F460700

General Info

Members Datasets Scaffolds Average Seq Length
535 206 1071 445

Family's Representative Sequence

Representative Sequence 3300046457|Ga0495590_0006438|Ga0495590_0006438_3020_4504
Length 494
Sequence MRRRLRWRAPRSCYHSRWPRRAMRARHRYRQPKEPNMLTPESPASPSPRRSPLLWVPTGYFTMALGYVMLTSVTAIMFKNLGMDNGRAAAYSSMLILAYTIKPLFAPIVEMYRTKKFFVLCAQVLIGLGFAGAALAMGLPGYMKLMLPLFWLMSFIGATQDIASDGVYVTSLDSRAQSLYCGVQSLSWNIGPIVASGFLVYLSGRLHAEVFHHDPRAFGPDWMDAWRVVFFIVAGITLLMAAWHARFMPEGARAGNTPSSLRGAWDILRDSFASFFQKPGVWTMVAFAFLFRLSIGFLEKIGPFFMVDAASRGGLGLSNEQLGIIYGTYGLAAVLLGSLLGGWFVARRGLKRTLFLLCCAVNIPNVTFLVMSLLLPSSLLAIAAGVVIEKFFFGFGAVGFMIYLMQQLAPGPYATTHYAFGTGLMGLCGMVTGVLSGHLQEMMGYVSYFVFVMVATIPSFLACWLAPFHHDDGSADTGEVRSDRSPASSAAPAP

Samples

Sample ID Description Type Environment
1 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
40 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
43 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
47 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
49 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
72 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
73 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
85 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
86 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
87 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
88 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
101 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
102 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
111 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
118 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
119 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
136 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
143 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
153 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
171 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
172 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
173 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
174 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
175 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
176 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
177 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
181 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
183 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
184 2643221556 Massilia sp. Root1485 Isolate Unclassified
185 2643221638 Duganella sp. Root336D2 Isolate Unclassified
186 2643221645 Massilia sp. Root351 Isolate Unclassified
187 2643221664 Massilia sp. Root418 Isolate Unclassified
188 2643221684 Massilia sp. Root133 Isolate Unclassified
189 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
190 2738541280 Massilia sp. GV090 Isolate Unclassified
191 2738541297 Duganella sp. GV083 Isolate Unclassified
192 2738541300 Massilia sp. GV016 Isolate Unclassified
193 2738541357 Duganella sp. GV053 Isolate Unclassified
194 2738543003 Duganella sp. GV066 Isolate Unclassified
195 2738543018 Massilia sp. GV045 Isolate Unclassified
196 2738543026 Duganella sp. GV089 Isolate Unclassified
197 2738543029 Duganella sp. GV039 Isolate Unclassified
198 2738543030 Massilia sp. GV097 Isolate Unclassified
199 2821131069 Duganella sp. 1224 Isolate Unclassified
200 2842711865 Duganella sp. R-73148 Isolate Unclassified
201 2857553236 Duganella sp. R-74557 Isolate Unclassified
202 2857558681 Duganella sp. R-74565 Isolate Unclassified
203 2857564685 Duganella sp. R-74599 Isolate Unclassified
204 2904424332 Duganella sp. 1411 Isolate Rhizosphere
205 2919476304 Duganella sp. 3397 Isolate Unclassified
206 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.14
Metatranscriptomes 0.19
Isolates 4.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.83
Nodule 0.56
Rhizoplane 2.24
Rhizosphere 75.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495590_0006438 3300046457 Bacteria 4582
2 JGI25152J39213_1000249 3300002773 Bacteria 36209
3 JGI25152J39213_1000332 3300002773 Bacteria 29910
4 JGI25150J39212_1000832 3300002774 Bacteria 10347
5 JGI25159J45721_1003445 3300002987 Bacteria 5587
6 JGI25153J46596_10019663 3300003215 Bacteria 2578
7 rootH2_10225938 3300003320 Bacteria 3025
8 rootH1_10002054 3300003316 Bacteria 7111
9 rootH1_10002054 3300003323 Bacteria 118550
10 rootH1_10165834 3300003323 Bacteria 14017
11 JGI25161J50226_1000287 3300003374 Bacteria 28657
12 Ga0055525_1000025 3300003759 Bacteria 347582
13 Ga0055529_1000133 3300003763 Bacteria 104484
14 Ga0055526_1000052 3300003771 Bacteria 116035
15 Ga0055526_1000063 3300003771 Bacteria 103612
16 Ga0055526_1000487 3300003771 Bacteria 31529
17 Ga0055526_1003900 3300003771 Bacteria 9233
18 Ga0055537_1000035 3300003773 Bacteria 96274
19 Ga0055537_1003137 3300003773 Bacteria 5184
20 Ga0055524_1000015 3300003775 Bacteria 246493
21 Ga0055524_1000843 3300003775 Bacteria 20118
22 Ga0055524_1005183 3300003775 Bacteria 5869
23 Ga0055524_1005887 3300003775 Bacteria 5407
24 Ga0055534_1000325 3300003784 Bacteria 31562
25 Ga0055534_1002557 3300003784 Bacteria 6236
26 Ga0055528_1000058 3300003790 Bacteria 88086
27 Ga0055528_1007015 3300003790 Bacteria 5037
28 Ga0055530_10001841 3300003791 Bacteria 14607
29 Ga0055530_10008165 3300003791 Bacteria 4243
30 Ga0055530_10008175 3300003791 Bacteria 4239
31 Ga0055531_10003133 3300003794 Bacteria 10659
32 Ga0055543_1000351 3300004625 Bacteria 31301
33 Ga0055543_1007580 3300004625 Bacteria 2492
34 Ga0065165_1000224 3300005262 Bacteria 99359
35 Ga0065165_1001101 3300005262 Bacteria 32096
36 Ga0065165_1001132 3300005262 Bacteria 31301
37 Ga0070660_100009511 3300005339 Bacteria 6840
38 Ga0070660_100020889 3300005339 Bacteria 4820
39 Ga0070661_100022583 3300005344 Bacteria 4505
40 Ga0070659_100026888 3300005366 Bacteria 4429
41 Ga0070708_100208751 3300005445 Bacteria 1830
42 Ga0070662_100141292 3300005457 Bacteria 1866
43 Ga0070706_100015578 3300005467 Bacteria 7022
44 Ga0070698_100037221 3300005471 Bacteria 5018
45 Ga0070699_100005007 3300005518 Bacteria 11676
46 Ga0070697_100011715 3300005536 Bacteria 6857
47 Ga0068855_100148709 3300005563 Bacteria 2664
48 Ga0070664_100026922 3300005564 Bacteria 4775
49 Ga0070664_100212817 3300005564 Bacteria 1728
50 Ga0068852_100249715 3300005616 Bacteria 1699
51 Ga0099826_10000003 3300006948 Bacteria 1067817
52 Ga0105244_10000269 3300009036 Bacteria 52299
53 Ga0105244_10001363 3300009036 Bacteria 19828
54 Ga0105243_10037731 3300009148 Bacteria 3758
55 Ga0105241_10014165 3300009174 Bacteria 5843
56 Ga0105242_10107039 3300009176 Bacteria 2378
57 Ga0105239_10255375 3300010375 Bacteria 1969
58 Ga0157371_10000003 3300013102 Bacteria 543317
59 Ga0182006_1000116 3300015261 Bacteria 86100
60 Ga0182005_1000003 3300015265 Bacteria 683269
61 Ga0213872_10000038 3300021361 Bacteria 123827
62 Ga0213872_10001082 3300021361 Bacteria 18762
63 Ga0213872_10002494 3300021361 Bacteria 10764
64 Ga0209436_100245 3300025208 Bacteria 25015
65 Ga0209436_100825 3300025208 Bacteria 12584
66 Ga0209563_100003 3300025230 Bacteria 1932942
67 Ga0209437_101668 3300025233 Bacteria 4987
68 Ga0207425_1000014 3300025245 Bacteria 481113
69 Ga0207425_1000082 3300025245 Bacteria 97145
70 Ga0207425_1000202 3300025245 Bacteria 47483
71 Ga0209646_1000104 3300025246 Bacteria 163824
72 Ga0209148_1000590 3300025254 Bacteria 33089
73 Ga0209129_1000017 3300025258 Bacteria 480935
74 Ga0209129_1008063 3300025258 Bacteria 2996
75 Ga0209565_1000009 3300025263 Bacteria 751701
76 Ga0209565_1002062 3300025263 Bacteria 7696
77 Ga0209565_1004593 3300025263 Bacteria 4164
78 Ga0209565_1018660 3300025263 Bacteria 1496
79 Ga0209455_1000063 3300025272 Bacteria 333019
80 Ga0209673_1000036 3300025273 Bacteria 323162
81 Ga0209673_1018822 3300025273 Bacteria 2497
82 Ga0209130_1000044 3300025284 Bacteria 241110
83 Ga0209130_1000668 3300025284 Bacteria 31199
84 Ga0209130_1001996 3300025284 Bacteria 11153
85 Ga0209675_1000013 3300025291 Bacteria 448220
86 Ga0209025_1001180 3300025294 Bacteria 36969
87 Ga0209564_1000006 3300025295 Bacteria 1100927
88 Ga0209564_1000026 3300025295 Bacteria 519154
89 Ga0209564_1000071 3300025295 Bacteria 301332
90 Ga0209564_1000122 3300025295 Bacteria 203709
91 Ga0209564_1003239 3300025295 Bacteria 11384
92 Ga0209564_1012739 3300025295 Bacteria 3638
93 Ga0209758_1000038 3300025297 Bacteria 433771
94 Ga0209758_1000372 3300025297 Bacteria 78825
95 Ga0209050_1000011 3300025298 Bacteria 914037
96 Ga0209050_1000333 3300025298 Bacteria 93952
97 Ga0209050_1001020 3300025298 Bacteria 34935
98 Ga0209256_1000005 3300025299 Bacteria 1315082
99 Ga0209256_1000106 3300025299 Bacteria 187258
100 Ga0209256_1000118 3300025299 Bacteria 168228
101 Ga0209256_1000526 3300025299 Bacteria 55596
102 Ga0209051_1022383 3300025303 Bacteria 2662
103 Ga0209257_1000518 3300025304 Bacteria 66924
104 Ga0209257_1008293 3300025304 Bacteria 5958
105 Ga0207655_1000807 3300025728 Bacteria 34045
106 Ga0207655_1003087 3300025728 Bacteria 12663
107 Ga0207705_10002066 3300025909 Bacteria 15609
108 Ga0207705_10035134 3300025909 Bacteria 3585
109 Ga0207684_10015015 3300025910 Bacteria 6667
110 Ga0207654_10032771 3300025911 Bacteria 2874
111 Ga0207657_10008597 3300025919 Bacteria 10340
112 Ga0207657_10010908 3300025919 Bacteria 9043
113 Ga0207649_10116482 3300025920 Bacteria 1794
114 Ga0207646_10004223 3300025922 Bacteria 15719
115 Ga0207690_10019905 3300025932 Bacteria 4138
116 Ga0207667_10009020 3300025949 Bacteria 11796
117 Ga0207667_10090052 3300025949 Bacteria 3170
118 Ga0207698_10046716 3300026142 Bacteria 3272
119 Ga0209281_1002640 3300027111 Bacteria 6862
120 Ga0209282_1000002 3300027666 Bacteria 1067825
121 Ga0316177_1109553 3300030731 Bacteria 8199
122 Ga0307408_100000424 3300031548 Bacteria 37733
123 Ga0307408_100000694 3300031548 Bacteria 27589
124 Ga0307408_100000871 3300031548 Bacteria 23712
125 Ga0307408_100003995 3300031548 Bacteria 10054
126 Ga0307408_100006646 3300031548 Bacteria 7667
127 Ga0265314_10120162 3300031711 Bacteria 1655
128 Ga0307518_10032613 3300031838 Bacteria 3777
129 Ga0307416_100006540 3300032002 Bacteria 7305
130 Ga0395899_0005184 3300037312 Bacteria 10139
131 Ga0395899_0116411 3300037312 Bacteria 1918
132 Ga0395900_0000267 3300037418 Bacteria 80920
133 Ga0395900_0000324 3300037418 Bacteria 70682
134 Ga0395900_0007680 3300037418 Bacteria 11126
135 Ga0395900_0039805 3300037418 Bacteria 4843
136 Ga0395900_0048040 3300037418 Bacteria 4395
137 Ga0395900_0143334 3300037418 Bacteria 2445
138 Ga0395900_0176307 3300037418 Bacteria 2174
139 Ga0395898_0011888 3300037466 Bacteria 9013
140 Ga0395898_0020086 3300037466 Bacteria 6787
141 Ga0395898_0231449 3300037466 Bacteria 1762
142 Ga0395905_0017712 3300037471 Bacteria 6763
143 Ga0395905_0299428 3300037471 Bacteria 1495
144 Ga0395901_0000089 3300038443 Bacteria 124305
145 Ga0395901_0005365 3300038443 Bacteria 12957
146 Ga0395901_0021560 3300038443 Bacteria 6601
147 Ga0395901_0313679 3300038443 Bacteria 1623
148 Ga0436361_0110346 3300039447 Bacteria 17360
149 Ga0436361_0147551 3300039447 Bacteria 5619
150 Ga0436361_0289190 3300039447 Bacteria 23351
151 Ga0436361_0651246 3300039447 Bacteria 75347
152 Ga0436361_0872034 3300039447 Bacteria 6446
153 Ga0439448_0000868 3300042005 Bacteria 7386
154 Ga0439449_0005551 3300042007 Bacteria 4828
155 Ga0439455_0012695 3300042012 Bacteria 1896
156 Ga0450891_001026 3300042129 Bacteria 2931
157 Ga0439458_0010868 3300042157 Bacteria 2033
158 Ga0466969_0002789 3300044656 Bacteria 9333
159 Ga0466972_0001798 3300044658 Bacteria 10506
160 Ga0466965_0001249 3300044683 Bacteria 10094
161 Ga0466965_0006602 3300044683 Bacteria 5284
162 Ga0466965_0103538 3300044683 Bacteria 1457
163 Ga0466966_0010214 3300044684 Bacteria 6227
164 Ga0466966_0043456 3300044684 Bacteria 2880
165 Ga0466966_0058876 3300044684 Bacteria 2427
166 Ga0466963_0045713 3300044694 Bacteria 2884
167 Ga0466964_0001830 3300044706 Bacteria 7405
168 Ga0466971_0064179 3300044719 Bacteria 1662
169 Ga0466968_0001038 3300044735 Bacteria 9818
170 Ga0466957_0001916 3300044842 Bacteria 11042
171 Ga0466957_0013814 3300044842 Bacteria 4692
172 Ga0466957_0149893 3300044842 Bacteria 1507
173 Ga0466959_0005079 3300045049 Bacteria 8949
174 Ga0466959_0032972 3300045049 Bacteria 3832
175 Ga0466967_0009040 3300045976 Bacteria 7363
176 Ga0466967_0274215 3300045976 Bacteria 1617
177 Ga0495617_000139 3300046452 Bacteria 47951
178 Ga0495617_001087 3300046452 Bacteria 12377
179 Ga0495617_038942 3300046452 Bacteria 1590
180 Ga0495627_000448 3300046453 Bacteria 35878
181 Ga0495590_0000008 3300046457 Bacteria 330520
182 Ga0495590_0000314 3300046457 Bacteria 25322
183 Ga0495590_0002561 3300046457 Bacteria 7521
184 Ga0495590_0011896 3300046457 Bacteria 3242
185 Ga0495591_000043 3300046458 Bacteria 148885
186 Ga0495591_027763 3300046458 Bacteria 1740
187 Ga0495638_0000067 3300046460 Bacteria 167869
188 Ga0495638_0019869 3300046460 Bacteria 4441
189 Ga0495638_0023229 3300046460 Bacteria 4060
190 Ga0495653_0000018 3300046463 Bacteria 185787
191 Ga0495650_0000099 3300046471 Bacteria 215347
192 Ga0495650_0000224 3300046471 Bacteria 118058
193 Ga0495650_0000305 3300046471 Bacteria 88924
194 Ga0495650_0000471 3300046471 Bacteria 62035
195 Ga0495650_0000472 3300046471 Bacteria 62014
196 Ga0495650_0002496 3300046471 Bacteria 14773
197 Ga0495650_0012009 3300046471 Bacteria 4689
198 Ga0495650_0013594 3300046471 Bacteria 4294
199 Ga0495582_0003186 3300046473 Bacteria 9223
200 Ga0495605_0000005 3300046474 Bacteria 376973
201 Ga0495605_0000117 3300046474 Bacteria 103262
202 Ga0495605_0001858 3300046474 Bacteria 13494
203 Ga0495605_0011184 3300046474 Bacteria 5015
204 Ga0495605_0017513 3300046474 Bacteria 3854
205 Ga0495605_0018984 3300046474 Bacteria 3680
206 Ga0495605_0047951 3300046474 Bacteria 2093
207 Ga0495584_0000025 3300046491 Bacteria 116731
208 Ga0495584_0000186 3300046491 Bacteria 43887
209 Ga0495584_0000401 3300046491 Bacteria 29931
210 Ga0495584_0012352 3300046491 Bacteria 4359
211 Ga0495584_0014111 3300046491 Bacteria 4071
212 Ga0495584_0071670 3300046491 Bacteria 1741
213 Ga0495585_0000418 3300046492 Bacteria 40978
214 Ga0495596_0000065 3300046500 Bacteria 77306
215 Ga0495596_0002174 3300046500 Bacteria 10693
216 Ga0495596_0003323 3300046500 Bacteria 8194
217 Ga0495596_0005983 3300046500 Bacteria 5673
218 Ga0495607_0003901 3300046501 Bacteria 11233
219 Ga0495607_0004532 3300046501 Bacteria 10200
220 Ga0495607_0005157 3300046501 Bacteria 9429
221 Ga0495607_0007402 3300046501 Bacteria 7600
222 Ga0495607_0010199 3300046501 Bacteria 6318
223 Ga0495607_0011562 3300046501 Bacteria 5868
224 Ga0495607_0018097 3300046501 Bacteria 4501
225 Ga0495607_0053965 3300046501 Bacteria 2318
226 Ga0495607_0101361 3300046501 Bacteria 1541
227 Ga0495583_0000056 3300046506 Bacteria 200858
228 Ga0495583_0000160 3300046506 Bacteria 113560
229 Ga0495583_0000162 3300046506 Bacteria 112598
230 Ga0495583_0000343 3300046506 Bacteria 73431
231 Ga0495583_0000512 3300046506 Bacteria 55428
232 Ga0495583_0004639 3300046506 Bacteria 9702
233 Ga0495583_0006502 3300046506 Bacteria 7631
234 Ga0495583_0023205 3300046506 Bacteria 3144
235 Ga0495583_0051571 3300046506 Bacteria 1875
236 Ga0495606_0000044 3300046507 Bacteria 212802
237 Ga0495606_0000158 3300046507 Bacteria 118616
238 Ga0495606_0000269 3300046507 Bacteria 91558
239 Ga0495606_0000410 3300046507 Bacteria 72184
240 Ga0495606_0000783 3300046507 Bacteria 48693
241 Ga0495606_0001159 3300046507 Bacteria 37266
242 Ga0495606_0001207 3300046507 Bacteria 36311
243 Ga0495606_0003466 3300046507 Bacteria 16724
244 Ga0495606_0017830 3300046507 Bacteria 5347
245 Ga0495606_0027728 3300046507 Bacteria 4009
246 Ga0495606_0033891 3300046507 Bacteria 3514
247 Ga0495606_0058135 3300046507 Bacteria 2487
248 Ga0495610_0000021 3300046512 Bacteria 336300
249 Ga0495610_0001547 3300046512 Bacteria 20272
250 Ga0495610_0002546 3300046512 Bacteria 15175
251 Ga0495616_0000107 3300046513 Bacteria 72253
252 Ga0495616_0000378 3300046513 Bacteria 34726
253 Ga0495616_0004534 3300046513 Bacteria 8745
254 Ga0495616_0006350 3300046513 Bacteria 7166
255 Ga0495616_0009575 3300046513 Bacteria 5655
256 Ga0495616_0013425 3300046513 Bacteria 4619
257 Ga0495616_0013802 3300046513 Bacteria 4543
258 Ga0495616_0021229 3300046513 Bacteria 3519
259 Ga0495630_0103968 3300046517 Bacteria 2149
260 Ga0495631_0000897 3300046518 Bacteria 18601
261 Ga0495631_0008030 3300046518 Bacteria 5333
262 Ga0495631_0009476 3300046518 Bacteria 4864
263 Ga0495631_0039541 3300046518 Bacteria 2092
264 Ga0495631_0041753 3300046518 Bacteria 2029
265 Ga0495631_0066949 3300046518 Bacteria 1554
266 Ga0495632_0000012 3300046519 Bacteria 264389
267 Ga0495632_0000082 3300046519 Bacteria 97726
268 Ga0495632_0000109 3300046519 Bacteria 85257
269 Ga0495632_0003632 3300046519 Bacteria 10840
270 Ga0495632_0011967 3300046519 Bacteria 5032
271 Ga0495637_0000009 3300046520 Bacteria 402028
272 Ga0495637_0000057 3300046520 Bacteria 97433
273 Ga0495637_0000764 3300046520 Bacteria 21685
274 Ga0495637_0007624 3300046520 Bacteria 5356
275 Ga0495637_0056962 3300046520 Bacteria 1616
276 Ga0495643_0000118 3300046522 Bacteria 127939
277 Ga0495643_0000212 3300046522 Bacteria 89287
278 Ga0495643_0000263 3300046522 Bacteria 76248
279 Ga0495643_0001396 3300046522 Bacteria 22518
280 Ga0495643_0020243 3300046522 Bacteria 3840
281 Ga0495643_0020629 3300046522 Bacteria 3795
282 Ga0495643_0029666 3300046522 Bacteria 3059
283 Ga0495643_0041707 3300046522 Bacteria 2502
284 Ga0495643_0087075 3300046522 Bacteria 1617
285 Ga0495643_0122485 3300046522 Bacteria 1312
286 Ga0495644_0002993 3300046523 Bacteria 6693
287 Ga0495644_0003936 3300046523 Bacteria 5846
288 Ga0495644_0005314 3300046523 Bacteria 5029
289 Ga0495644_0005598 3300046523 Bacteria 4901
290 Ga0495644_0038946 3300046523 Bacteria 1792
291 Ga0495648_0000008 3300046524 Bacteria 336584
292 Ga0495648_0000856 3300046524 Bacteria 32108
293 Ga0495648_0003084 3300046524 Bacteria 14880
294 Ga0495648_0005490 3300046524 Bacteria 10522
295 Ga0495648_0009922 3300046524 Bacteria 7309
296 Ga0495648_0011000 3300046524 Bacteria 6858
297 Ga0495648_0015929 3300046524 Bacteria 5433
298 Ga0495642_0000504 3300046528 Bacteria 20130
299 Ga0495642_0000611 3300046528 Bacteria 17994
300 Ga0495642_0006502 3300046528 Bacteria 4484
301 Ga0495642_0027084 3300046528 Bacteria 2279
302 Ga0495652_0011037 3300046529 Bacteria 8187
303 Ga0495654_0000005 3300046530 Bacteria 491381
304 Ga0495654_0009991 3300046530 Bacteria 5183
305 Ga0495654_0032939 3300046530 Bacteria 2625
306 Ga0495587_0111817 3300046536 Bacteria 1568
307 Ga0495609_0000001 3300046538 Bacteria 1060094
308 Ga0495609_0000269 3300046538 Bacteria 48750
309 Ga0495609_0000379 3300046538 Bacteria 37917
310 Ga0495609_0001883 3300046538 Bacteria 13400
311 Ga0495609_0002987 3300046538 Bacteria 9995
312 Ga0495609_0004426 3300046538 Bacteria 7684
313 Ga0495597_0000027 3300046542 Bacteria 139281
314 Ga0495597_0000076 3300046542 Bacteria 86094
315 Ga0495597_0000227 3300046542 Bacteria 50869
316 Ga0495597_0000917 3300046542 Bacteria 22841
317 Ga0495597_0002313 3300046542 Bacteria 12364
318 Ga0495597_0003369 3300046542 Bacteria 9384
319 Ga0495597_0006008 3300046542 Bacteria 6327
320 Ga0495597_0020806 3300046542 Bacteria 3053
321 Ga0495597_0027054 3300046542 Bacteria 2631
322 Ga0495622_0000060 3300046557 Bacteria 96603
323 Ga0495622_0000095 3300046557 Bacteria 77903
324 Ga0495622_0018618 3300046557 Bacteria 3236
325 Ga0495633_0000128 3300046558 Bacteria 101213
326 Ga0495633_0000925 3300046558 Bacteria 24854
327 Ga0495633_0001536 3300046558 Bacteria 17721
328 Ga0495633_0003696 3300046558 Bacteria 10097
329 Ga0495656_0010325 3300046615 Bacteria 3391
330 Ga0495668_0000025 3300046616 Bacteria 304546
331 Ga0495668_0000144 3300046616 Bacteria 106951
332 Ga0495668_0000590 3300046616 Bacteria 44130
333 Ga0495668_0000619 3300046616 Bacteria 42997
334 Ga0495668_0001247 3300046616 Bacteria 25528
335 Ga0495668_0002800 3300046616 Bacteria 13877
336 Ga0495668_0003000 3300046616 Bacteria 13179
337 Ga0495668_0013049 3300046616 Bacteria 4917
338 Ga0495668_0013104 3300046616 Bacteria 4904
339 Ga0495668_0014373 3300046616 Bacteria 4642
340 Ga0495668_0032315 3300046616 Bacteria 2945
341 Ga0495611_0001056 3300046648 Bacteria 14568
342 Ga0495611_0005350 3300046648 Bacteria 5494
343 Ga0495625_0000192 3300046660 Bacteria 97193
344 Ga0495625_0003424 3300046660 Bacteria 15832
345 Ga0495625_0003549 3300046660 Bacteria 15395
346 Ga0495625_0005933 3300046660 Bacteria 10991
347 Ga0495625_0006117 3300046660 Bacteria 10784
348 Ga0495625_0020824 3300046660 Bacteria 5056
349 Ga0495625_0027935 3300046660 Bacteria 4237
350 Ga0495625_0113000 3300046660 Bacteria 1855
351 Ga0495659_0000156 3300046664 Bacteria 30321
352 Ga0495659_0002903 3300046664 Bacteria 5501
353 Ga0495659_0004179 3300046664 Bacteria 4556
354 Ga0495661_0000663 3300046665 Bacteria 34526
355 Ga0495661_0000872 3300046665 Bacteria 27928
356 Ga0495661_0008196 3300046665 Bacteria 7238
357 Ga0495661_0012378 3300046665 Bacteria 5758
358 Ga0495661_0058700 3300046665 Bacteria 2292
359 Ga0495661_0065039 3300046665 Bacteria 2149
360 Ga0495661_0090633 3300046665 Bacteria 1740
361 Ga0495661_0099281 3300046665 Bacteria 1642
362 Ga0495588_0000089 3300046674 Bacteria 191894
363 Ga0495588_0027742 3300046674 Bacteria 2831
364 Ga0495669_0000304 3300046684 Bacteria 27214
365 Ga0495669_0004941 3300046684 Bacteria 5537
366 Ga0495669_0007796 3300046684 Bacteria 4495
367 Ga0495670_0003210 3300046691 Bacteria 8045
368 Ga0495670_0009714 3300046691 Bacteria 4728
369 Ga0495670_0017420 3300046691 Bacteria 3534
370 Ga0495671_0000024 3300046692 Bacteria 246812
371 Ga0495671_0000088 3300046692 Bacteria 87282
372 Ga0495671_0000935 3300046692 Bacteria 20623
373 Ga0495671_0030769 3300046692 Bacteria 2747
374 Ga0495671_0070248 3300046692 Bacteria 1720
375 Ga0495671_0103938 3300046692 Bacteria 1387
376 Ga0495649_0000028 3300046694 Bacteria 163229
377 Ga0495649_0000715 3300046694 Bacteria 27013
378 Ga0495649_0002538 3300046694 Bacteria 12794
379 Ga0495649_0005242 3300046694 Bacteria 8292
380 Ga0495649_0027984 3300046694 Bacteria 3125
381 Ga0495589_0000027 3300046794 Bacteria 181084
382 Ga0495589_0000112 3300046794 Bacteria 77426
383 Ga0495589_0000974 3300046794 Bacteria 17471
384 Ga0495589_0001735 3300046794 Bacteria 12390
385 Ga0495589_0009505 3300046794 Bacteria 5054
386 Ga0495589_0010445 3300046794 Bacteria 4824
387 Ga0495589_0015215 3300046794 Bacteria 3961
388 Ga0495589_0015690 3300046794 Bacteria 3894
389 Ga0495589_0026392 3300046794 Bacteria 2942
390 Ga0495660_0000054 3300046810 Bacteria 135325
391 Ga0495660_0000207 3300046810 Bacteria 61056
392 Ga0495660_0000310 3300046810 Bacteria 44326
393 Ga0495660_0006559 3300046810 Bacteria 6875
394 Ga0495660_0012798 3300046810 Bacteria 4866
395 Ga0495660_0014125 3300046810 Bacteria 4624
396 Ga0495660_0022556 3300046810 Bacteria 3593
397 Ga0495604_0015115 3300047317 Bacteria 6158
398 Ga0495674_0007963 3300047319 Bacteria 10116
399 Ga0495672_0000055 3300047320 Bacteria 229428
400 Ga0495672_0000109 3300047320 Bacteria 131335
401 Ga0495672_0000253 3300047320 Bacteria 74560
402 Ga0495672_0001329 3300047320 Bacteria 24574
403 Ga0495672_0001487 3300047320 Bacteria 22976
404 Ga0495672_0002190 3300047320 Bacteria 18196
405 Ga0495672_0030167 3300047320 Bacteria 3406
406 Ga0495676_0083802 3300047321 Bacteria 2408
407 Ga0495680_0069995 3300047322 Bacteria 2676
408 Ga0495683_0000047 3300047323 Bacteria 126770
409 Ga0495683_0004438 3300047323 Bacteria 7969
410 Ga0495683_0009565 3300047323 Bacteria 5162
411 Ga0495683_0010058 3300047323 Bacteria 5017
412 Ga0495687_000002 3300047443 Bacteria 1085770
413 Ga0495687_000019 3300047443 Bacteria 341756
414 Ga0495687_000023 3300047443 Bacteria 317750
415 Ga0495687_000081 3300047443 Bacteria 147362
416 Ga0495687_000287 3300047443 Bacteria 66402
417 Ga0495687_000299 3300047443 Bacteria 65591
418 Ga0495687_000358 3300047443 Bacteria 57250
419 Ga0495687_000412 3300047443 Bacteria 52902
420 Ga0495687_001042 3300047443 Bacteria 27543
421 Ga0495675_0009409 3300047444 Bacteria 6080
422 Ga0495677_0000020 3300047445 Bacteria 107093
423 Ga0495677_0000451 3300047445 Bacteria 17521
424 Ga0495677_0000779 3300047445 Bacteria 12855
425 Ga0495677_0001493 3300047445 Bacteria 9408
426 Ga0495677_0002106 3300047445 Bacteria 7910
427 Ga0495677_0005120 3300047445 Bacteria 4991
428 Ga0495677_0008626 3300047445 Bacteria 3784
429 Ga0495679_020002 3300047446 Bacteria 2339
430 Ga0495685_000013 3300047447 Bacteria 79924
431 Ga0495685_001735 3300047447 Bacteria 6718
432 Ga0495685_002123 3300047447 Bacteria 6157
433 Ga0495685_005262 3300047447 Bacteria 4215
434 Ga0495673_0000033 3300047469 Bacteria 354152
435 Ga0495673_0000034 3300047469 Bacteria 326920
436 Ga0495673_0000120 3300047469 Bacteria 144972
437 Ga0495673_0041873 3300047469 Bacteria 2059
438 Ga0495681_0000028 3300047470 Bacteria 139008
439 Ga0495681_0011640 3300047470 Bacteria 5224
440 Ga0495681_0013487 3300047470 Bacteria 4736
441 Ga0495681_0032012 3300047470 Bacteria 2652
442 Ga0495686_0000307 3300047472 Bacteria 83190
443 Ga0495686_0001628 3300047472 Bacteria 23473
444 Ga0495686_0003432 3300047472 Bacteria 13747
445 Ga0495686_0004598 3300047472 Bacteria 11251
446 Ga0495686_0009746 3300047472 Bacteria 6893
447 Ga0495686_0143817 3300047472 Bacteria 1405
448 Ga0495626_0000017 3300048091 Bacteria 231648
449 Ga0495626_0000800 3300048091 Bacteria 28478
450 Ga0495626_0004509 3300048091 Bacteria 8524
451 Ga0495626_0008085 3300048091 Bacteria 5802
452 Ga0495626_0009875 3300048091 Bacteria 5130
453 Ga0495626_0026263 3300048091 Bacteria 2840
454 Ga0495626_0028876 3300048091 Bacteria 2686
455 Ga0495626_0039772 3300048091 Bacteria 2224
456 Ga0495626_0091234 3300048091 Bacteria 1339
457 Ga0496102_0000123 3300048905 Bacteria 110781
458 Ga0496102_0000158 3300048905 Bacteria 91822
459 Ga0496102_0014694 3300048905 Bacteria 6805
460 Ga0496102_0022913 3300048905 Bacteria 5539
461 Ga0496102_0092898 3300048905 Bacteria 2795
462 Ga0496103_0002834 3300048906 Bacteria 10786
463 Ga0496103_0105668 3300048906 Bacteria 1785
464 Ga0496105_0183645 3300048908 Bacteria 1712
465 Ga0496106_0001057 3300048909 Bacteria 20282
466 Ga0496107_0033188 3300048910 Bacteria 3693
467 Ga0496113_0001726 3300048916 Bacteria 12370
468 Ga0496113_0001957 3300048916 Bacteria 11799
469 Ga0496122_0002307 3300048925 Bacteria 27528
470 Ga0496122_0011273 3300048925 Bacteria 9078
471 Ga0496123_0001793 3300048926 Bacteria 28269
472 Ga0496123_0002950 3300048926 Bacteria 19865
473 Ga0496123_0032026 3300048926 Bacteria 3815
474 Ga0496123_0090104 3300048926 Bacteria 1825
475 Ga0496124_0022608 3300048927 Bacteria 5759
476 Ga0496124_0029297 3300048927 Bacteria 4908
477 Ga0496124_0036417 3300048927 Bacteria 4292
478 Ga0496124_0087414 3300048927 Bacteria 2549
479 Ga0496124_0089328 3300048927 Bacteria 2516
480 Ga0496126_0033779 3300048929 Bacteria 4811
481 Ga0496126_0108082 3300048929 Bacteria 2426
482 Ga0501308_006687 3300049128 Bacteria 1189
483 Ga0495678_000001 3300049459 Bacteria 1060340
484 Ga0495678_000025 3300049459 Bacteria 227891
485 Ga0495678_000041 3300049459 Bacteria 185715
486 Ga0495678_000097 3300049459 Bacteria 107672
487 Ga0495678_000102 3300049459 Bacteria 104107
488 Ga0495678_000154 3300049459 Bacteria 82494
489 Ga0495678_007323 3300049459 Bacteria 5733
490 Ga0495678_013706 3300049459 Bacteria 3795
491 Ga0495678_032817 3300049459 Bacteria 2148
492 Ga0495678_045417 3300049459 Bacteria 1732
493 Ga0495682_0000191 3300049460 Bacteria 50310
494 Ga0495682_0000534 3300049460 Bacteria 26283
495 Ga0495682_0000918 3300049460 Bacteria 17933
496 Ga0495682_0002911 3300049460 Bacteria 7854
497 Ga0495682_0008718 3300049460 Bacteria 3991
498 Ga0495682_0015962 3300049460 Bacteria 2842
499 Ga0501227_002877 3300049665 Bacteria 3777
500 Ga0501238_001649 3300049671 Bacteria 2595
501 Ga0501249_022928 3300049679 Bacteria 1368
502 Ga0501241_010002 3300049758 Bacteria 1725
503 Ga0501269_000029 3300049766 Bacteria 46771
504 Ga0501279_000512 3300049775 Bacteria 5093
505 Ga0501279_002805 3300049775 Bacteria 2272
506 Ga0501035_0002652 3300049822 Bacteria 17407
507 Ga0501044_0102594 3300049823 Bacteria 2876
508 Ga0500618_000284 3300053125 Bacteria 38522
509 Ga0500586_000057 3300053145 Bacteria 20024
510 Ga0500586_005369 3300053145 Bacteria 3235
511 Ga0466962_0021941 3300061719 Bacteria 3066
512 2643791249 2643221554 Bacteria 6603920
513 2643800989 2643221556 Bacteria 7251154
514 2644215456 2643221638 Bacteria 6579467
515 2644250234 2643221645 Bacteria 7207331
516 2644357785 2643221664 Bacteria 7272945
517 2644473361 2643221684 Bacteria 7145183
518 2738714667 2738541276 Bacteria 4690596
519 2738717124 2738541276 Bacteria 4690596
520 2738741728 2738541280 Bacteria 6630198
521 2738825867 2738541297 Bacteria 6549566
522 2738843953 2738541300 Bacteria 6675882
523 2739149664 2738541357 Bacteria 6549408
524 2739191583 2738543003 Bacteria 6549560
525 2739274486 2738543018 Bacteria 6718814
526 2739318060 2738543026 Bacteria 6549408
527 2739336301 2738543029 Bacteria 6549249
528 2739343530 2738543030 Bacteria 6719714
529 2821135509 2821131069 Bacteria 6108407
530 2842713906 2842711865 Bacteria 7155354
531 2857554982 2857553236 Bacteria 6166726
532 2857562424 2857558681 Bacteria 6617694
533 2857566269 2857564685 Bacteria 6290584
534 2904429918 2904424332 Bacteria 7633521
535 2919478912 2919476304 Bacteria 5888696
536 8047679087 8047673197 Bacteria 7395230
537 Ga0495590_0006438
538 JGI25152J39213_1000249
539 JGI25152J39213_1000332
540 JGI25150J39212_1000832
541 JGI25159J45721_1003445
542 JGI25153J46596_10019663
543 rootH2_10225938
544 rootH1_10002054
545 rootH1_10165834
546 JGI25161J50226_1000287
547 Ga0055525_1000025
548 Ga0055529_1000133
549 Ga0055526_1000052
550 Ga0055526_1000063
551 Ga0055526_1000487
552 Ga0055526_1003900
553 Ga0055537_1000035
554 Ga0055537_1003137
555 Ga0055524_1000015
556 Ga0055524_1000843
557 Ga0055524_1005183
558 Ga0055524_1005887
559 Ga0055534_1000325
560 Ga0055534_1002557
561 Ga0055528_1000058
562 Ga0055528_1007015
563 Ga0055530_10001841
564 Ga0055530_10008165
565 Ga0055530_10008175
566 Ga0055531_10003133
567 Ga0055543_1000351
568 Ga0055543_1007580
569 Ga0065165_1000224
570 Ga0065165_1001101
571 Ga0065165_1001132
572 Ga0070660_100009511
573 Ga0070660_100020889
574 Ga0070661_100022583
575 Ga0070659_100026888
576 Ga0070708_100208751
577 Ga0070662_100141292
578 Ga0070706_100015578
579 Ga0070698_100037221
580 Ga0070699_100005007
581 Ga0070697_100011715
582 Ga0068855_100148709
583 Ga0070664_100026922
584 Ga0070664_100212817
585 Ga0068852_100249715
586 Ga0099826_10000003
587 Ga0105244_10000269
588 Ga0105244_10001363
589 Ga0105243_10037731
590 Ga0105241_10014165
591 Ga0105242_10107039
592 Ga0105239_10255375
593 Ga0157371_10000003
594 Ga0182006_1000116
595 Ga0182005_1000003
596 Ga0213872_10000038
597 Ga0213872_10001082
598 Ga0213872_10002494
599 Ga0209436_100245
600 Ga0209436_100825
601 Ga0209563_100003
602 Ga0209437_101668
603 Ga0207425_1000014
604 Ga0207425_1000082
605 Ga0207425_1000202
606 Ga0209646_1000104
607 Ga0209148_1000590
608 Ga0209129_1000017
609 Ga0209129_1008063
610 Ga0209565_1000009
611 Ga0209565_1002062
612 Ga0209565_1004593
613 Ga0209565_1018660
614 Ga0209455_1000063
615 Ga0209673_1000036
616 Ga0209673_1018822
617 Ga0209130_1000044
618 Ga0209130_1000668
619 Ga0209130_1001996
620 Ga0209675_1000013
621 Ga0209025_1001180
622 Ga0209564_1000006
623 Ga0209564_1000026
624 Ga0209564_1000071
625 Ga0209564_1000122
626 Ga0209564_1003239
627 Ga0209564_1012739
628 Ga0209758_1000038
629 Ga0209758_1000372
630 Ga0209050_1000011
631 Ga0209050_1000333
632 Ga0209050_1001020
633 Ga0209256_1000005
634 Ga0209256_1000106
635 Ga0209256_1000118
636 Ga0209256_1000526
637 Ga0209051_1022383
638 Ga0209257_1000518
639 Ga0209257_1008293
640 Ga0207655_1000807
641 Ga0207655_1003087
642 Ga0207705_10002066
643 Ga0207705_10035134
644 Ga0207684_10015015
645 Ga0207654_10032771
646 Ga0207657_10008597
647 Ga0207657_10010908
648 Ga0207649_10116482
649 Ga0207646_10004223
650 Ga0207690_10019905
651 Ga0207667_10009020
652 Ga0207667_10090052
653 Ga0207698_10046716
654 Ga0209281_1002640
655 Ga0209282_1000002
656 Ga0316177_1109553
657 Ga0307408_100000424
658 Ga0307408_100000694
659 Ga0307408_100000871
660 Ga0307408_100003995
661 Ga0307408_100006646
662 Ga0265314_10120162
663 Ga0307518_10032613
664 Ga0307416_100006540
665 Ga0395899_0005184
666 Ga0395899_0116411
667 Ga0395900_0000267
668 Ga0395900_0000324
669 Ga0395900_0007680
670 Ga0395900_0039805
671 Ga0395900_0048040
672 Ga0395900_0143334
673 Ga0395900_0176307
674 Ga0395898_0011888
675 Ga0395898_0020086
676 Ga0395898_0231449
677 Ga0395905_0017712
678 Ga0395905_0299428
679 Ga0395901_0000089
680 Ga0395901_0005365
681 Ga0395901_0021560
682 Ga0395901_0313679
683 Ga0436361_0110346
684 Ga0436361_0147551
685 Ga0436361_0289190
686 Ga0436361_0651246
687 Ga0436361_0872034
688 Ga0439448_0000868
689 Ga0439449_0005551
690 Ga0439455_0012695
691 Ga0450891_001026
692 Ga0439458_0010868
693 Ga0466969_0002789
694 Ga0466972_0001798
695 Ga0466965_0001249
696 Ga0466965_0006602
697 Ga0466965_0103538
698 Ga0466966_0010214
699 Ga0466966_0043456
700 Ga0466966_0058876
701 Ga0466963_0045713
702 Ga0466964_0001830
703 Ga0466971_0064179
704 Ga0466968_0001038
705 Ga0466957_0001916
706 Ga0466957_0013814
707 Ga0466957_0149893
708 Ga0466959_0005079
709 Ga0466959_0032972
710 Ga0466967_0009040
711 Ga0466967_0274215
712 Ga0495617_000139
713 Ga0495617_001087
714 Ga0495617_038942
715 Ga0495627_000448
716 Ga0495590_0000008
717 Ga0495590_0000314
718 Ga0495590_0002561
719 Ga0495590_0011896
720 Ga0495591_000043
721 Ga0495591_027763
722 Ga0495638_0000067
723 Ga0495638_0019869
724 Ga0495638_0023229
725 Ga0495653_0000018
726 Ga0495650_0000099
727 Ga0495650_0000224
728 Ga0495650_0000305
729 Ga0495650_0000471
730 Ga0495650_0000472
731 Ga0495650_0002496
732 Ga0495650_0012009
733 Ga0495650_0013594
734 Ga0495582_0003186
735 Ga0495605_0000005
736 Ga0495605_0000117
737 Ga0495605_0001858
738 Ga0495605_0011184
739 Ga0495605_0017513
740 Ga0495605_0018984
741 Ga0495605_0047951
742 Ga0495584_0000025
743 Ga0495584_0000186
744 Ga0495584_0000401
745 Ga0495584_0012352
746 Ga0495584_0014111
747 Ga0495584_0071670
748 Ga0495585_0000418
749 Ga0495596_0000065
750 Ga0495596_0002174
751 Ga0495596_0003323
752 Ga0495596_0005983
753 Ga0495607_0003901
754 Ga0495607_0004532
755 Ga0495607_0005157
756 Ga0495607_0007402
757 Ga0495607_0010199
758 Ga0495607_0011562
759 Ga0495607_0018097
760 Ga0495607_0053965
761 Ga0495607_0101361
762 Ga0495583_0000056
763 Ga0495583_0000160
764 Ga0495583_0000162
765 Ga0495583_0000343
766 Ga0495583_0000512
767 Ga0495583_0004639
768 Ga0495583_0006502
769 Ga0495583_0023205
770 Ga0495583_0051571
771 Ga0495606_0000044
772 Ga0495606_0000158
773 Ga0495606_0000269
774 Ga0495606_0000410
775 Ga0495606_0000783
776 Ga0495606_0001159
777 Ga0495606_0001207
778 Ga0495606_0003466
779 Ga0495606_0017830
780 Ga0495606_0027728
781 Ga0495606_0033891
782 Ga0495606_0058135
783 Ga0495610_0000021
784 Ga0495610_0001547
785 Ga0495610_0002546
786 Ga0495616_0000107
787 Ga0495616_0000378
788 Ga0495616_0004534
789 Ga0495616_0006350
790 Ga0495616_0009575
791 Ga0495616_0013425
792 Ga0495616_0013802
793 Ga0495616_0021229
794 Ga0495630_0103968
795 Ga0495631_0000897
796 Ga0495631_0008030
797 Ga0495631_0009476
798 Ga0495631_0039541
799 Ga0495631_0041753
800 Ga0495631_0066949
801 Ga0495632_0000012
802 Ga0495632_0000082
803 Ga0495632_0000109
804 Ga0495632_0003632
805 Ga0495632_0011967
806 Ga0495637_0000009
807 Ga0495637_0000057
808 Ga0495637_0000764
809 Ga0495637_0007624
810 Ga0495637_0056962
811 Ga0495643_0000118
812 Ga0495643_0000212
813 Ga0495643_0000263
814 Ga0495643_0001396
815 Ga0495643_0020243
816 Ga0495643_0020629
817 Ga0495643_0029666
818 Ga0495643_0041707
819 Ga0495643_0087075
820 Ga0495643_0122485
821 Ga0495644_0002993
822 Ga0495644_0003936
823 Ga0495644_0005314
824 Ga0495644_0005598
825 Ga0495644_0038946
826 Ga0495648_0000008
827 Ga0495648_0000856
828 Ga0495648_0003084
829 Ga0495648_0005490
830 Ga0495648_0009922
831 Ga0495648_0011000
832 Ga0495648_0015929
833 Ga0495642_0000504
834 Ga0495642_0000611
835 Ga0495642_0006502
836 Ga0495642_0027084
837 Ga0495652_0011037
838 Ga0495654_0000005
839 Ga0495654_0009991
840 Ga0495654_0032939
841 Ga0495587_0111817
842 Ga0495609_0000001
843 Ga0495609_0000269
844 Ga0495609_0000379
845 Ga0495609_0001883
846 Ga0495609_0002987
847 Ga0495609_0004426
848 Ga0495597_0000027
849 Ga0495597_0000076
850 Ga0495597_0000227
851 Ga0495597_0000917
852 Ga0495597_0002313
853 Ga0495597_0003369
854 Ga0495597_0006008
855 Ga0495597_0020806
856 Ga0495597_0027054
857 Ga0495622_0000060
858 Ga0495622_0000095
859 Ga0495622_0018618
860 Ga0495633_0000128
861 Ga0495633_0000925
862 Ga0495633_0001536
863 Ga0495633_0003696
864 Ga0495656_0010325
865 Ga0495668_0000025
866 Ga0495668_0000144
867 Ga0495668_0000590
868 Ga0495668_0000619
869 Ga0495668_0001247
870 Ga0495668_0002800
871 Ga0495668_0003000
872 Ga0495668_0013049
873 Ga0495668_0013104
874 Ga0495668_0014373
875 Ga0495668_0032315
876 Ga0495611_0001056
877 Ga0495611_0005350
878 Ga0495625_0000192
879 Ga0495625_0003424
880 Ga0495625_0003549
881 Ga0495625_0005933
882 Ga0495625_0006117
883 Ga0495625_0020824
884 Ga0495625_0027935
885 Ga0495625_0113000
886 Ga0495659_0000156
887 Ga0495659_0002903
888 Ga0495659_0004179
889 Ga0495661_0000663
890 Ga0495661_0000872
891 Ga0495661_0008196
892 Ga0495661_0012378
893 Ga0495661_0058700
894 Ga0495661_0065039
895 Ga0495661_0090633
896 Ga0495661_0099281
897 Ga0495588_0000089
898 Ga0495588_0027742
899 Ga0495669_0000304
900 Ga0495669_0004941
901 Ga0495669_0007796
902 Ga0495670_0003210
903 Ga0495670_0009714
904 Ga0495670_0017420
905 Ga0495671_0000024
906 Ga0495671_0000088
907 Ga0495671_0000935
908 Ga0495671_0030769
909 Ga0495671_0070248
910 Ga0495671_0103938
911 Ga0495649_0000028
912 Ga0495649_0000715
913 Ga0495649_0002538
914 Ga0495649_0005242
915 Ga0495649_0027984
916 Ga0495589_0000027
917 Ga0495589_0000112
918 Ga0495589_0000974
919 Ga0495589_0001735
920 Ga0495589_0009505
921 Ga0495589_0010445
922 Ga0495589_0015215
923 Ga0495589_0015690
924 Ga0495589_0026392
925 Ga0495660_0000054
926 Ga0495660_0000207
927 Ga0495660_0000310
928 Ga0495660_0006559
929 Ga0495660_0012798
930 Ga0495660_0014125
931 Ga0495660_0022556
932 Ga0495604_0015115
933 Ga0495674_0007963
934 Ga0495672_0000055
935 Ga0495672_0000109
936 Ga0495672_0000253
937 Ga0495672_0001329
938 Ga0495672_0001487
939 Ga0495672_0002190
940 Ga0495672_0030167
941 Ga0495676_0083802
942 Ga0495680_0069995
943 Ga0495683_0000047
944 Ga0495683_0004438
945 Ga0495683_0009565
946 Ga0495683_0010058
947 Ga0495687_000002
948 Ga0495687_000019
949 Ga0495687_000023
950 Ga0495687_000081
951 Ga0495687_000287
952 Ga0495687_000299
953 Ga0495687_000358
954 Ga0495687_000412
955 Ga0495687_001042
956 Ga0495675_0009409
957 Ga0495677_0000020
958 Ga0495677_0000451
959 Ga0495677_0000779
960 Ga0495677_0001493
961 Ga0495677_0002106
962 Ga0495677_0005120
963 Ga0495677_0008626
964 Ga0495679_020002
965 Ga0495685_000013
966 Ga0495685_001735
967 Ga0495685_002123
968 Ga0495685_005262
969 Ga0495673_0000033
970 Ga0495673_0000034
971 Ga0495673_0000120
972 Ga0495673_0041873
973 Ga0495681_0000028
974 Ga0495681_0011640
975 Ga0495681_0013487
976 Ga0495681_0032012
977 Ga0495686_0000307
978 Ga0495686_0001628
979 Ga0495686_0003432
980 Ga0495686_0004598
981 Ga0495686_0009746
982 Ga0495686_0143817
983 Ga0495626_0000017
984 Ga0495626_0000800
985 Ga0495626_0004509
986 Ga0495626_0008085
987 Ga0495626_0009875
988 Ga0495626_0026263
989 Ga0495626_0028876
990 Ga0495626_0039772
991 Ga0495626_0091234
992 Ga0496102_0000123
993 Ga0496102_0000158
994 Ga0496102_0014694
995 Ga0496102_0022913
996 Ga0496102_0092898
997 Ga0496103_0002834
998 Ga0496103_0105668
999 Ga0496105_0183645
1000 Ga0496106_0001057
1001 Ga0496107_0033188
1002 Ga0496113_0001726
1003 Ga0496113_0001957
1004 Ga0496122_0002307
1005 Ga0496122_0011273
1006 Ga0496123_0001793
1007 Ga0496123_0002950
1008 Ga0496123_0032026
1009 Ga0496123_0090104
1010 Ga0496124_0022608
1011 Ga0496124_0029297
1012 Ga0496124_0036417
1013 Ga0496124_0087414
1014 Ga0496124_0089328
1015 Ga0496126_0033779
1016 Ga0496126_0108082
1017 Ga0501308_006687
1018 Ga0495678_000001
1019 Ga0495678_000025
1020 Ga0495678_000041
1021 Ga0495678_000097
1022 Ga0495678_000102
1023 Ga0495678_000154
1024 Ga0495678_007323
1025 Ga0495678_013706
1026 Ga0495678_032817
1027 Ga0495678_045417
1028 Ga0495682_0000191
1029 Ga0495682_0000534
1030 Ga0495682_0000918
1031 Ga0495682_0002911
1032 Ga0495682_0008718
1033 Ga0495682_0015962
1034 Ga0501227_002877
1035 Ga0501238_001649
1036 Ga0501249_022928
1037 Ga0501241_010002
1038 Ga0501269_000029
1039 Ga0501279_000512
1040 Ga0501279_002805
1041 Ga0501035_0002652
1042 Ga0501044_0102594
1043 Ga0500618_000284
1044 Ga0500586_000057
1045 Ga0500586_005369
1046 Ga0466962_0021941
1047 2643791249
1048 2643800989
1049 2644215456
1050 2644250234
1051 2644357785
1052 2644473361
1053 2738714667
1054 2738717124
1055 2738741728
1056 2738825867
1057 2738843953
1058 2739149664
1059 2739191583
1060 2739274486
1061 2739318060
1062 2739336301
1063 2739343530
1064 2821135509
1065 2842713906
1066 2857554982
1067 2857562424
1068 2857566269
1069 2904429918
1070 2919478912
1071 8047679087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

56

437

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.7705 4 396
8sc2-assembly1.cif.gz_A human oct1 bound to diltiazem in inward-open conformation 0.7689 40 399
8sc6-assembly1.cif.gz_A human oct1 bound to thiamine in inward-open conformation 0.7603 40 399
8sc1-assembly1.cif.gz_A human oct1 (apo) in inward-open conformation 0.7597 40 399
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.7589 5 398
ID Description Score Start End Superfamily
af_P0AE16_220_412_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9369 210 397 1.20.1250.20
af_P0AE16_220_412_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.877 210 397 1.20.1250.20
af_O96186_278_457_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8408 210 397 1.20.1250.20
af_O96186_278_457_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8285 210 397 1.20.1250.20
af_O23203_10_235_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8067 4 182 1.20.1250.20
ID Description Score Start End GO Terms
AF-F3PI25-F1-model_v4 deleted 0.8755 1 398
AF-A0A6S7A7T0-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8397 216 398 GO:0016020
AF-A0A521GVT1-F1-model_v4 MFS transporter 0.8388 7 397 GO:0016020
GO:0022857
AF-A0A7Z9K709-F1-model_v4 MFS transporter 0.8348 202 397 GO:0016020
AF-A0A4Q0MI55-F1-model_v4 MFS transporter 0.8328 185 398 GO:0016020

Map