ga0070690_1000406241 246
486 3300009176 Ga0105242_10194426 Ga0105242_101944262 246
487 3300009177 Ga0105248_10112704 Ga0105248_101127042 246
488 3300014497 Ga0182008_10000949 Ga0182008_1000094917 246
489 3300017792 Ga0163161_10017594 Ga0163161_100175944 246
490 3300028786 Ga0307517_10133837 Ga0307517_101338372 246
491 3300032005 Ga0307411_10401616 Ga0307411_104016162 246
492 3300035089 Ga0373944_0103922 Ga0373944_0103922_35_799 246
493 3300037068 Ga0373925_0281199 Ga0373925_0281199_165_929 246
494 3300039438 Ga0436360_0420953 Ga0436360_0420953_696_1436 246
495 3300046476 Ga0495662_0260828 Ga0495662_0260828_44_808 246
496 3300046520 Ga0495637_0023384 Ga0495637_0023384_94_849 246
497 3300046558 Ga0495633_0000204 Ga0495633_0000204_8181_8936 246
498 3300048907 Ga0496104_0073802 Ga0496104_0073802_364_1128 246
499 3300048925 Ga0496122_0023924 Ga0496122_0023924_1117_1872 246
500 3300049460 Ga0495682_0003951 Ga0495682_0003951_5685_6440 246
501 3300002987 JGI25159J45721_1001367 JGI25159J45721_10013679 247
502 3300003354 JGI25160J50197_1000034 JGI25160J50197_1000034105 247
503 3300003374 JGI25161J50226_1000019 JGI25161J50226_100001972 247
504 3300004625 Ga0055543_1000018 Ga0055543_1000018105 247
505 3300005262 Ga0065165_1000121 Ga0065165_1000121105 247
506 3300025284 Ga0209130_1000077 Ga0209130_1000077102 247
507 3300025302 Ga0207426_1000054 Ga0207426_1000054102 247
508 3300028794 Ga0307515_10007623 Ga0307515_1000762317 247
509 3300031456 Ga0307513_10006015 Ga0307513_100060157 247
510 3300031456 Ga0307513_10064249 Ga0307513_100642493 247
511 3300046474 Ga0495605_0001288 Ga0495605_0001288_6776_7519 247
512 3300046506 Ga0495583_0022115 Ga0495583_0022115_1370_2113 247
513 3300046507 Ga0495606_0005352 Ga0495606_0005352_7905_8648 247
514 3300046515 Ga0495620_0015287 Ga0495620_0015287_1245_1988 247
515 3300046518 Ga0495631_0001980 Ga0495631_0001980_10097_10840 247
516 3300046519 Ga0495632_0006772 Ga0495632_0006772_1380_2123 247
517 3300046538 Ga0495609_0027161 Ga0495609_0027161_1333_2076 247
518 3300046616 Ga0495668_0003287 Ga0495668_0003287_2647_3390 247
519 3300046648 Ga0495611_0009602 Ga0495611_0009602_1484_2227 247
520 3300046660 Ga0495625_0004637 Ga0495625_0004637_9588_10331 247
521 3300046660 Ga0495625_0118036 Ga0495625_0118036_494_1237 247
522 3300046810 Ga0495660_0009927 Ga0495660_0009927_1312_2055 247
523 3300047320 Ga0495672_0035815 Ga0495672_0035815_2134_2877 247
524 3300048922 Ga0496119_0031271 Ga0496119_0031271_2525_3268 247
525 3300048924 Ga0496121_0069807 Ga0496121_0069807_1187_1930 247
526 3300048925 Ga0496122_0110163 Ga0496122_0110163_514_1257 247
527 3300049459 Ga0495678_011013 Ga0495678_011013_1068_1811 247
528 3300053079 Ga0500610_0201791 Ga0500610_0201791_171_914 247
529 3300053104 Ga0500556_0090189 Ga0500556_0090189_350_1093 247
530 3300053108 Ga0500562_027170 Ga0500562_027170_169_912 247
531 3300053118 Ga0500594_0038243 Ga0500594_0038243_322_1065 247
532 3300053139 Ga0500568_0000109 Ga0500568_0000109_43407_44150 247
533 3300053146 Ga0500588_0046197 Ga0500588_0046197_44_787 247
534 3300053153 Ga0500616_0000472 Ga0500616_0000472_41294_42037 247
535 3300053156 Ga0500622_0164846 Ga0500622_0164846_153_896 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

34

219

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

40

269

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ag5-assembly1.cif.gz_D crystal structure of human dhrs6 0.979 4 245
2ag5-assembly1.cif.gz_D crystal structure of human dhrs6 0.9672 4 245
4yqz-assembly1.cif.gz_B crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form 0.9578 4 243
4yqz-assembly1.cif.gz_D crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form 0.9566 4 243
5t2u-assembly1.cif.gz_B short chain dehydrogenase/reductase family protein 0.9494 4 243
ID Description Score Start End Superfamily
2ag5D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.979 4 245 3.40.50.720
2ag5D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9672 4 245 3.40.50.720
4yqzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9553 5 243 3.40.50.720
5t2uB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9494 4 243 3.40.50.720
5jc8D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9473 4 247 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A519GZL5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9908 4 183 GO:0016491
AF-A0A091D5V5-F1-model_v4 Dehydrogenase/reductase SDR family member 6 (EC 1.1.1.104) (EC 1.1.1.30) ((R)-beta-hydroxybutyrate dehydrogenase) (3-hydroxybutyrate dehydrogenase type 2) (4-oxo-L-proline reductase) (Oxidoreductase UCPA) (Short chain dehydrogenase/reductase family 15C member 1) 0.9905 4 179 GO:0003858
GO:0005737
GO:0019290
AF-A0A3Q7V0S1-F1-model_v4 deleted 0.9903 4 120
AF-Z4YIQ5-F1-model_v4 deleted 0.9887 4 178
AF-A0A091TZD9-F1-model_v4 Dehydrogenase/reductase SDR family member 6 (EC 1.1.1.104) (EC 1.1.1.30) ((R)-beta-hydroxybutyrate dehydrogenase) (3-hydroxybutyrate dehydrogenase type 2) (4-oxo-L-proline reductase) (Oxidoreductase UCPA) (Short chain dehydrogenase/reductase family 15C member 1) 0.9867 27 179 GO:0003858
GO:0005737
GO:0019290

Feature Viewer

pLDDT pTM Quality
92.56 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map