F460697

General Info

Members Datasets Scaffolds Average Seq Length
535 280 1070 204

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0083598|Ga0466964_0083598_46_765
Length 239
Sequence VAFAIAPRVYVGACRRLVESARVIRTLRFLARNRMLNLKYARLLWRYAWRRLLTPAGWRWETDGPVFFGRGLELQIGRGATVRFGRFCWIGDRTKIRCHEGVIEIGAKTVLGQECTISAYQRVRIGEQCVVADRAMFIDFDHGVVEVERPIRAQGIYKRDVRVGHNVWVGYGTSFLRGARVXDNAVIGTASVVTKDVPANAVAAGAPIRVLRMRERPRSIRWPEPVDPAPPGEPGPSDR

Samples

Sample ID Description Type Environment
1 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.74
Nodule 0
Rhizoplane 9.53
Rhizosphere 84.3
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466964_0083598 3300044706 Bacteria 1375
2 JGI24740J21852_10006219 3300001979 Bacteria 4969
3 JGI24748J21848_1000299 3300002074 Bacteria 5810
4 JGI24034J26672_10000180 3300002239 Bacteria 8646
5 JGI24751J29686_10007587 3300002459 Bacteria 2217
6 JGI25407J50210_10012274 3300003373 Bacteria 2195
7 Ga0070658_10274672 3300005327 Bacteria 1434
8 Ga0070683_100003289 3300005329 Bacteria 13064
9 Ga0070683_100006767 3300005329 Bacteria 9633
10 Ga0070683_100295190 3300005329 Bacteria 1541
11 Ga0070670_100147222 3300005331 Bacteria 2038
12 Ga0070677_10000098 3300005333 Bacteria 28689
13 Ga0070680_100283461 3300005336 Bacteria 1404
14 Ga0070682_100000013 3300005337 Bacteria 254641
15 Ga0070682_100000421 3300005337 Bacteria 27464
16 Ga0070682_100016042 3300005337 Bacteria 4351
17 Ga0068868_100004331 3300005338 Bacteria 9949
18 Ga0068868_100004773 3300005338 Bacteria 9518
19 Ga0070691_10004831 3300005341 Bacteria 6134
20 Ga0070661_100000599 3300005344 Bacteria 26985
21 Ga0070661_100336554 3300005344 Bacteria 1181
22 Ga0070661_100395489 3300005344 Bacteria 1092
23 Ga0070692_10022930 3300005345 Bacteria 3055
24 Ga0070692_10043138 3300005345 Bacteria 2319
25 Ga0070668_100395499 3300005347 Bacteria 1179
26 Ga0070675_100000053 3300005354 Bacteria 70601
27 Ga0070675_100064623 3300005354 Bacteria 3025
28 Ga0070674_100000025 3300005356 Bacteria 78679
29 Ga0070674_100023380 3300005356 Bacteria 4000
30 Ga0070674_100040199 3300005356 Bacteria 3163
31 Ga0070673_100169977 3300005364 Bacteria 1860
32 Ga0070688_100000012 3300005365 Bacteria 79406
33 Ga0070688_100000269 3300005365 Bacteria 26936
34 Ga0070688_100142726 3300005365 Bacteria 1629
35 Ga0070659_100118051 3300005366 Bacteria 2146
36 Ga0070659_100422934 3300005366 Bacteria 1127
37 Ga0070667_100001647 3300005367 Bacteria 19972
38 Ga0070703_10027432 3300005406 Bacteria 1697
39 Ga0070701_10019776 3300005438 Bacteria 3185
40 Ga0070711_100037171 3300005439 Bacteria 3265
41 Ga0070700_100115092 3300005441 Bacteria 1794
42 Ga0070663_100001410 3300005455 Bacteria 13139
43 Ga0070663_100009785 3300005455 Bacteria 5954
44 Ga0070678_100013493 3300005456 Bacteria 5126
45 Ga0070678_100031589 3300005456 Bacteria 3656
46 Ga0070678_100250943 3300005456 Bacteria 1484
47 Ga0070678_100663268 3300005456 Bacteria 937
48 Ga0070662_100000007 3300005457 Bacteria 168761
49 Ga0070681_10032650 3300005458 Bacteria 5226
50 Ga0070685_10000018 3300005466 Bacteria 110132
51 Ga0070685_10000142 3300005466 Bacteria 46324
52 Ga0070685_10061070 3300005466 Bacteria 2206
53 Ga0070679_100004180 3300005530 Bacteria 13313
54 Ga0070679_100018917 3300005530 Bacteria 6689
55 Ga0070679_100135888 3300005530 Bacteria 2440
56 Ga0070679_100261196 3300005530 Bacteria 1687
57 Ga0070684_100030694 3300005535 Bacteria 4569
58 Ga0070684_100107492 3300005535 Bacteria 2499
59 Ga0070684_100243693 3300005535 Bacteria 1643
60 Ga0070684_100287992 3300005535 Bacteria 1506
61 Ga0068853_100067597 3300005539 Bacteria 3105
62 Ga0068853_100100626 3300005539 Bacteria 2555
63 Ga0070672_100000030 3300005543 Bacteria 62612
64 Ga0070686_100034395 3300005544 Bacteria 3123
65 Ga0070695_100379688 3300005545 Bacteria 1066
66 Ga0070693_100001370 3300005547 Bacteria 10977
67 Ga0070665_100000776 3300005548 Bacteria 41977
68 Ga0070665_100001190 3300005548 Bacteria 31771
69 Ga0070665_100130454 3300005548 Bacteria 2516
70 Ga0070665_100703241 3300005548 Bacteria 1024
71 Ga0070664_100042879 3300005564 Bacteria 3818
72 Ga0070664_100158166 3300005564 Bacteria 2003
73 Ga0070664_100414037 3300005564 Bacteria 1234
74 Ga0068857_100249196 3300005577 Bacteria 1628
75 Ga0068854_100000031 3300005578 Bacteria 107298
76 Ga0068856_100015030 3300005614 Bacteria 7475
77 Ga0068856_100073883 3300005614 Bacteria 3376
78 Ga0068856_101381778 3300005614 Bacteria 719
79 Ga0070702_100234708 3300005615 Bacteria 1234
80 Ga0068852_100125447 3300005616 Bacteria 2357
81 Ga0068852_100163618 3300005616 Bacteria 2079
82 Ga0068866_10000001 3300005718 Bacteria 519680
83 Ga0068866_10023383 3300005718 Bacteria 2874
84 Ga0068861_100349156 3300005719 Bacteria 1297
85 Ga0068851_10011865 3300005834 Bacteria 4096
86 Ga0068851_10107938 3300005834 Bacteria 1483
87 Ga0068863_100000021 3300005841 Bacteria 198088
88 Ga0068863_100038925 3300005841 Bacteria 4525
89 Ga0068858_100000109 3300005842 Bacteria 86772
90 Ga0068858_100025383 3300005842 Bacteria 5514
91 Ga0068858_100107826 3300005842 Bacteria 2600
92 Ga0068860_100012821 3300005843 Bacteria 8241
93 Ga0068860_100075496 3300005843 Bacteria 3206
94 Ga0068860_100381944 3300005843 Bacteria 1391
95 Ga0068860_100596481 3300005843 Bacteria 1110
96 Ga0068862_100002701 3300005844 Bacteria 15571
97 Ga0081455_10022369 3300005937 Bacteria 5909
98 Ga0081455_10080576 3300005937 Bacteria 2668
99 Ga0081455_10090326 3300005937 Bacteria 2484
100 Ga0081455_10162209 3300005937 Bacteria 1712
101 Ga0081455_10164927 3300005937 Bacteria 1694
102 Ga0081538_10000030 3300005981 Bacteria 124321
103 Ga0081538_10067285 3300005981 Bacteria 2001
104 Ga0081540_1006334 3300005983 Bacteria 8644
105 Ga0081539_10001003 3300005985 Bacteria 52435
106 Ga0081539_10004902 3300005985 Bacteria 14265
107 Ga0081539_10058038 3300005985 Bacteria 2138
108 Ga0075365_10072512 3300006038 Bacteria 2320
109 Ga0075365_10214602 3300006038 Bacteria 1349
110 Ga0075365_10276546 3300006038 Bacteria 1181
111 Ga0075363_100019275 3300006048 Bacteria 3409
112 Ga0075364_10012215 3300006051 Bacteria 5247
113 Ga0075364_10217894 3300006051 Bacteria 1295
114 Ga0070715_10000001 3300006163 Bacteria 693690
115 Ga0070715_10058183 3300006163 Bacteria 1687
116 Ga0070715_10188392 3300006163 Bacteria 1040
117 Ga0070716_100298653 3300006173 Bacteria 1119
118 Ga0070712_100356383 3300006175 Bacteria 1199
119 Ga0075367_10025801 3300006178 Bacteria 3326
120 Ga0075430_100014638 3300006846 Bacteria 6681
121 Ga0075430_100157036 3300006846 Bacteria 1893
122 Ga0075431_100536773 3300006847 Bacteria 1158
123 Ga0075433_10011635 3300006852 Bacteria 7087
124 Ga0075433_10122016 3300006852 Bacteria 2314
125 Ga0075434_100206282 3300006871 Bacteria 1986
126 Ga0068865_100000301 3300006881 Bacteria 27213
127 Ga0068865_100194176 3300006881 Bacteria 1572
128 Ga0075435_100460474 3300007076 Bacteria 1097
129 Ga0111539_10134875 3300009094 Bacteria 2891
130 Ga0105245_10000180 3300009098 Bacteria 59695
131 Ga0105245_10000832 3300009098 Bacteria 28099
132 Ga0105245_10011890 3300009098 Bacteria 7568
133 Ga0105245_10014301 3300009098 Bacteria 6917
134 Ga0105247_10000323 3300009101 Bacteria 42551
135 Ga0114129_10153933 3300009147 Bacteria 3146
136 Ga0105243_10010482 3300009148 Bacteria 7038
137 Ga0105243_10014733 3300009148 Bacteria 5914
138 Ga0105243_10332854 3300009148 Bacteria 1388
139 Ga0105242_10003600 3300009176 Bacteria 12051
140 Ga0105242_10048894 3300009176 Bacteria 3439
141 Ga0105248_10000032 3300009177 Bacteria 201114
142 Ga0105248_10213460 3300009177 Bacteria 2174
143 Ga0105248_10240120 3300009177 Bacteria 2039
144 Ga0105238_10000201 3300009551 Bacteria 66092
145 Ga0105238_10650894 3300009551 Bacteria 1064
146 Ga0105249_10000074 3300009553 Bacteria 145235
147 Ga0105249_10028847 3300009553 Bacteria 5009
148 Ga0105249_10967641 3300009553 Bacteria 919
149 Ga0105249_11009895 3300009553 Bacteria 901
150 Ga0105239_10054592 3300010375 Bacteria 4383
151 Ga0105239_10428672 3300010375 Bacteria 1499
152 Ga0105246_10171863 3300011119 Bacteria 1660
153 Ga0157371_10013940 3300013102 Bacteria 6088
154 Ga0157370_10003066 3300013104 Bacteria 19809
155 Ga0157370_10069893 3300013104 Bacteria 3316
156 Ga0157369_10135949 3300013105 Bacteria 2603
157 Ga0157374_10001471 3300013296 Bacteria 19884
158 Ga0157378_10002558 3300013297 Bacteria 16176
159 Ga0163162_10329846 3300013306 Bacteria 1658
160 Ga0157372_10000308 3300013307 Bacteria 54161
161 Ga0157375_10004976 3300013308 Bacteria 11555
162 Ga0157375_10210708 3300013308 Bacteria 2100
163 Ga0157375_10217413 3300013308 Bacteria 2069
164 Ga0157380_10000158 3300014326 Bacteria 39132
165 Ga0157380_10030540 3300014326 Bacteria 4128
166 Ga0157377_10012521 3300014745 Bacteria 4268
167 Ga0157377_10475511 3300014745 Bacteria 868
168 Ga0157379_10004315 3300014968 Bacteria 12160
169 Ga0206354_11582559 3300020081 Bacteria 959
170 Ga0207656_10000321 3300025321 Bacteria 16492
171 Ga0207656_10027041 3300025321 Bacteria 2344
172 Ga0207653_10021814 3300025885 Bacteria 2032
173 Ga0207682_10000182 3300025893 Bacteria 28392
174 Ga0207642_10000006 3300025899 Bacteria 230268
175 Ga0207642_10000007 3300025899 Bacteria 226017
176 Ga0207710_10000549 3300025900 Bacteria 22590
177 Ga0207688_10137767 3300025901 Bacteria 1434
178 Ga0207680_10005946 3300025903 Bacteria 5864
179 Ga0207680_10010817 3300025903 Bacteria 4581
180 Ga0207680_10039292 3300025903 Bacteria 2745
181 Ga0207685_10000011 3300025905 Bacteria 213430
182 Ga0207643_10027450 3300025908 Bacteria 3156
183 Ga0207705_10067792 3300025909 Bacteria 2583
184 Ga0207705_10182098 3300025909 Bacteria 1586
185 Ga0207705_10231880 3300025909 Bacteria 1404
186 Ga0207654_10212095 3300025911 Bacteria 1280
187 Ga0207707_10017275 3300025912 Bacteria 6288
188 Ga0207693_10007556 3300025915 Bacteria 8932
189 Ga0207663_10000683 3300025916 Bacteria 15043
190 Ga0207663_10087442 3300025916 Bacteria 2058
191 Ga0207649_10000076 3300025920 Bacteria 83824
192 Ga0207649_10277162 3300025920 Bacteria 1218
193 Ga0207652_10000370 3300025921 Bacteria 46725
194 Ga0207652_10012858 3300025921 Bacteria 6767
195 Ga0207652_10286443 3300025921 Bacteria 1486
196 Ga0207652_10313304 3300025921 Bacteria 1416
197 Ga0207694_10000004 3300025924 Bacteria 967075
198 Ga0207650_10106478 3300025925 Bacteria 2166
199 Ga0207659_10000010 3300025926 Bacteria 286639
200 Ga0207659_10054482 3300025926 Bacteria 2857
201 Ga0207687_10000007 3300025927 Bacteria 604185
202 Ga0207687_10000018 3300025927 Bacteria 236159
203 Ga0207687_10002274 3300025927 Bacteria 13067
204 Ga0207687_10005996 3300025927 Bacteria 8042
205 Ga0207687_10139451 3300025927 Bacteria 1838
206 Ga0207687_10250988 3300025927 Unclassified 1406
207 Ga0207700_10529288 3300025928 Bacteria 1045
208 Ga0207644_10301525 3300025931 Bacteria 1291
209 Ga0207690_10091435 3300025932 Bacteria 2151
210 Ga0207690_10392888 3300025932 Bacteria 1105
211 Ga0207706_10000018 3300025933 Bacteria 168729
212 Ga0207686_10000859 3300025934 Bacteria 18488
213 Ga0207686_10612009 3300025934 Bacteria 858
214 Ga0207709_10010539 3300025935 Bacteria 5091
215 Ga0207709_10023271 3300025935 Bacteria 3525
216 Ga0207670_10174054 3300025936 Bacteria 1616
217 Ga0207669_10000009 3300025937 Bacteria 168012
218 Ga0207669_10004394 3300025937 Bacteria 6202
219 Ga0207669_10331622 3300025937 Bacteria 1168
220 Ga0207704_10000720 3300025938 Bacteria 14555
221 Ga0207704_10161763 3300025938 Bacteria 1594
222 Ga0207665_10154233 3300025939 Bacteria 1647
223 Ga0207665_10253483 3300025939 Bacteria 1301
224 Ga0207691_10000190 3300025940 Bacteria 58438
225 Ga0207691_10009388 3300025940 Bacteria 9394
226 Ga0207711_10000020 3300025941 Bacteria 363325
227 Ga0207661_10000403 3300025944 Bacteria 27999
228 Ga0207661_10004642 3300025944 Bacteria 9622
229 Ga0207661_10012409 3300025944 Bacteria 6191
230 Ga0207661_10252826 3300025944 Bacteria 1567
231 Ga0207679_10067633 3300025945 Bacteria 2681
232 Ga0207679_10119171 3300025945 Bacteria 2098
233 Ga0207679_10149061 3300025945 Bacteria 1901
234 Ga0207679_10486131 3300025945 Bacteria 1100
235 Ga0207651_10112095 3300025960 Bacteria 2050
236 Ga0207712_10000007 3300025961 Bacteria 539589
237 Ga0207712_10133084 3300025961 Bacteria 1897
238 Ga0207668_10044195 3300025972 Bacteria 3029
239 Ga0207668_10580458 3300025972 Bacteria 974
240 Ga0207640_10000015 3300025981 Bacteria 215411
241 Ga0207658_10001533 3300025986 Bacteria 17952
242 Ga0207658_10023756 3300025986 Bacteria 4282
243 Ga0207677_10000392 3300026023 Bacteria 30151
244 Ga0207677_10000821 3300026023 Bacteria 17760
245 Ga0207703_10000040 3300026035 Bacteria 168191
246 Ga0207703_10014850 3300026035 Bacteria 6078
247 Ga0207703_10128161 3300026035 Bacteria 2188
248 Ga0207639_10011619 3300026041 Bacteria 6119
249 Ga0207639_10044087 3300026041 Bacteria 3353
250 Ga0207639_10078135 3300026041 Bacteria 2611
251 Ga0207678_10000965 3300026067 Bacteria 26298
252 Ga0207678_10017172 3300026067 Bacteria 6353
253 Ga0207708_10010731 3300026075 Bacteria 6810
254 Ga0207702_10000016 3300026078 Bacteria 226633
255 Ga0207702_10012239 3300026078 Bacteria 7139
256 Ga0207702_10293130 3300026078 Bacteria 1542
257 Ga0207702_10314175 3300026078 Bacteria 1491
258 Ga0207702_10482975 3300026078 Bacteria 1206
259 Ga0207641_10000094 3300026088 Bacteria 124545
260 Ga0207641_10022402 3300026088 Bacteria 5201
261 Ga0207676_10000016 3300026095 Bacteria 311561
262 Ga0207675_100373128 3300026118 Bacteria 1402
263 Ga0207683_10049359 3300026121 Bacteria 3684
264 Ga0207683_10053995 3300026121 Bacteria 3523
265 Ga0207683_10248819 3300026121 Bacteria 1622
266 Ga0207698_10024398 3300026142 Bacteria 4244
267 Ga0207698_10237811 3300026142 Bacteria 1658
268 Ga0207698_10648387 3300026142 Bacteria 1046
269 Ga0207428_10020111 3300027907 Bacteria 5679
270 Ga0268266_10000085 3300028379 Bacteria 201288
271 Ga0268266_10012151 3300028379 Bacteria 7452
272 Ga0268266_10016714 3300028379 Bacteria 6272
273 Ga0268266_10046993 3300028379 Bacteria 3695
274 Ga0268265_10004381 3300028380 Bacteria 9813
275 Ga0268265_10418039 3300028380 Bacteria 1244
276 Ga0268264_10002386 3300028381 Bacteria 16562
277 Ga0268264_10531421 3300028381 Bacteria 1151
278 Ga0265319_1000025 3300028563 Bacteria 142639
279 Ga0265338_10000486 3300028800 Bacteria 70900
280 Ga0307413_10231805 3300031824 Bacteria 1357
281 Ga0307413_10669300 3300031824 Bacteria 858
282 Ga0307407_10426081 3300031903 Bacteria 957
283 Ga0307409_100006593 3300031995 Bacteria 6844
284 Ga0307409_100012316 3300031995 Bacteria 5445
285 Ga0307416_100004093 3300032002 Bacteria 8721
286 Ga0307416_100069010 3300032002 Bacteria 2923
287 Ga0307415_100243460 3300032126 Bacteria 1456
288 Ga0307415_100337501 3300032126 Bacteria 1263
289 Ga0316574_0047407 3300035398 Bacteria 2667
290 Ga0373925_0113370 3300037068 Bacteria 2097
291 Ga0395900_0255786 3300037418 Bacteria 1751
292 Ga0395900_0274135 3300037418 Bacteria 1681
293 Ga0451839_0988598 3300041496 Bacteria 867
294 Ga0451853_3221651 3300041512 Bacteria 929
295 Ga0466966_0055892 3300044684 Bacteria 2498
296 Ga0466963_0000312 3300044694 Bacteria 21872
297 Ga0466963_0023650 3300044694 Bacteria 3905
298 Ga0466963_0035111 3300044694 Bacteria 3265
299 Ga0466963_0451936 3300044694 Bacteria 907
300 Ga0466957_0066244 3300044842 Bacteria 2226
301 Ga0466957_0131527 3300044842 Bacteria 1604
302 Ga0466960_0105417 3300044901 Bacteria 1457
303 Ga0466958_0040747 3300045836 Bacteria 2792
304 Ga0466967_0000033 3300045976 Bacteria 54859
305 Ga0466967_0146488 3300045976 Bacteria 2203
306 Ga0466967_0268156 3300045976 Bacteria 1635
307 Ga0466967_0292033 3300045976 Bacteria 1566
308 Ga0495603_0007993 3300046455 Bacteria 6385
309 Ga0495591_041366 3300046458 Bacteria 1309
310 Ga0495629_0006408 3300046459 Bacteria 8724
311 Ga0495629_0007203 3300046459 Bacteria 8190
312 Ga0495641_0006893 3300046461 Bacteria 7252
313 Ga0495641_0013209 3300046461 Bacteria 4555
314 Ga0495653_0358047 3300046463 Bacteria 937
315 Ga0495582_0006962 3300046473 Bacteria 6289
316 Ga0495662_0093522 3300046476 Bacteria 1467
317 Ga0495662_0325575 3300046476 Bacteria 756
318 Ga0495594_0000003 3300046499 Bacteria 199267
319 Ga0495594_0172051 3300046499 Bacteria 1232
320 Ga0495596_0104682 3300046500 Bacteria 1099
321 Ga0495606_0000221 3300046507 Bacteria 101157
322 Ga0495608_0000031 3300046511 Bacteria 145255
323 Ga0495618_0000004 3300046514 Bacteria 245690
324 Ga0495620_0000246 3300046515 Bacteria 40444
325 Ga0495628_0000595 3300046516 Bacteria 33337
326 Ga0495628_0022989 3300046516 Bacteria 5118
327 Ga0495628_0094633 3300046516 Bacteria 2309
328 Ga0495628_0183765 3300046516 Bacteria 1580
329 Ga0495630_0000018 3300046517 Bacteria 186064
330 Ga0495630_0027320 3300046517 Bacteria 4232
331 Ga0495652_0000019 3300046529 Bacteria 190248
332 Ga0495640_0014065 3300046533 Bacteria 6069
333 Ga0495587_0001523 3300046536 Bacteria 15407
334 Ga0495587_0077590 3300046536 Bacteria 1928
335 Ga0495598_0000203 3300046537 Bacteria 10475
336 Ga0495621_0001660 3300046539 Bacteria 5832
337 Ga0495622_0000014 3300046557 Bacteria 182142
338 Ga0495667_0000032 3300046559 Bacteria 143493
339 Ga0495668_0453962 3300046616 Bacteria 705
340 Ga0495634_0000050 3300046642 Bacteria 94546
341 Ga0495625_0000122 3300046660 Bacteria 121146
342 Ga0495588_0000376 3300046674 Bacteria 26068
343 Ga0495657_0000024 3300046675 Bacteria 145255
344 Ga0495599_0035946 3300046678 Bacteria 3109
345 Ga0495647_0000228 3300046681 Bacteria 15271
346 Ga0495658_0000025 3300046683 Bacteria 79910
347 Ga0495669_0000126 3300046684 Bacteria 48798
348 Ga0495669_0018686 3300046684 Bacteria 2982
349 Ga0495669_0033510 3300046684 Bacteria 2261
350 Ga0495613_0000152 3300046689 Bacteria 68384
351 Ga0495624_0000009 3300046690 Bacteria 145026
352 Ga0495624_0000037 3300046690 Bacteria 83796
353 Ga0495600_0070478 3300046809 Bacteria 2284
354 Ga0495600_0075269 3300046809 Bacteria 2205
355 Ga0495600_0170897 3300046809 Bacteria 1403
356 Ga0495604_0000038 3300047317 Bacteria 123703
357 Ga0495604_0000073 3300047317 Bacteria 86844
358 Ga0495604_0104449 3300047317 Bacteria 2076
359 Ga0495674_0000042 3300047319 Bacteria 94820
360 Ga0495674_0111902 3300047319 Bacteria 2314
361 Ga0495672_0031181 3300047320 Bacteria 3331
362 Ga0495672_0113523 3300047320 Bacteria 1451
363 Ga0495676_0001150 3300047321 Bacteria 22493
364 Ga0495676_0006325 3300047321 Bacteria 10903
365 Ga0495676_0027941 3300047321 Bacteria 4830
366 Ga0495676_0056484 3300047321 Bacteria 3104
367 Ga0495676_0200395 3300047321 Bacteria 1387
368 Ga0495680_0005346 3300047322 Bacteria 12116
369 Ga0495675_0000090 3300047444 Bacteria 63705
370 Ga0495675_0003673 3300047444 Bacteria 9275
371 Ga0495685_041322 3300047447 Bacteria 1576
372 Ga0495673_0059073 3300047469 Bacteria 1650
373 Ga0495593_0121148 3300047673 Bacteria 1331
374 Ga0495593_0203305 3300047673 Bacteria 995
375 Ga0495602_0001155 3300048088 Bacteria 25844
376 Ga0495614_0051308 3300048089 Bacteria 1768
377 Ga0496100_0000002 3300048903 Bacteria 489057
378 Ga0496100_0000038 3300048903 Bacteria 94110
379 Ga0496100_0269056 3300048903 Bacteria 1266
380 Ga0496101_0000001 3300048904 Bacteria 489057
381 Ga0496101_0000153 3300048904 Bacteria 59317
382 Ga0496101_0053959 3300048904 Bacteria 2901
383 Ga0496101_0078457 3300048904 Bacteria 2436
384 Ga0496102_0943011 3300048905 Bacteria 784
385 Ga0496103_0004880 3300048906 Bacteria 8101
386 Ga0496103_0075422 3300048906 Bacteria 2115
387 Ga0496103_0076257 3300048906 Bacteria 2103
388 Ga0496105_0000006 3300048908 Bacteria 393578
389 Ga0496105_0079564 3300048908 Bacteria 2707
390 Ga0496106_0000018 3300048909 Bacteria 175028
391 Ga0496106_0000022 3300048909 Bacteria 166339
392 Ga0496106_0000138 3300048909 Bacteria 54275
393 Ga0496106_0029896 3300048909 Bacteria 4061
394 Ga0496106_0034441 3300048909 Bacteria 3782
395 Ga0496106_0683083 3300048909 Unclassified 819
396 Ga0496106_0769575 3300048909 Bacteria 765
397 Ga0496107_0000006 3300048910 Bacteria 258746
398 Ga0496107_0000016 3300048910 Bacteria 172319
399 Ga0496107_0004661 3300048910 Bacteria 9306
400 Ga0496107_0060785 3300048910 Bacteria 2735
401 Ga0496107_0427057 3300048910 Bacteria 985
402 Ga0496108_0000107 3300048911 Bacteria 86395
403 Ga0496108_0000150 3300048911 Bacteria 67068
404 Ga0496108_0018497 3300048911 Bacteria 5706
405 Ga0496108_0045648 3300048911 Bacteria 3660
406 Ga0496109_0000007 3300048912 Bacteria 247554
407 Ga0496109_0000028 3300048912 Bacteria 168138
408 Ga0496109_0000190 3300048912 Bacteria 61169
409 Ga0496109_0000693 3300048912 Bacteria 28050
410 Ga0496109_0113848 3300048912 Bacteria 2516
411 Ga0496110_0001693 3300048913 Bacteria 16200
412 Ga0496110_0044429 3300048913 Bacteria 3880
413 Ga0496110_0048191 3300048913 Bacteria 3734
414 Ga0496110_0354377 3300048913 Bacteria 1337
415 Ga0496111_0021513 3300048914 Bacteria 4506
416 Ga0496111_0027521 3300048914 Bacteria 4022
417 Ga0496111_0039014 3300048914 Bacteria 3403
418 Ga0496112_0125426 3300048915 Bacteria 2538
419 Ga0496113_0082039 3300048916 Bacteria 2472
420 Ga0496113_0116488 3300048916 Bacteria 2085
421 Ga0496113_0165063 3300048916 Bacteria 1752
422 Ga0496113_0266292 3300048916 Bacteria 1369
423 Ga0496114_0018437 3300048917 Bacteria 5642
424 Ga0496114_0043059 3300048917 Bacteria 3744
425 Ga0496114_0231431 3300048917 Bacteria 1624
426 Ga0496115_0000316 3300048918 Bacteria 41025
427 Ga0496115_0086443 3300048918 Bacteria 2558
428 Ga0496116_0000769 3300048919 Bacteria 40716
429 Ga0496117_0001943 3300048920 Bacteria 27588
430 Ga0496119_0003085 3300048922 Bacteria 17574
431 Ga0496119_0025079 3300048922 Bacteria 4173
432 Ga0496120_0003588 3300048923 Bacteria 13945
433 Ga0496121_0004930 3300048924 Bacteria 17505
434 Ga0496121_0043578 3300048924 Bacteria 3884
435 Ga0496121_0219216 3300048924 Bacteria 1341
436 Ga0496124_0104348 3300048927 Bacteria 2292
437 Ga0496126_0081806 3300048929 Bacteria 2854
438 Ga0496126_0288616 3300048929 Bacteria 1357
439 Ga0501032_0065115 3300049569 Bacteria 2438
440 Ga0501033_0004761 3300049570 Bacteria 10847
441 Ga0501034_0059391 3300049571 Bacteria 3841
442 Ga0501034_0110742 3300049571 Bacteria 2736
443 Ga0501034_0111633 3300049571 Bacteria 2724
444 Ga0501036_0099620 3300049572 Bacteria 2457
445 Ga0501036_0603579 3300049572 Bacteria 910
446 Ga0501037_0388682 3300049573 Bacteria 958
447 Ga0501038_0066271 3300049574 Bacteria 3075
448 Ga0501039_0101035 3300049575 Bacteria 2251
449 Ga0501039_0217504 3300049575 Bacteria 1502
450 Ga0501040_0474519 3300049576 Bacteria 901
451 Ga0501042_0077912 3300049578 Bacteria 2374
452 Ga0501042_0160584 3300049578 Bacteria 1621
453 Ga0501043_0076045 3300049579 Bacteria 2637
454 Ga0501043_0394537 3300049579 Bacteria 1046
455 Ga0501046_0000162 3300049580 Bacteria 69629
456 Ga0501046_0549629 3300049580 Bacteria 823
457 Ga0501047_0000263 3300049581 Bacteria 61685
458 Ga0501047_0098610 3300049581 Bacteria 2800
459 Ga0501047_0132626 3300049581 Bacteria 2371
460 Ga0501048_0072361 3300049582 Bacteria 2433
461 Ga0501067_0002329 3300049583 Bacteria 10503
462 Ga0501067_0067574 3300049583 Bacteria 1979
463 Ga0501068_0076036 3300049584 Bacteria 2054
464 Ga0501068_0089799 3300049584 Bacteria 1895
465 Ga0501068_0129118 3300049584 Bacteria 1580
466 Ga0501068_0159406 3300049584 Bacteria 1422
467 Ga0501070_0001887 3300049586 Bacteria 18534
468 Ga0501070_0021753 3300049586 Bacteria 5375
469 Ga0501071_0120916 3300049587 Bacteria 1941
470 Ga0501071_0152022 3300049587 Bacteria 1727
471 Ga0501071_0237172 3300049587 Bacteria 1375
472 Ga0501072_0065291 3300049588 Bacteria 2870
473 Ga0501073_0072519 3300049589 Bacteria 2398
474 Ga0501074_0009267 3300049590 Bacteria 7150
475 Ga0501074_0253859 3300049590 Bacteria 1250
476 Ga0501074_0296545 3300049590 Bacteria 1148
477 Ga0501075_0021845 3300049591 Bacteria 4669
478 Ga0501076_0151600 3300049592 Bacteria 1886
479 Ga0501076_0501316 3300049592 Bacteria 1001
480 Ga0501079_0266326 3300049741 Bacteria 1339
481 Ga0501079_0273831 3300049741 Bacteria 1319
482 Ga0501081_0080884 3300049743 Bacteria 2275
483 Ga0501083_0056429 3300049744 Bacteria 2631
484 Ga0501083_0066187 3300049744 Bacteria 2406
485 Ga0501035_0000391 3300049822 Bacteria 50329
486 Ga0501035_0455326 3300049822 Bacteria 1058
487 Ga0501044_0003076 3300049823 Bacteria 18881
488 Ga0501044_0030206 3300049823 Bacteria 5712
489 Ga0501044_0030682 3300049823 Bacteria 5663
490 Ga0501045_0029512 3300049824 Bacteria 3965
491 nmdc:mga03n38_12578_c1 3300050490 Bacteria 3189
492 nmdc:mga00v17_263485_c1 3300050491 Bacteria 1118
493 nmdc:mga00v17_269744_c1 3300050491 Bacteria 1104
494 nmdc:mga00v17_67695_c1 3300050491 Bacteria 2207
495 nmdc:mga0yw44_157248_c1 3300050492 Bacteria 1486
496 nmdc:mga0yw44_173853_c1 3300050492 Bacteria 1415
497 nmdc:mga0yw44_199314_c1 3300050492 Bacteria 1322
498 nmdc:mga0yw44_36425_c1 3300050492 Bacteria 2899
499 nmdc:mga0yw44_41116_c1 3300050492 Bacteria 2750
500 nmdc:mga0yw44_517217_c1 3300050492 Bacteria 810
501 nmdc:mga0yw44_636979_c1 3300050492 Bacteria 724
502 nmdc:mga05p37_490020_c1 3300050507 Bacteria 1413
503 nmdc:mga09592_386919_c1 3300050508 Bacteria 1209
504 nmdc:mga0qj67_110266_c1 3300050509 Bacteria 2221
505 nmdc:mga0qj67_126729_c1 3300050509 Bacteria 2066
506 nmdc:mga06r32_2035_c1 3300050510 Bacteria 18077
507 nmdc:mga06r32_685514_c1 3300050510 Bacteria 991
508 nmdc:mga08y16_15591_c1 3300050511 Bacteria 7991
509 nmdc:mga0n895_198093_c1 3300050512 Bacteria 2040
510 nmdc:mga0rr50_101735_c1 3300050513 Bacteria 2259
511 nmdc:mga0rr50_262728_c1 3300050513 Bacteria 1436
512 nmdc:mga0rr50_357521_c1 3300050513 Bacteria 1229
513 nmdc:mga0a205_28171_c1 3300050515 Bacteria 3845
514 nmdc:mga0a205_3884_c1 3300050515 Bacteria 13377
515 Ga0495601_0000039 3300053077 Bacteria 79594
516 Ga0495601_0000126 3300053077 Bacteria 42871
517 Ga0495612_0000195 3300053078 Bacteria 25890
518 Ga0495612_0003451 3300053078 Bacteria 6551
519 Ga0495612_0007882 3300053078 Bacteria 4342
520 Ga0495612_0012840 3300053078 Bacteria 3376
521 Ga0495595_0000014 3300053084 Bacteria 145255
522 Ga0495619_0000021 3300053085 Bacteria 187095
523 Ga0495619_0000114 3300053085 Bacteria 59624
524 Ga0495619_0000135 3300053085 Bacteria 54848
525 Ga0495619_0014237 3300053085 Bacteria 5024
526 Ga0500566_0019922 3300053094 Bacteria 3938
527 Ga0500595_005432 3300053119 Bacteria 5563
528 Ga0501084_0047868 3300054114 Bacteria 3580
529 Ga0501084_0450216 3300054114 Bacteria 1088
530 Ga0501084_0898194 3300054114 Bacteria 745
531 Ga0501082_0030821 3300060353 Bacteria 4623
532 Ga0501082_0106259 3300060353 Bacteria 2428
533 Ga0501082_0514708 3300060353 Bacteria 1046
534 Ga0530510_0033777 3300061734 Bacteria 3683
535 Ga0530510_0165866 3300061734 Bacteria 1635
536 Ga0466964_0083598
537 JGI24740J21852_10006219
538 JGI24748J21848_1000299
539 JGI24034J26672_10000180
540 JGI24751J29686_10007587
541 JGI25407J50210_10012274
542 Ga0070658_10274672
543 Ga0070683_100003289
544 Ga0070683_100006767
545 Ga0070683_100295190
546 Ga0070670_100147222
547 Ga0070677_10000098
548 Ga0070680_100283461
549 Ga0070682_100000013
550 Ga0070682_100000421
551 Ga0070682_100016042
552 Ga0068868_100004331
553 Ga0068868_100004773
554 Ga0070691_10004831
555 Ga0070661_100000599
556 Ga0070661_100336554
557 Ga0070661_100395489
558 Ga0070692_10022930
559 Ga0070692_10043138
560 Ga0070668_100395499
561 Ga0070675_100000053
562 Ga0070675_100064623
563 Ga0070674_100000025
564 Ga0070674_100023380
565 Ga0070674_100040199
566 Ga0070673_100169977
567 Ga0070688_100000012
568 Ga0070688_100000269
569 Ga0070688_100142726
570 Ga0070659_100118051
571 Ga0070659_100422934
572 Ga0070667_100001647
573 Ga0070703_10027432
574 Ga0070701_10019776
575 Ga0070711_100037171
576 Ga0070700_100115092
577 Ga0070663_100001410
578 Ga0070663_100009785
579 Ga0070678_100013493
580 Ga0070678_100031589
581 Ga0070678_100250943
582 Ga0070678_100663268
583 Ga0070662_100000007
584 Ga0070681_10032650
585 Ga0070685_10000018
586 Ga0070685_10000142
587 Ga0070685_10061070
588 Ga0070679_100004180
589 Ga0070679_100018917
590 Ga0070679_100135888
591 Ga0070679_100261196
592 Ga0070684_100030694
593 Ga0070684_100107492
594 Ga0070684_100243693
595 Ga0070684_100287992
596 Ga0068853_100067597
597 Ga0068853_100100626
598 Ga0070672_100000030
599 Ga0070686_100034395
600 Ga0070695_100379688
601 Ga0070693_100001370
602 Ga0070665_100000776
603 Ga0070665_100001190
604 Ga0070665_100130454
605 Ga0070665_100703241
606 Ga0070664_100042879
607 Ga0070664_100158166
608 Ga0070664_100414037
609 Ga0068857_100249196
610 Ga0068854_100000031
611 Ga0068856_100015030
612 Ga0068856_100073883
613 Ga0068856_101381778
614 Ga0070702_100234708
615 Ga0068852_100125447
616 Ga0068852_100163618
617 Ga0068866_10000001
618 Ga0068866_10023383
619 Ga0068861_100349156
620 Ga0068851_10011865
621 Ga0068851_10107938
622 Ga0068863_100000021
623 Ga0068863_100038925
624 Ga0068858_100000109
625 Ga0068858_100025383
626 Ga0068858_100107826
627 Ga0068860_100012821
628 Ga0068860_100075496
629 Ga0068860_100381944
630 Ga0068860_100596481
631 Ga0068862_100002701
632 Ga0081455_10022369
633 Ga0081455_10080576
634 Ga0081455_10090326
635 Ga0081455_10162209
636 Ga0081455_10164927
637 Ga0081538_10000030
638 Ga0081538_10067285
639 Ga0081540_1006334
640 Ga0081539_10001003
641 Ga0081539_10004902
642 Ga0081539_10058038
643 Ga0075365_10072512
644 Ga0075365_10214602
645 Ga0075365_10276546
646 Ga0075363_100019275
647 Ga0075364_10012215
648 Ga0075364_10217894
649 Ga0070715_10000001
650 Ga0070715_10058183
651 Ga0070715_10188392
652 Ga0070716_100298653
653 Ga0070712_100356383
654 Ga0075367_10025801
655 Ga0075430_100014638
656 Ga0075430_100157036
657 Ga0075431_100536773
658 Ga0075433_10011635
659 Ga0075433_10122016
660 Ga0075434_100206282
661 Ga0068865_100000301
662 Ga0068865_100194176
663 Ga0075435_100460474
664 Ga0111539_10134875
665 Ga0105245_10000180
666 Ga0105245_10000832
667 Ga0105245_10011890
668 Ga0105245_10014301
669 Ga0105247_10000323
670 Ga0114129_10153933
671 Ga0105243_10010482
672 Ga0105243_10014733
673 Ga0105243_10332854
674 Ga0105242_10003600
675 Ga0105242_10048894
676 Ga0105248_10000032
677 Ga0105248_10213460
678 Ga0105248_10240120
679 Ga0105238_10000201
680 Ga0105238_10650894
681 Ga0105249_10000074
682 Ga0105249_10028847
683 Ga0105249_10967641
684 Ga0105249_11009895
685 Ga0105239_10054592
686 Ga0105239_10428672
687 Ga0105246_10171863
688 Ga0157371_10013940
689 Ga0157370_10003066
690 Ga0157370_10069893
691 Ga0157369_10135949
692 Ga0157374_10001471
693 Ga0157378_10002558
694 Ga0163162_10329846
695 Ga0157372_10000308
696 Ga0157375_10004976
697 Ga0157375_10210708
698 Ga0157375_10217413
699 Ga0157380_10000158
700 Ga0157380_10030540
701 Ga0157377_10012521
702 Ga0157377_10475511
703 Ga0157379_10004315
704 Ga0206354_11582559
705 Ga0207656_10000321
706 Ga0207656_10027041
707 Ga0207653_10021814
708 Ga0207682_10000182
709 Ga0207642_10000006
710 Ga0207642_10000007
711 Ga0207710_10000549
712 Ga0207688_10137767
713 Ga0207680_10005946
714 Ga0207680_10010817
715 Ga0207680_10039292
716 Ga0207685_10000011
717 Ga0207643_10027450
718 Ga0207705_10067792
719 Ga0207705_10182098
720 Ga0207705_10231880
721 Ga0207654_10212095
722 Ga0207707_10017275
723 Ga0207693_10007556
724 Ga0207663_10000683
725 Ga0207663_10087442
726 Ga0207649_10000076
727 Ga0207649_10277162
728 Ga0207652_10000370
729 Ga0207652_10012858
730 Ga0207652_10286443
731 Ga0207652_10313304
732 Ga0207694_10000004
733 Ga0207650_10106478
734 Ga0207659_10000010
735 Ga0207659_10054482
736 Ga0207687_10000007
737 Ga0207687_10000018
738 Ga0207687_10002274
739 Ga0207687_10005996
740 Ga0207687_10139451
741 Ga0207687_10250988
742 Ga0207700_10529288
743 Ga0207644_10301525
744 Ga0207690_10091435
745 Ga0207690_10392888
746 Ga0207706_10000018
747 Ga0207686_10000859
748 Ga0207686_10612009
749 Ga0207709_10010539
750 Ga0207709_10023271
751 Ga0207670_10174054
752 Ga0207669_10000009
753 Ga0207669_10004394
754 Ga0207669_10331622
755 Ga0207704_10000720
756 Ga0207704_10161763
757 Ga0207665_10154233
758 Ga0207665_10253483
759 Ga0207691_10000190
760 Ga0207691_10009388
761 Ga0207711_10000020
762 Ga0207661_10000403
763 Ga0207661_10004642
764 Ga0207661_10012409
765 Ga0207661_10252826
766 Ga0207679_10067633
767 Ga0207679_10119171
768 Ga0207679_10149061
769 Ga0207679_10486131
770 Ga0207651_10112095
771 Ga0207712_10000007
772 Ga0207712_10133084
773 Ga0207668_10044195
774 Ga0207668_10580458
775 Ga0207640_10000015
776 Ga0207658_10001533
777 Ga0207658_10023756
778 Ga0207677_10000392
779 Ga0207677_10000821
780 Ga0207703_10000040
781 Ga0207703_10014850
782 Ga0207703_10128161
783 Ga0207639_10011619
784 Ga0207639_10044087
785 Ga0207639_10078135
786 Ga0207678_10000965
787 Ga0207678_10017172
788 Ga0207708_10010731
789 Ga0207702_10000016
790 Ga0207702_10012239
791 Ga0207702_10293130
792 Ga0207702_10314175
793 Ga0207702_10482975
794 Ga0207641_10000094
795 Ga0207641_10022402
796 Ga0207676_10000016
797 Ga0207675_100373128
798 Ga0207683_10049359
799 Ga0207683_10053995
800 Ga0207683_10248819
801 Ga0207698_10024398
802 Ga0207698_10237811
803 Ga0207698_10648387
804 Ga0207428_10020111
805 Ga0268266_10000085
806 Ga0268266_10012151
807 Ga0268266_10016714
808 Ga0268266_10046993
809 Ga0268265_10004381
810 Ga0268265_10418039
811 Ga0268264_10002386
812 Ga0268264_10531421
813 Ga0265319_1000025
814 Ga0265338_10000486
815 Ga0307413_10231805
816 Ga0307413_10669300
817 Ga0307407_10426081
818 Ga0307409_100006593
819 Ga0307409_100012316
820 Ga0307416_100004093
821 Ga0307416_100069010
822 Ga0307415_100243460
823 Ga0307415_100337501
824 Ga0316574_0047407
825 Ga0373925_0113370
826 Ga0395900_0255786
827 Ga0395900_0274135
828 Ga0451839_0988598
829 Ga0451853_3221651
830 Ga0466966_0055892
831 Ga0466963_0000312
832 Ga0466963_0023650
833 Ga0466963_0035111
834 Ga0466963_0451936
835 Ga0466957_0066244
836 Ga0466957_0131527
837 Ga0466960_0105417
838 Ga0466958_0040747
839 Ga0466967_0000033
840 Ga0466967_0146488
841 Ga0466967_0268156
842 Ga0466967_0292033
843 Ga0495603_0007993
844 Ga0495591_041366
845 Ga0495629_0006408
846 Ga0495629_0007203
847 Ga0495641_0006893
848 Ga0495641_0013209
849 Ga0495653_0358047
850 Ga0495582_0006962
851 Ga0495662_0093522
852 Ga0495662_0325575
853 Ga0495594_0000003
854 Ga0495594_0172051
855 Ga0495596_0104682
856 Ga0495606_0000221
857 Ga0495608_0000031
858 Ga0495618_0000004
859 Ga0495620_0000246
860 Ga0495628_0000595
861 Ga0495628_0022989
862 Ga0495628_0094633
863 Ga0495628_0183765
864 Ga0495630_0000018
865 Ga0495630_0027320
866 Ga0495652_0000019
867 Ga0495640_0014065
868 Ga0495587_0001523
869 Ga0495587_0077590
870 Ga0495598_0000203
871 Ga0495621_0001660
872 Ga0495622_0000014
873 Ga0495667_0000032
874 Ga0495668_0453962
875 Ga0495634_0000050
876 Ga0495625_0000122
877 Ga0495588_0000376
878 Ga0495657_0000024
879 Ga0495599_0035946
880 Ga0495647_0000228
881 Ga0495658_0000025
882 Ga0495669_0000126
883 Ga0495669_0018686
884 Ga0495669_0033510
885 Ga0495613_0000152
886 Ga0495624_0000009
887 Ga0495624_0000037
888 Ga0495600_0070478
889 Ga0495600_0075269
890 Ga0495600_0170897
891 Ga0495604_0000038
892 Ga0495604_0000073
893 Ga0495604_0104449
894 Ga0495674_0000042
895 Ga0495674_0111902
896 Ga0495672_0031181
897 Ga0495672_0113523
898 Ga0495676_0001150
899 Ga0495676_0006325
900 Ga0495676_0027941
901 Ga0495676_0056484
902 Ga0495676_0200395
903 Ga0495680_0005346
904 Ga0495675_0000090
905 Ga0495675_0003673
906 Ga0495685_041322
907 Ga0495673_0059073
908 Ga0495593_0121148
909 Ga0495593_0203305
910 Ga0495602_0001155
911 Ga0495614_0051308
912 Ga0496100_0000002
913 Ga0496100_0000038
914 Ga0496100_0269056
915 Ga0496101_0000001
916 Ga0496101_0000153
917 Ga0496101_0053959
918 Ga0496101_0078457
919 Ga0496102_0943011
920 Ga0496103_0004880
921 Ga0496103_0075422
922 Ga0496103_0076257
923 Ga0496105_0000006
924 Ga0496105_0079564
925 Ga0496106_0000018
926 Ga0496106_0000022
927 Ga0496106_0000138
928 Ga0496106_0029896
929 Ga0496106_0034441
930 Ga0496106_0683083
931 Ga0496106_0769575
932 Ga0496107_0000006
933 Ga0496107_0000016
934 Ga0496107_0004661
935 Ga0496107_0060785
936 Ga0496107_0427057
937 Ga0496108_0000107
938 Ga0496108_0000150
939 Ga0496108_0018497
940 Ga0496108_0045648
941 Ga0496109_0000007
942 Ga0496109_0000028
943 Ga0496109_0000190
944 Ga0496109_0000693
945 Ga0496109_0113848
946 Ga0496110_0001693
947 Ga0496110_0044429
948 Ga0496110_0048191
949 Ga0496110_0354377
950 Ga0496111_0021513
951 Ga0496111_0027521
952 Ga0496111_0039014
953 Ga0496112_0125426
954 Ga0496113_0082039
955 Ga0496113_0116488
956 Ga0496113_0165063
957 Ga0496113_0266292
958 Ga0496114_0018437
959 Ga0496114_0043059
960 Ga0496114_0231431
961 Ga0496115_0000316
962 Ga0496115_0086443
963 Ga0496116_0000769
964 Ga0496117_0001943
965 Ga0496119_0003085
966 Ga0496119_0025079
967 Ga0496120_0003588
968 Ga0496121_0004930
969 Ga0496121_0043578
970 Ga0496121_0219216
971 Ga0496124_0104348
972 Ga0496126_0081806
973 Ga0496126_0288616
974 Ga0501032_0065115
975 Ga0501033_0004761
976 Ga0501034_0059391
977 Ga0501034_0110742
978 Ga0501034_0111633
979 Ga0501036_0099620
980 Ga0501036_0603579
981 Ga0501037_0388682
982 Ga0501038_0066271
983 Ga0501039_0101035
984 Ga0501039_0217504
985 Ga0501040_0474519
986 Ga0501042_0077912
987 Ga0501042_0160584
988 Ga0501043_0076045
989 Ga0501043_0394537
990 Ga0501046_0000162
991 Ga0501046_0549629
992 Ga0501047_0000263
993 Ga0501047_0098610
994 Ga0501047_0132626
995 Ga0501048_0072361
996 Ga0501067_0002329
997 Ga0501067_0067574
998 Ga0501068_0076036
999 Ga0501068_0089799
1000 Ga0501068_0129118
1001 Ga0501068_0159406
1002 Ga0501070_0001887
1003 Ga0501070_0021753
1004 Ga0501071_0120916
1005 Ga0501071_0152022
1006 Ga0501071_0237172
1007 Ga0501072_0065291
1008 Ga0501073_0072519
1009 Ga0501074_0009267
1010 Ga0501074_0253859
1011 Ga0501074_0296545
1012 Ga0501075_0021845
1013 Ga0501076_0151600
1014 Ga0501076_0501316
1015 Ga0501079_0266326
1016 Ga0501079_0273831
1017 Ga0501081_0080884
1018 Ga0501083_0056429
1019 Ga0501083_0066187
1020 Ga0501035_0000391
1021 Ga0501035_0455326
1022 Ga0501044_0003076
1023 Ga0501044_0030206
1024 Ga0501044_0030682
1025 Ga0501045_0029512
1026 nmdc:mga03n38_12578_c1
1027 nmdc:mga00v17_263485_c1
1028 nmdc:mga00v17_269744_c1
1029 nmdc:mga00v17_67695_c1
1030 nmdc:mga0yw44_157248_c1
1031 nmdc:mga0yw44_173853_c1
1032 nmdc:mga0yw44_199314_c1
1033 nmdc:mga0yw44_36425_c1
1034 nmdc:mga0yw44_41116_c1
1035 nmdc:mga0yw44_517217_c1
1036 nmdc:mga0yw44_636979_c1
1037 nmdc:mga05p37_490020_c1
1038 nmdc:mga09592_386919_c1
1039 nmdc:mga0qj67_110266_c1
1040 nmdc:mga0qj67_126729_c1
1041 nmdc:mga06r32_2035_c1
1042 nmdc:mga06r32_685514_c1
1043 nmdc:mga08y16_15591_c1
1044 nmdc:mga0n895_198093_c1
1045 nmdc:mga0rr50_101735_c1
1046 nmdc:mga0rr50_262728_c1
1047 nmdc:mga0rr50_357521_c1
1048 nmdc:mga0a205_28171_c1
1049 nmdc:mga0a205_3884_c1
1050 Ga0495601_0000039
1051 Ga0495601_0000126
1052 Ga0495612_0000195
1053 Ga0495612_0003451
1054 Ga0495612_0007882
1055 Ga0495612_0012840
1056 Ga0495595_0000014
1057 Ga0495619_0000021
1058 Ga0495619_0000114
1059 Ga0495619_0000135
1060 Ga0495619_0014237
1061 Ga0500566_0019922
1062 Ga0500595_005432
1063 Ga0501084_0047868
1064 Ga0501084_0450216
1065 Ga0501084_0898194
1066 Ga0501082_0030821
1067 Ga0501082_0106259
1068 Ga0501082_0514708
1069 Ga0530510_0033777
1070 Ga0530510_0165866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jly-assembly1.cif.gz_J eif2a - eif2b complex 0.7976 39 161
3ect-assembly1.cif.gz_A crystal structure of the hexapeptide-repeat containing-acetyltransferase vca0836 from vibrio cholerae 0.7183 67 173
3vbl-assembly1.cif.gz_A crystal structure of the s84c mutant of antd, an n-acyltransferase from bacillus cereus in complex with dtdp-4-amino-4,6-dideoxyglucose and coenzyme a 0.689 36 173
3vbk-assembly1.cif.gz_E crystal structure of the s84a mutant of antd, an n-acyltransferase from bacillus cereus in complex with dtdp-4-amino-4,6-dideoxyglucose and coenzyme a 0.6743 37 173
5t2y-assembly1.cif.gz_A crystal structure of c. jejuni pgld in complex with 5-methyl-4-(methylamino)-2-phenethylthieno[2,3-d]pyrimidine-6-carboxylic acid 0.6713 43 168
ID Description Score Start End Superfamily
af_P39206_2_173_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8697 43 171 2.160.10.10
af_O53281_107_298_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8549 33 171 2.160.10.10
af_Q4D1S1_471_572_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8296 43 113 2.160.10.10
af_O60064_269_353_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.7445 38 113 2.160.10.10
af_P37750_24_194_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.7414 51 170 2.160.10.10
ID Description Score Start End GO Terms
AF-A0A838PPW3-F1-model_v4 Acyltransferase 0.9587 2 145 GO:0016746
AF-A0A7V9VQV6-F1-model_v4 deleted 0.9584 2 119
AF-A0A7M3MMV8-F1-model_v4 Acyltransferase 0.9235 2 113
AF-A0A7J9VP95-F1-model_v4 Acyltransferase 0.9078 1 170 GO:0016746
AF-A0A1I3AFX9-F1-model_v4 Acetyltransferase (Isoleucine patch superfamily) 0.9056 2 170 GO:0016740

Map