F460702

General Info

Members Datasets Scaffolds Average Seq Length
535 314 1070 374

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0002034|Ga0495584_0002034_6325_7452
Length 365
Sequence MNHPSSLFPRPVWIALATVTIAAALLPLLNLAFPPGHALHVSGYALGLVGKFMCYALAALALDLVWGYTGILSLGHGLFFALGAYAHGMYLMRAIGRDGAYQSTLPDFMVFLDWKTYPWYWAMTDNFWYCMALVVLVPGVLAFVFGYFAFRSRIKGVYFSIITQALTYAFMLLFFRNDTGFGGNNGFTDFKRILGYSITAPGTRAVLYLVTLRWVVTSRLGRVLQAVRDSESRLMFIGYNPLWFKLFVWTLSAVLCGIAGALYVPQVGIINPSEMSPANSIEMVVWAAVGGRGTLLGPILGAFAVNGLKSWFTAAFPDLWLFALGLLFILVTLSMQTGILGLPGKLKRRPRVEEAAPMKKTEEAA

Samples

Sample ID Description Type Environment
1 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
96 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
160 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
189 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
190 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
191 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
222 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
223 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
224 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
246 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
255 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
256 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
257 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
258 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
259 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
260 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
261 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
262 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
263 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
264 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
265 2643221569 Achromobacter sp. Root565 Isolate Unclassified
266 2643221594 Achromobacter sp. Root170 Isolate Unclassified
267 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
268 2643221621 Achromobacter sp. Root83 Isolate Unclassified
269 2643221645 Massilia sp. Root351 Isolate Unclassified
270 2643221664 Massilia sp. Root418 Isolate Unclassified
271 2738541280 Massilia sp. GV090 Isolate Unclassified
272 2738541297 Duganella sp. GV083 Isolate Unclassified
273 2738541300 Massilia sp. GV016 Isolate Unclassified
274 2738541357 Duganella sp. GV053 Isolate Unclassified
275 2738543003 Duganella sp. GV066 Isolate Unclassified
276 2738543018 Massilia sp. GV045 Isolate Unclassified
277 2738543026 Duganella sp. GV089 Isolate Unclassified
278 2738543029 Duganella sp. GV039 Isolate Unclassified
279 2738543030 Massilia sp. GV097 Isolate Unclassified
280 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
281 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
282 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
283 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
284 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
285 2818991436 Collimonas arenae 515 Isolate Unclassified
286 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
287 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
288 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
289 2842711865 Duganella sp. R-73148 Isolate Unclassified
290 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
291 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
292 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
293 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
294 2857558681 Duganella sp. R-74565 Isolate Unclassified
295 2857564685 Duganella sp. R-74599 Isolate Unclassified
296 2858950400 Achromobacter sp. K91 Isolate Unclassified
297 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
298 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
299 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
300 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
301 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
302 2904424332 Duganella sp. 1411 Isolate Rhizosphere
303 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
304 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
305 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
306 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
307 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
308 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
309 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
310 2919476304 Duganella sp. 3397 Isolate Unclassified
311 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
312 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
313 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
314 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.35
Metatranscriptomes 0
Isolates 10.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.6
Nodule 0.93
Rhizoplane 2.43
Rhizosphere 74.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495584_0002034 3300046491 Bacteria 11628
2 JGI25155J39150_1000813 3300002704 Bacteria 4887
3 JGI25155J39150_1000814 3300002704 Bacteria 4878
4 JGI25156J39149_1001146 3300002705 Bacteria 11872
5 JGI25156J39149_1007831 3300002705 Bacteria 2758
6 JGI25162J39368_1000036 3300002737 Bacteria 180433
7 JGI25162J39368_1003311 3300002737 Bacteria 4835
8 JGI25154J39366_1001169 3300002738 Bacteria 10057
9 JGI25154J39366_1001229 3300002738 Bacteria 9652
10 JGI25154J39366_1001612 3300002738 Bacteria 7666
11 JGI25157J39369_1000796 3300002741 Bacteria 16066
12 JGI25163J39215_1002533 3300002771 Bacteria 1824
13 JGI25165J46597_1000022 3300003214 Bacteria 357959
14 JGI25153J46596_10033156 3300003215 Bacteria 1709
15 Ga0055538_1000011 3300003751 Bacteria 357959
16 Ga0055538_1000024 3300003751 Bacteria 241526
17 Ga0055539_1000016 3300003752 Bacteria 358248
18 Ga0055539_1000031 3300003752 Bacteria 241526
19 Ga0055533_1000019 3300003756 Bacteria 357959
20 Ga0055533_1000041 3300003756 Bacteria 241526
21 Ga0055532_1000074 3300003758 Bacteria 125513
22 Ga0055525_1000042 3300003759 Bacteria 279804
23 Ga0055525_1000049 3300003759 Bacteria 241526
24 Ga0055529_1000015 3300003763 Bacteria 366950
25 Ga0055526_1000411 3300003771 Bacteria 34678
26 Ga0055541_1000017 3300003841 Bacteria 286811
27 Ga0055541_1000022 3300003841 Bacteria 241526
28 Ga0065715_10016676 3300005293 Bacteria 2003
29 Ga0070683_100001269 3300005329 Bacteria 19223
30 Ga0070690_100073357 3300005330 Bacteria 2227
31 Ga0070670_100122306 3300005331 Bacteria 2245
32 Ga0070670_100150757 3300005331 Bacteria 2012
33 Ga0070677_10018722 3300005333 Bacteria 2498
34 Ga0068869_100001950 3300005334 Bacteria 12358
35 Ga0068869_100011250 3300005334 Bacteria 5862
36 Ga0068869_100084577 3300005334 Bacteria 2375
37 Ga0070666_10093400 3300005335 Bacteria 2068
38 Ga0070666_10223417 3300005335 Bacteria 1329
39 Ga0068868_100154967 3300005338 Bacteria 1889
40 Ga0070661_100023572 3300005344 Bacteria 4412
41 Ga0070668_100028580 3300005347 Bacteria 4232
42 Ga0070675_100019962 3300005354 Bacteria 5346
43 Ga0070675_100038297 3300005354 Bacteria 3907
44 Ga0070675_100067506 3300005354 Bacteria 2959
45 Ga0070671_100023329 3300005355 Bacteria 5063
46 Ga0070671_100025766 3300005355 Bacteria 4828
47 Ga0070671_100040429 3300005355 Bacteria 3873
48 Ga0070671_100111453 3300005355 Bacteria 2299
49 Ga0070674_100004493 3300005356 Bacteria 7959
50 Ga0070674_100020993 3300005356 Bacteria 4185
51 Ga0070674_100023207 3300005356 Bacteria 4012
52 Ga0070674_100048460 3300005356 Bacteria 2916
53 Ga0070674_100085881 3300005356 Bacteria 2259
54 Ga0070673_100035083 3300005364 Bacteria 3801
55 Ga0070673_100117999 3300005364 Bacteria 2209
56 Ga0070688_100106559 3300005365 Bacteria 1857
57 Ga0070714_100194146 3300005435 Bacteria 1854
58 Ga0070714_100261076 3300005435 Bacteria 1604
59 Ga0070694_100104247 3300005444 Bacteria 2011
60 Ga0070708_100339466 3300005445 Bacteria 1416
61 Ga0070678_100010725 3300005456 Bacteria 5613
62 Ga0070678_100011584 3300005456 Bacteria 5446
63 Ga0070678_100054957 3300005456 Bacteria 2904
64 Ga0070678_100311271 3300005456 Bacteria 1342
65 Ga0070662_100149486 3300005457 Bacteria 1817
66 Ga0068867_100007073 3300005459 Bacteria 7928
67 Ga0068867_100075647 3300005459 Bacteria 2526
68 Ga0068867_100089980 3300005459 Bacteria 2328
69 Ga0070699_100209716 3300005518 Bacteria 1734
70 Ga0070679_100040681 3300005530 Bacteria 4625
71 Ga0070684_100167536 3300005535 Bacteria 1994
72 Ga0068853_100032759 3300005539 Bacteria 4404
73 Ga0070672_100011632 3300005543 Bacteria 6141
74 Ga0070672_100056166 3300005543 Bacteria 3086
75 Ga0070696_100144936 3300005546 Bacteria 1739
76 Ga0070693_100034524 3300005547 Bacteria 2799
77 Ga0070665_100006666 3300005548 Bacteria 11742
78 Ga0070665_100122000 3300005548 Bacteria 2608
79 Ga0070665_100217467 3300005548 Bacteria 1911
80 Ga0068855_100007810 3300005563 Bacteria 12920
81 Ga0068855_100042177 3300005563 Bacteria 5406
82 Ga0068855_100087418 3300005563 Bacteria 3603
83 Ga0070664_100018600 3300005564 Bacteria 5711
84 Ga0070664_100176265 3300005564 Bacteria 1898
85 Ga0068857_100034613 3300005577 Bacteria 4467
86 Ga0068857_100178781 3300005577 Bacteria 1930
87 Ga0068854_100259638 3300005578 Bacteria 1390
88 Ga0068852_100001737 3300005616 Bacteria 14834
89 Ga0068852_100154685 3300005616 Bacteria 2135
90 Ga0068859_100368999 3300005617 Bacteria 1531
91 Ga0068859_100380741 3300005617 Bacteria 1506
92 Ga0068864_100000656 3300005618 Bacteria 28875
93 Ga0068864_100002028 3300005618 Bacteria 16707
94 Ga0068864_100004298 3300005618 Bacteria 11712
95 Ga0068864_100067255 3300005618 Bacteria 3111
96 Ga0068864_100191379 3300005618 Bacteria 1875
97 Ga0068864_100258815 3300005618 Bacteria 1618
98 Ga0068866_10042479 3300005718 Bacteria 2262
99 Ga0068866_10146894 3300005718 Bacteria 1361
100 Ga0068861_100031153 3300005719 Bacteria 3915
101 Ga0068861_100081997 3300005719 Bacteria 2527
102 Ga0068851_10008955 3300005834 Bacteria 4642
103 Ga0068870_10027666 3300005840 Bacteria 2838
104 Ga0068870_10034833 3300005840 Bacteria 2579
105 Ga0068870_10041629 3300005840 Bacteria 2388
106 Ga0068863_100019892 3300005841 Bacteria 6421
107 Ga0068863_100036693 3300005841 Bacteria 4669
108 Ga0068863_100432189 3300005841 Bacteria 1290
109 Ga0068858_100028485 3300005842 Bacteria 5189
110 Ga0068858_100085774 3300005842 Bacteria 2930
111 Ga0068860_100037956 3300005843 Bacteria 4610
112 Ga0068860_100070409 3300005843 Bacteria 3325
113 Ga0068860_100093978 3300005843 Bacteria 2858
114 Ga0068860_100104911 3300005843 Bacteria 2699
115 Ga0068860_100419815 3300005843 Bacteria 1326
116 Ga0068862_100007043 3300005844 Bacteria 9338
117 Ga0068862_100022469 3300005844 Bacteria 5276
118 Ga0068862_100060971 3300005844 Bacteria 3241
119 Ga0068862_100076752 3300005844 Bacteria 2892
120 Ga0068862_100200206 3300005844 Bacteria 1800
121 Ga0068862_100357404 3300005844 Bacteria 1357
122 Ga0081539_10010806 3300005985 Bacteria 7345
123 Ga0070717_10123877 3300006028 Bacteria 2217
124 Ga0097621_100012338 3300006237 Bacteria 6329
125 Ga0097621_100024893 3300006237 Bacteria 4679
126 Ga0097621_100049325 3300006237 Bacteria 3419
127 Ga0097621_100130963 3300006237 Bacteria 2135
128 Ga0068871_100048640 3300006358 Bacteria 3424
129 Ga0068871_100071670 3300006358 Bacteria 2851
130 Ga0068871_100124416 3300006358 Bacteria 2181
131 Ga0068871_100182836 3300006358 Bacteria 1802
132 Ga0075428_100065356 3300006844 Bacteria 3983
133 Ga0068865_100043699 3300006881 Bacteria 3063
134 Ga0068865_100055341 3300006881 Bacteria 2760
135 Ga0097620_100369014 3300006931 Bacteria 1531
136 Ga0097620_100380702 3300006931 Bacteria 1506
137 Ga0079104_1005965 3300006946 Bacteria 4724
138 Ga0105244_10003810 3300009036 Bacteria 10640
139 Ga0105244_10018527 3300009036 Bacteria 3904
140 Ga0105244_10031833 3300009036 Bacteria 2798
141 Ga0105240_10016169 3300009093 Bacteria 10112
142 Ga0105240_10095751 3300009093 Bacteria 3619
143 Ga0105240_10110333 3300009093 Bacteria 3330
144 Ga0111539_10041103 3300009094 Bacteria 5561
145 Ga0105242_10211740 3300009176 Bacteria 1728
146 Ga0105248_10021120 3300009177 Bacteria 7215
147 Ga0105237_10010158 3300009545 Bacteria 10032
148 Ga0105238_10000107 3300009551 Bacteria 91765
149 Ga0105249_10061247 3300009553 Bacteria 3453
150 Ga0105249_10157707 3300009553 Bacteria 2190
151 Ga0105239_10001202 3300010375 Bacteria 35405
152 Ga0105239_10207888 3300010375 Bacteria 2193
153 Ga0157373_10237572 3300013100 Bacteria 1288
154 Ga0157369_10249390 3300013105 Bacteria 1853
155 Ga0157374_10103647 3300013296 Bacteria 2730
156 Ga0157374_10120966 3300013296 Bacteria 2527
157 Ga0157378_10041906 3300013297 Bacteria 4062
158 Ga0157378_10061833 3300013297 Bacteria 3343
159 Ga0157378_10215909 3300013297 Bacteria 1821
160 Ga0163162_10320439 3300013306 Bacteria 1683
161 Ga0163162_10385326 3300013306 Bacteria 1535
162 Ga0157375_10044984 3300013308 Bacteria 4295
163 Ga0157375_10050428 3300013308 Bacteria 4083
164 Ga0163163_10003457 3300014325 Bacteria 13423
165 Ga0157380_10044600 3300014326 Bacteria 3476
166 Ga0182008_10064633 3300014497 Bacteria 1801
167 Ga0157379_10023567 3300014968 Bacteria 5462
168 Ga0157379_10107879 3300014968 Bacteria 2500
169 Ga0157379_10236325 3300014968 Bacteria 1657
170 Ga0157376_10008428 3300014969 Bacteria 7438
171 Ga0157376_10032848 3300014969 Bacteria 4171
172 Ga0157376_10141865 3300014969 Bacteria 2156
173 Ga0182006_1000002 3300015261 Bacteria 887990
174 Ga0182006_1000231 3300015261 Bacteria 52984
175 Ga0182007_10000176 3300015262 Bacteria 43571
176 Ga0182007_10008818 3300015262 Bacteria 4113
177 Ga0182007_10012212 3300015262 Bacteria 3313
178 Ga0182007_10053350 3300015262 Bacteria 1331
179 Ga0182005_1000002 3300015265 Bacteria 908499
180 Ga0182005_1000037 3300015265 Bacteria 166102
181 Ga0182005_1005071 3300015265 Bacteria 4155
182 Ga0163161_10053809 3300017792 Bacteria 2920
183 Ga0213876_10000466 3300021384 Bacteria 32338
184 Ga0209435_100094 3300025206 Bacteria 39577
185 Ga0209760_103621 3300025207 Bacteria 1363
186 Ga0209784_100018 3300025224 Bacteria 456816
187 Ga0209784_100019 3300025224 Bacteria 453558
188 Ga0209566_100016 3300025225 Bacteria 456824
189 Ga0209566_100017 3300025225 Bacteria 453558
190 Ga0209674_100030 3300025226 Bacteria 456824
191 Ga0209674_100031 3300025226 Bacteria 453558
192 Ga0209147_100097 3300025229 Bacteria 164034
193 Ga0209563_100034 3300025230 Bacteria 456824
194 Ga0209563_100035 3300025230 Bacteria 453558
195 Ga0207427_100315 3300025231 Bacteria 32969
196 Ga0209437_100038 3300025233 Bacteria 453558
197 Ga0209437_100372 3300025233 Bacteria 45954
198 Ga0209258_100192 3300025242 Bacteria 125565
199 Ga0207425_1000455 3300025245 Bacteria 26503
200 Ga0209646_1000051 3300025246 Bacteria 296525
201 Ga0209646_1000103 3300025246 Bacteria 164034
202 Ga0209646_1000398 3300025246 Bacteria 25972
203 Ga0209026_1001208 3300025250 Bacteria 11962
204 Ga0209677_100019 3300025253 Bacteria 456824
205 Ga0209677_100020 3300025253 Bacteria 453558
206 Ga0209759_1000091 3300025256 Bacteria 164034
207 Ga0209759_1001694 3300025256 Bacteria 11470
208 Ga0209233_1000049 3300025261 Bacteria 453558
209 Ga0209455_1000031 3300025272 Bacteria 519952
210 Ga0209455_1000319 3300025272 Bacteria 47809
211 Ga0209455_1006271 3300025272 Bacteria 3537
212 Ga0209025_1020414 3300025294 Bacteria 3627
213 Ga0209564_1000011 3300025295 Bacteria 822327
214 Ga0209758_1000286 3300025297 Bacteria 99636
215 Ga0207697_10000114 3300025315 Bacteria 37714
216 Ga0207697_10079995 3300025315 Bacteria 1377
217 Ga0207656_10004253 3300025321 Bacteria 4986
218 Ga0207655_1025647 3300025728 Bacteria 2855
219 Ga0207713_1018426 3300025735 Bacteria 3458
220 Ga0207682_10002141 3300025893 Bacteria 8947
221 Ga0207642_10017443 3300025899 Bacteria 2731
222 Ga0207688_10000190 3300025901 Bacteria 27202
223 Ga0207680_10088988 3300025903 Bacteria 1959
224 Ga0207680_10091278 3300025903 Bacteria 1938
225 Ga0207680_10092478 3300025903 Bacteria 1927
226 Ga0207645_10074659 3300025907 Bacteria 2170
227 Ga0207643_10000683 3300025908 Bacteria 21203
228 Ga0207643_10057030 3300025908 Bacteria 2223
229 Ga0207707_10120805 3300025912 Bacteria 2291
230 Ga0207695_10001362 3300025913 Bacteria 41437
231 Ga0207695_10009442 3300025913 Bacteria 12064
232 Ga0207695_10014244 3300025913 Bacteria 9432
233 Ga0207695_10164918 3300025913 Bacteria 2144
234 Ga0207671_10001336 3300025914 Bacteria 28835
235 Ga0207671_10098691 3300025914 Bacteria 2209
236 Ga0207663_10017653 3300025916 Bacteria 3982
237 Ga0207657_10021094 3300025919 Bacteria 6139
238 Ga0207681_10088404 3300025923 Bacteria 2207
239 Ga0207681_10094606 3300025923 Bacteria 2141
240 Ga0207681_10203826 3300025923 Bacteria 1520
241 Ga0207694_10000130 3300025924 Bacteria 77624
242 Ga0207650_10002751 3300025925 Bacteria 12133
243 Ga0207650_10017924 3300025925 Bacteria 4962
244 Ga0207650_10051311 3300025925 Bacteria 3052
245 Ga0207650_10076538 3300025925 Bacteria 2528
246 Ga0207659_10030586 3300025926 Bacteria 3681
247 Ga0207659_10034701 3300025926 Bacteria 3481
248 Ga0207700_10000082 3300025928 Bacteria 58939
249 Ga0207664_10234771 3300025929 Bacteria 1595
250 Ga0207644_10007321 3300025931 Bacteria 7184
251 Ga0207644_10059333 3300025931 Bacteria 2767
252 Ga0207690_10095760 3300025932 Bacteria 2109
253 Ga0207706_10117066 3300025933 Bacteria 2344
254 Ga0207670_10151946 3300025936 Bacteria 1719
255 Ga0207669_10002801 3300025937 Bacteria 7471
256 Ga0207669_10018315 3300025937 Bacteria 3617
257 Ga0207669_10092995 3300025937 Bacteria 1969
258 Ga0207691_10000282 3300025940 Bacteria 50196
259 Ga0207691_10003554 3300025940 Bacteria 15162
260 Ga0207691_10015564 3300025940 Bacteria 7231
261 Ga0207691_10022198 3300025940 Bacteria 5987
262 Ga0207711_10015183 3300025941 Bacteria 6394
263 Ga0207711_10031413 3300025941 Bacteria 4482
264 Ga0207711_10040750 3300025941 Bacteria 3952
265 Ga0207689_10000236 3300025942 Bacteria 49281
266 Ga0207689_10004760 3300025942 Bacteria 12243
267 Ga0207689_10031421 3300025942 Bacteria 4420
268 Ga0207689_10161641 3300025942 Bacteria 1845
269 Ga0207667_10002863 3300025949 Bacteria 21405
270 Ga0207667_10004521 3300025949 Bacteria 17039
271 Ga0207651_10025135 3300025960 Bacteria 3698
272 Ga0207651_10048141 3300025960 Bacteria 2880
273 Ga0207651_10106402 3300025960 Bacteria 2094
274 Ga0207651_10131224 3300025960 Bacteria 1918
275 Ga0207658_10066603 3300025986 Bacteria 2709
276 Ga0207703_10002561 3300026035 Bacteria 15706
277 Ga0207703_10051154 3300026035 Bacteria 3347
278 Ga0207703_10082136 3300026035 Bacteria 2688
279 Ga0207639_10051279 3300026041 Bacteria 3138
280 Ga0207678_10016762 3300026067 Bacteria 6435
281 Ga0207708_10002496 3300026075 Bacteria 13538
282 Ga0207708_10096261 3300026075 Bacteria 2287
283 Ga0207702_10032287 3300026078 Bacteria 4369
284 Ga0207641_10050007 3300026088 Bacteria 3535
285 Ga0207641_10132933 3300026088 Bacteria 2236
286 Ga0207641_10451544 3300026088 Bacteria 1242
287 Ga0207648_10017616 3300026089 Bacteria 6488
288 Ga0207648_10030633 3300026089 Bacteria 4762
289 Ga0207648_10046431 3300026089 Bacteria 3808
290 Ga0207648_10048261 3300026089 Bacteria 3728
291 Ga0207648_10058515 3300026089 Bacteria 3361
292 Ga0207648_10062718 3300026089 Bacteria 3240
293 Ga0207648_10243083 3300026089 Bacteria 1603
294 Ga0207676_10006248 3300026095 Bacteria 8410
295 Ga0207676_10043994 3300026095 Bacteria 3442
296 Ga0207676_10082849 3300026095 Bacteria 2610
297 Ga0207676_10189078 3300026095 Bacteria 1810
298 Ga0207676_10206592 3300026095 Bacteria 1739
299 Ga0207674_10052685 3300026116 Bacteria 4149
300 Ga0207674_10279411 3300026116 Bacteria 1618
301 Ga0207675_100012145 3300026118 Bacteria 8046
302 Ga0207675_100016418 3300026118 Bacteria 6914
303 Ga0207675_100171386 3300026118 Bacteria 2075
304 Ga0207675_100224765 3300026118 Bacteria 1809
305 Ga0207683_10000005 3300026121 Bacteria 187889
306 Ga0207683_10007970 3300026121 Bacteria 9062
307 Ga0207683_10019024 3300026121 Bacteria 5862
308 Ga0207683_10026288 3300026121 Bacteria 5024
309 Ga0207698_10002326 3300026142 Bacteria 11254
310 Ga0207698_10002505 3300026142 Bacteria 10897
311 Ga0209281_1007420 3300027111 Bacteria 2754
312 Ga0209998_10018614 3300027717 Bacteria 1476
313 Ga0268266_10026246 3300028379 Bacteria 4957
314 Ga0268266_10067830 3300028379 Bacteria 3088
315 Ga0268266_10105714 3300028379 Bacteria 2487
316 Ga0268266_10224848 3300028379 Bacteria 1727
317 Ga0268265_10058836 3300028380 Bacteria 2937
318 Ga0268265_10103275 3300028380 Bacteria 2308
319 Ga0268264_10085308 3300028381 Bacteria 2710
320 Ga0268264_10140046 3300028381 Bacteria 2156
321 Ga0268264_10148804 3300028381 Bacteria 2097
322 Ga0268264_10342142 3300028381 Bacteria 1421
323 Ga0307515_10107895 3300028794 Bacteria 3286
324 Ga0265328_10000108 3300031239 Bacteria 39432
325 Ga0265327_10001504 3300031251 Bacteria 28880
326 Ga0307513_10176630 3300031456 Bacteria 2005
327 Ga0316575_10000019 3300031665 Bacteria 42637
328 Ga0373937_0082054 3300036401 Bacteria 2983
329 Ga0373925_0054709 3300037068 Bacteria 2986
330 Ga0395899_0000637 3300037312 Bacteria 36229
331 Ga0395899_0002108 3300037312 Bacteria 16341
332 Ga0395899_0002891 3300037312 Bacteria 13797
333 Ga0395900_0000252 3300037418 Bacteria 83358
334 Ga0395900_0008082 3300037418 Bacteria 10830
335 Ga0395900_0028511 3300037418 Bacteria 5721
336 Ga0395898_0004624 3300037466 Bacteria 15023
337 Ga0395905_0000455 3300037471 Bacteria 57161
338 Ga0436364_0771919 3300037853 Bacteria 2911
339 Ga0395901_0000967 3300038443 Bacteria 31229
340 Ga0395901_0003504 3300038443 Bacteria 15808
341 Ga0395901_0023068 3300038443 Bacteria 6378
342 Ga0436365_0093204 3300039437 Bacteria 1768
343 Ga0436365_0206678 3300039437 Bacteria 20594
344 Ga0436365_0926110 3300039437 Bacteria 5187
345 Ga0436360_0627319 3300039438 Bacteria 3961
346 Ga0436361_0031704 3300039447 Bacteria 1440
347 Ga0466972_0000070 3300044658 Bacteria 100242
348 Ga0495617_000096 3300046452 Bacteria 62625
349 Ga0495617_041929 3300046452 Bacteria 1529
350 Ga0495592_0019492 3300046454 Bacteria 5159
351 Ga0495590_0000002 3300046457 Bacteria 485720
352 Ga0495638_0000367 3300046460 Bacteria 55964
353 Ga0495638_0001765 3300046460 Bacteria 18944
354 Ga0495650_0000019 3300046471 Bacteria 533849
355 Ga0495650_0000276 3300046471 Bacteria 98048
356 Ga0495650_0000530 3300046471 Bacteria 55501
357 Ga0495650_0001558 3300046471 Bacteria 21622
358 Ga0495580_0028776 3300046472 Bacteria 4037
359 Ga0495582_0010500 3300046473 Bacteria 5094
360 Ga0495605_0000023 3300046474 Bacteria 236732
361 Ga0495605_0001219 3300046474 Bacteria 17121
362 Ga0495596_0000088 3300046500 Bacteria 64229
363 Ga0495607_0004194 3300046501 Bacteria 10702
364 Ga0495607_0004779 3300046501 Bacteria 9894
365 Ga0495607_0022889 3300046501 Bacteria 3918
366 Ga0495583_0000016 3300046506 Bacteria 312691
367 Ga0495583_0001717 3300046506 Bacteria 21041
368 Ga0495606_0000001 3300046507 Bacteria 592123
369 Ga0495606_0000089 3300046507 Bacteria 154743
370 Ga0495606_0000526 3300046507 Bacteria 61953
371 Ga0495606_0003493 3300046507 Bacteria 16645
372 Ga0495606_0005324 3300046507 Bacteria 12372
373 Ga0495606_0005973 3300046507 Bacteria 11420
374 Ga0495606_0016928 3300046507 Bacteria 5534
375 Ga0495606_0122806 3300046507 Bacteria 1552
376 Ga0495608_0023013 3300046511 Bacteria 4272
377 Ga0495610_0000106 3300046512 Bacteria 97582
378 Ga0495610_0003952 3300046512 Bacteria 11224
379 Ga0495610_0009664 3300046512 Bacteria 6071
380 Ga0495610_0021686 3300046512 Bacteria 3526
381 Ga0495616_0029555 3300046513 Bacteria 2891
382 Ga0495616_0034750 3300046513 Bacteria 2614
383 Ga0495616_0092977 3300046513 Bacteria 1425
384 Ga0495628_0001262 3300046516 Bacteria 23180
385 Ga0495637_0001337 3300046520 Bacteria 14795
386 Ga0495643_0000312 3300046522 Bacteria 67022
387 Ga0495643_0001280 3300046522 Bacteria 24099
388 Ga0495643_0019437 3300046522 Bacteria 3930
389 Ga0495644_0000339 3300046523 Bacteria 21282
390 Ga0495648_0000037 3300046524 Bacteria 195401
391 Ga0495648_0000384 3300046524 Bacteria 48550
392 Ga0495648_0009791 3300046524 Bacteria 7374
393 Ga0495652_0025793 3300046529 Bacteria 5195
394 Ga0495652_0182043 3300046529 Bacteria 1611
395 Ga0495654_0000015 3300046530 Bacteria 307873
396 Ga0495654_0009030 3300046530 Bacteria 5472
397 Ga0495654_0061845 3300046530 Bacteria 1796
398 Ga0495665_0009106 3300046531 Bacteria 5380
399 Ga0495609_0000431 3300046538 Bacteria 34849
400 Ga0495609_0001009 3300046538 Bacteria 20017
401 Ga0495597_0000874 3300046542 Bacteria 23420
402 Ga0495597_0065004 3300046542 Bacteria 1583
403 Ga0495645_0009956 3300046543 Bacteria 6655
404 Ga0495633_0000244 3300046558 Bacteria 65398
405 Ga0495633_0000334 3300046558 Bacteria 52747
406 Ga0495633_0000433 3300046558 Bacteria 43302
407 Ga0495633_0020963 3300046558 Bacteria 3276
408 Ga0495633_0075304 3300046558 Bacteria 1572
409 Ga0495656_0008575 3300046615 Bacteria 3653
410 Ga0495668_0000241 3300046616 Bacteria 78040
411 Ga0495668_0001687 3300046616 Bacteria 20430
412 Ga0495611_0001508 3300046648 Bacteria 11493
413 Ga0495625_0001881 3300046660 Bacteria 23817
414 Ga0495625_0014730 3300046660 Bacteria 6225
415 Ga0495625_0026803 3300046660 Bacteria 4348
416 Ga0495659_0000461 3300046664 Bacteria 15185
417 Ga0495661_0010477 3300046665 Bacteria 6324
418 Ga0495646_0012603 3300046680 Bacteria 5373
419 Ga0495658_0002829 3300046683 Bacteria 8717
420 Ga0495613_0041193 3300046689 Bacteria 3421
421 Ga0495671_0000006 3300046692 Bacteria 500471
422 Ga0495671_0001937 3300046692 Bacteria 13276
423 Ga0495636_0000252 3300047318 Bacteria 21169
424 Ga0495672_0000159 3300047320 Bacteria 98262
425 Ga0495672_0031972 3300047320 Bacteria 3279
426 Ga0495683_0004311 3300047323 Bacteria 8108
427 Ga0495687_000281 3300047443 Bacteria 66974
428 Ga0495687_001598 3300047443 Bacteria 20448
429 Ga0495677_0000230 3300047445 Bacteria 25473
430 Ga0495679_011288 3300047446 Bacteria 3457
431 Ga0495685_000057 3300047447 Bacteria 41679
432 Ga0495673_0000003 3300047469 Bacteria 1491337
433 Ga0495673_0000061 3300047469 Bacteria 230647
434 Ga0495686_0000321 3300047472 Bacteria 79813
435 Ga0495686_0026700 3300047472 Bacteria 3777
436 Ga0495626_0005215 3300048091 Bacteria 7692
437 Ga0495626_0008949 3300048091 Bacteria 5434
438 Ga0496100_0087502 3300048903 Bacteria 2118
439 Ga0496102_0018236 3300048905 Bacteria 6164
440 Ga0496103_0023805 3300048906 Bacteria 3693
441 Ga0496106_0035810 3300048909 Bacteria 3711
442 Ga0496108_0092792 3300048911 Bacteria 2567
443 Ga0496109_0025707 3300048912 Bacteria 5248
444 Ga0496109_0035756 3300048912 Bacteria 4483
445 Ga0496110_0025065 3300048913 Bacteria 5092
446 Ga0496112_0003280 3300048915 Bacteria 13362
447 Ga0496114_0201639 3300048917 Bacteria 1742
448 Ga0496114_0299524 3300048917 Bacteria 1419
449 Ga0496116_0007298 3300048919 Bacteria 9843
450 Ga0496117_0000001 3300048920 Bacteria 2526244
451 Ga0496118_0000002 3300048921 Bacteria 1690764
452 Ga0496121_0000684 3300048924 Bacteria 63147
453 Ga0496121_0003774 3300048924 Bacteria 21160
454 Ga0496121_0015920 3300048924 Bacteria 7811
455 Ga0496122_0000701 3300048925 Bacteria 66268
456 Ga0496122_0003287 3300048925 Bacteria 21411
457 Ga0496122_0009086 3300048925 Bacteria 10539
458 Ga0496123_0004113 3300048926 Bacteria 15595
459 Ga0496124_0020891 3300048927 Bacteria 6040
460 Ga0496124_0087729 3300048927 Bacteria 2544
461 Ga0496125_0040163 3300048928 Bacteria 4016
462 Ga0496125_0054590 3300048928 Bacteria 3263
463 Ga0495678_000905 3300049459 Bacteria 26145
464 Ga0495678_001619 3300049459 Bacteria 17175
465 Ga0495678_004565 3300049459 Bacteria 7965
466 Ga0495682_0000408 3300049460 Bacteria 30679
467 Ga0501072_0006553 3300049588 Bacteria 8867
468 Ga0501073_0018946 3300049589 Bacteria 4973
469 Ga0501080_0003752 3300049742 Bacteria 13415
470 Ga0501269_000655 3300049766 Bacteria 5945
471 Ga0501035_0002263 3300049822 Bacteria 19027
472 Ga0501035_0004536 3300049822 Bacteria 13179
473 Ga0501044_0005080 3300049823 Bacteria 14681
474 nmdc:mga08y16_95476_c1 3300050511 Bacteria 3097
475 Ga0500618_000543 3300053125 Bacteria 23454
476 Ga0500586_000310 3300053145 Bacteria 9716
477 Ga0500622_0000011 3300053156 Bacteria 386096
478 Ga0500661_010238 3300055283 Bacteria 1708
479 2511250586 2511231003 Bacteria 5606035
480 2511387923 2511231026 Bacteria 5225445
481 2521560650 2521172590 Bacteria 5047645
482 2550697254 2548876994 Bacteria 4904866
483 2553008016 2551306416 Bacteria 6152985
484 2599907278 2599185292 Bacteria 6290804
485 2601667734 2600255292 Bacteria 6300551
486 2643863975 2643221569 Bacteria 6064337
487 2643982509 2643221594 Bacteria 5811388
488 2644026681 2643221603 Bacteria 6147767
489 2644121481 2643221621 Bacteria 6212786
490 2644249707 2643221645 Bacteria 7207331
491 2644356275 2643221664 Bacteria 7272945
492 2738739080 2738541280 Bacteria 6630198
493 2738830184 2738541297 Bacteria 6549566
494 2738846313 2738541300 Bacteria 6675882
495 2739153980 2738541357 Bacteria 6549408
496 2739195900 2738543003 Bacteria 6549560
497 2739275038 2738543018 Bacteria 6718814
498 2739322376 2738543026 Bacteria 6549408
499 2739340617 2738543029 Bacteria 6549249
500 2739344082 2738543030 Bacteria 6719714
501 2765571898 2765235838 Bacteria 5445269
502 2808982103 2808606386 Bacteria 4471946
503 2809034621 2808606395 Bacteria 6020352
504 2809130096 2808606415 Bacteria 4576710
505 2809148849 2808606419 Bacteria 4576925
506 2819542493 2818991436 Bacteria 5376622
507 2819595332 2818991445 Bacteria 4955017
508 2819618821 2818991449 Bacteria 5518009
509 2839098378 2839094727 Bacteria 5534556
510 2842712649 2842711865 Bacteria 7155354
511 2852618982 2852618963 Bacteria 4577824
512 2857541785 2857537821 Bacteria 5248181
513 2857544339 2857542790 Bacteria 5326616
514 2857550237 2857547612 Bacteria 6179999
515 2857561019 2857558681 Bacteria 6617694
516 2857568459 2857564685 Bacteria 6290584
517 2858953723 2858950400 Bacteria 6783797
518 2884839282 2884836552 Bacteria 5219991
519 2884856908 2884852848 Bacteria 5221161
520 2885086288 2885080285 Bacteria 6355622
521 2891092835 2891088606 Bacteria 4762464
522 2896158254 2896154374 Bacteria 5221518
523 2904425451 2904424332 Bacteria 7633521
524 2904442968 2904439833 Bacteria 5931679
525 2904534824 2904530477 Bacteria 5876334
526 2904588847 2904584206 Bacteria 6028872
527 2904594080 2904589729 Bacteria 6113573
528 2904605076 2904601388 Bacteria 5884906
529 2919048525 2919046199 Bacteria 5567169
530 2919083308 2919079590 Bacteria 5946433
531 2919477297 2919476304 Bacteria 5888696
532 2923514457 2923510766 Bacteria 5926163
533 2928133165 2928130867 Bacteria 5467269
534 2932411347 2932410948 Bacteria 6312192
535 2932419086 2932416698 Bacteria 6315112
536 Ga0495584_0002034
537 JGI25155J39150_1000813
538 JGI25155J39150_1000814
539 JGI25156J39149_1001146
540 JGI25156J39149_1007831
541 JGI25162J39368_1000036
542 JGI25162J39368_1003311
543 JGI25154J39366_1001169
544 JGI25154J39366_1001229
545 JGI25154J39366_1001612
546 JGI25157J39369_1000796
547 JGI25163J39215_1002533
548 JGI25165J46597_1000022
549 JGI25153J46596_10033156
550 Ga0055538_1000011
551 Ga0055538_1000024
552 Ga0055539_1000016
553 Ga0055539_1000031
554 Ga0055533_1000019
555 Ga0055533_1000041
556 Ga0055532_1000074
557 Ga0055525_1000042
558 Ga0055525_1000049
559 Ga0055529_1000015
560 Ga0055526_1000411
561 Ga0055541_1000017
562 Ga0055541_1000022
563 Ga0065715_10016676
564 Ga0070683_100001269
565 Ga0070690_100073357
566 Ga0070670_100122306
567 Ga0070670_100150757
568 Ga0070677_10018722
569 Ga0068869_100001950
570 Ga0068869_100011250
571 Ga0068869_100084577
572 Ga0070666_10093400
573 Ga0070666_10223417
574 Ga0068868_100154967
575 Ga0070661_100023572
576 Ga0070668_100028580
577 Ga0070675_100019962
578 Ga0070675_100038297
579 Ga0070675_100067506
580 Ga0070671_100023329
581 Ga0070671_100025766
582 Ga0070671_100040429
583 Ga0070671_100111453
584 Ga0070674_100004493
585 Ga0070674_100020993
586 Ga0070674_100023207
587 Ga0070674_100048460
588 Ga0070674_100085881
589 Ga0070673_100035083
590 Ga0070673_100117999
591 Ga0070688_100106559
592 Ga0070714_100194146
593 Ga0070714_100261076
594 Ga0070694_100104247
595 Ga0070708_100339466
596 Ga0070678_100010725
597 Ga0070678_100011584
598 Ga0070678_100054957
599 Ga0070678_100311271
600 Ga0070662_100149486
601 Ga0068867_100007073
602 Ga0068867_100075647
603 Ga0068867_100089980
604 Ga0070699_100209716
605 Ga0070679_100040681
606 Ga0070684_100167536
607 Ga0068853_100032759
608 Ga0070672_100011632
609 Ga0070672_100056166
610 Ga0070696_100144936
611 Ga0070693_100034524
612 Ga0070665_100006666
613 Ga0070665_100122000
614 Ga0070665_100217467
615 Ga0068855_100007810
616 Ga0068855_100042177
617 Ga0068855_100087418
618 Ga0070664_100018600
619 Ga0070664_100176265
620 Ga0068857_100034613
621 Ga0068857_100178781
622 Ga0068854_100259638
623 Ga0068852_100001737
624 Ga0068852_100154685
625 Ga0068859_100368999
626 Ga0068859_100380741
627 Ga0068864_100000656
628 Ga0068864_100002028
629 Ga0068864_100004298
630 Ga0068864_100067255
631 Ga0068864_100191379
632 Ga0068864_100258815
633 Ga0068866_10042479
634 Ga0068866_10146894
635 Ga0068861_100031153
636 Ga0068861_100081997
637 Ga0068851_10008955
638 Ga0068870_10027666
639 Ga0068870_10034833
640 Ga0068870_10041629
641 Ga0068863_100019892
642 Ga0068863_100036693
643 Ga0068863_100432189
644 Ga0068858_100028485
645 Ga0068858_100085774
646 Ga0068860_100037956
647 Ga0068860_100070409
648 Ga0068860_100093978
649 Ga0068860_100104911
650 Ga0068860_100419815
651 Ga0068862_100007043
652 Ga0068862_100022469
653 Ga0068862_100060971
654 Ga0068862_100076752
655 Ga0068862_100200206
656 Ga0068862_100357404
657 Ga0081539_10010806
658 Ga0070717_10123877
659 Ga0097621_100012338
660 Ga0097621_100024893
661 Ga0097621_100049325
662 Ga0097621_100130963
663 Ga0068871_100048640
664 Ga0068871_100071670
665 Ga0068871_100124416
666 Ga0068871_100182836
667 Ga0075428_100065356
668 Ga0068865_100043699
669 Ga0068865_100055341
670 Ga0097620_100369014
671 Ga0097620_100380702
672 Ga0079104_1005965
673 Ga0105244_10003810
674 Ga0105244_10018527
675 Ga0105244_10031833
676 Ga0105240_10016169
677 Ga0105240_10095751
678 Ga0105240_10110333
679 Ga0111539_10041103
680 Ga0105242_10211740
681 Ga0105248_10021120
682 Ga0105237_10010158
683 Ga0105238_10000107
684 Ga0105249_10061247
685 Ga0105249_10157707
686 Ga0105239_10001202
687 Ga0105239_10207888
688 Ga0157373_10237572
689 Ga0157369_10249390
690 Ga0157374_10103647
691 Ga0157374_10120966
692 Ga0157378_10041906
693 Ga0157378_10061833
694 Ga0157378_10215909
695 Ga0163162_10320439
696 Ga0163162_10385326
697 Ga0157375_10044984
698 Ga0157375_10050428
699 Ga0163163_10003457
700 Ga0157380_10044600
701 Ga0182008_10064633
702 Ga0157379_10023567
703 Ga0157379_10107879
704 Ga0157379_10236325
705 Ga0157376_10008428
706 Ga0157376_10032848
707 Ga0157376_10141865
708 Ga0182006_1000002
709 Ga0182006_1000231
710 Ga0182007_10000176
711 Ga0182007_10008818
712 Ga0182007_10012212
713 Ga0182007_10053350
714 Ga0182005_1000002
715 Ga0182005_1000037
716 Ga0182005_1005071
717 Ga0163161_10053809
718 Ga0213876_10000466
719 Ga0209435_100094
720 Ga0209760_103621
721 Ga0209784_100018
722 Ga0209784_100019
723 Ga0209566_100016
724 Ga0209566_100017
725 Ga0209674_100030
726 Ga0209674_100031
727 Ga0209147_100097
728 Ga0209563_100034
729 Ga0209563_100035
730 Ga0207427_100315
731 Ga0209437_100038
732 Ga0209437_100372
733 Ga0209258_100192
734 Ga0207425_1000455
735 Ga0209646_1000051
736 Ga0209646_1000103
737 Ga0209646_1000398
738 Ga0209026_1001208
739 Ga0209677_100019
740 Ga0209677_100020
741 Ga0209759_1000091
742 Ga0209759_1001694
743 Ga0209233_1000049
744 Ga0209455_1000031
745 Ga0209455_1000319
746 Ga0209455_1006271
747 Ga0209025_1020414
748 Ga0209564_1000011
749 Ga0209758_1000286
750 Ga0207697_10000114
751 Ga0207697_10079995
752 Ga0207656_10004253
753 Ga0207655_1025647
754 Ga0207713_1018426
755 Ga0207682_10002141
756 Ga0207642_10017443
757 Ga0207688_10000190
758 Ga0207680_10088988
759 Ga0207680_10091278
760 Ga0207680_10092478
761 Ga0207645_10074659
762 Ga0207643_10000683
763 Ga0207643_10057030
764 Ga0207707_10120805
765 Ga0207695_10001362
766 Ga0207695_10009442
767 Ga0207695_10014244
768 Ga0207695_10164918
769 Ga0207671_10001336
770 Ga0207671_10098691
771 Ga0207663_10017653
772 Ga0207657_10021094
773 Ga0207681_10088404
774 Ga0207681_10094606
775 Ga0207681_10203826
776 Ga0207694_10000130
777 Ga0207650_10002751
778 Ga0207650_10017924
779 Ga0207650_10051311
780 Ga0207650_10076538
781 Ga0207659_10030586
782 Ga0207659_10034701
783 Ga0207700_10000082
784 Ga0207664_10234771
785 Ga0207644_10007321
786 Ga0207644_10059333
787 Ga0207690_10095760
788 Ga0207706_10117066
789 Ga0207670_10151946
790 Ga0207669_10002801
791 Ga0207669_10018315
792 Ga0207669_10092995
793 Ga0207691_10000282
794 Ga0207691_10003554
795 Ga0207691_10015564
796 Ga0207691_10022198
797 Ga0207711_10015183
798 Ga0207711_10031413
799 Ga0207711_10040750
800 Ga0207689_10000236
801 Ga0207689_10004760
802 Ga0207689_10031421
803 Ga0207689_10161641
804 Ga0207667_10002863
805 Ga0207667_10004521
806 Ga0207651_10025135
807 Ga0207651_10048141
808 Ga0207651_10106402
809 Ga0207651_10131224
810 Ga0207658_10066603
811 Ga0207703_10002561
812 Ga0207703_10051154
813 Ga0207703_10082136
814 Ga0207639_10051279
815 Ga0207678_10016762
816 Ga0207708_10002496
817 Ga0207708_10096261
818 Ga0207702_10032287
819 Ga0207641_10050007
820 Ga0207641_10132933
821 Ga0207641_10451544
822 Ga0207648_10017616
823 Ga0207648_10030633
824 Ga0207648_10046431
825 Ga0207648_10048261
826 Ga0207648_10058515
827 Ga0207648_10062718
828 Ga0207648_10243083
829 Ga0207676_10006248
830 Ga0207676_10043994
831 Ga0207676_10082849
832 Ga0207676_10189078
833 Ga0207676_10206592
834 Ga0207674_10052685
835 Ga0207674_10279411
836 Ga0207675_100012145
837 Ga0207675_100016418
838 Ga0207675_100171386
839 Ga0207675_100224765
840 Ga0207683_10000005
841 Ga0207683_10007970
842 Ga0207683_10019024
843 Ga0207683_10026288
844 Ga0207698_10002326
845 Ga0207698_10002505
846 Ga0209281_1007420
847 Ga0209998_10018614
848 Ga0268266_10026246
849 Ga0268266_10067830
850 Ga0268266_10105714
851 Ga0268266_10224848
852 Ga0268265_10058836
853 Ga0268265_10103275
854 Ga0268264_10085308
855 Ga0268264_10140046
856 Ga0268264_10148804
857 Ga0268264_10342142
858 Ga0307515_10107895
859 Ga0265328_10000108
860 Ga0265327_10001504
861 Ga0307513_10176630
862 Ga0316575_10000019
863 Ga0373937_0082054
864 Ga0373925_0054709
865 Ga0395899_0000637
866 Ga0395899_0002108
867 Ga0395899_0002891
868 Ga0395900_0000252
869 Ga0395900_0008082
870 Ga0395900_0028511
871 Ga0395898_0004624
872 Ga0395905_0000455
873 Ga0436364_0771919
874 Ga0395901_0000967
875 Ga0395901_0003504
876 Ga0395901_0023068
877 Ga0436365_0093204
878 Ga0436365_0206678
879 Ga0436365_0926110
880 Ga0436360_0627319
881 Ga0436361_0031704
882 Ga0466972_0000070
883 Ga0495617_000096
884 Ga0495617_041929
885 Ga0495592_0019492
886 Ga0495590_0000002
887 Ga0495638_0000367
888 Ga0495638_0001765
889 Ga0495650_0000019
890 Ga0495650_0000276
891 Ga0495650_0000530
892 Ga0495650_0001558
893 Ga0495580_0028776
894 Ga0495582_0010500
895 Ga0495605_0000023
896 Ga0495605_0001219
897 Ga0495596_0000088
898 Ga0495607_0004194
899 Ga0495607_0004779
900 Ga0495607_0022889
901 Ga0495583_0000016
902 Ga0495583_0001717
903 Ga0495606_0000001
904 Ga0495606_0000089
905 Ga0495606_0000526
906 Ga0495606_0003493
907 Ga0495606_0005324
908 Ga0495606_0005973
909 Ga0495606_0016928
910 Ga0495606_0122806
911 Ga0495608_0023013
912 Ga0495610_0000106
913 Ga0495610_0003952
914 Ga0495610_0009664
915 Ga0495610_0021686
916 Ga0495616_0029555
917 Ga0495616_0034750
918 Ga0495616_0092977
919 Ga0495628_0001262
920 Ga0495637_0001337
921 Ga0495643_0000312
922 Ga0495643_0001280
923 Ga0495643_0019437
924 Ga0495644_0000339
925 Ga0495648_0000037
926 Ga0495648_0000384
927 Ga0495648_0009791
928 Ga0495652_0025793
929 Ga0495652_0182043
930 Ga0495654_0000015
931 Ga0495654_0009030
932 Ga0495654_0061845
933 Ga0495665_0009106
934 Ga0495609_0000431
935 Ga0495609_0001009
936 Ga0495597_0000874
937 Ga0495597_0065004
938 Ga0495645_0009956
939 Ga0495633_0000244
940 Ga0495633_0000334
941 Ga0495633_0000433
942 Ga0495633_0020963
943 Ga0495633_0075304
944 Ga0495656_0008575
945 Ga0495668_0000241
946 Ga0495668_0001687
947 Ga0495611_0001508
948 Ga0495625_0001881
949 Ga0495625_0014730
950 Ga0495625_0026803
951 Ga0495659_0000461
952 Ga0495661_0010477
953 Ga0495646_0012603
954 Ga0495658_0002829
955 Ga0495613_0041193
956 Ga0495671_0000006
957 Ga0495671_0001937
958 Ga0495636_0000252
959 Ga0495672_0000159
960 Ga0495672_0031972
961 Ga0495683_0004311
962 Ga0495687_000281
963 Ga0495687_001598
964 Ga0495677_0000230
965 Ga0495679_011288
966 Ga0495685_000057
967 Ga0495673_0000003
968 Ga0495673_0000061
969 Ga0495686_0000321
970 Ga0495686_0026700
971 Ga0495626_0005215
972 Ga0495626_0008949
973 Ga0496100_0087502
974 Ga0496102_0018236
975 Ga0496103_0023805
976 Ga0496106_0035810
977 Ga0496108_0092792
978 Ga0496109_0025707
979 Ga0496109_0035756
980 Ga0496110_0025065
981 Ga0496112_0003280
982 Ga0496114_0201639
983 Ga0496114_0299524
984 Ga0496116_0007298
985 Ga0496117_0000001
986 Ga0496118_0000002
987 Ga0496121_0000684
988 Ga0496121_0003774
989 Ga0496121_0015920
990 Ga0496122_0000701
991 Ga0496122_0003287
992 Ga0496122_0009086
993 Ga0496123_0004113
994 Ga0496124_0020891
995 Ga0496124_0087729
996 Ga0496125_0040163
997 Ga0496125_0054590
998 Ga0495678_000905
999 Ga0495678_001619
1000 Ga0495678_004565
1001 Ga0495682_0000408
1002 Ga0501072_0006553
1003 Ga0501073_0018946
1004 Ga0501080_0003752
1005 Ga0501269_000655
1006 Ga0501035_0002263
1007 Ga0501035_0004536
1008 Ga0501044_0005080
1009 nmdc:mga08y16_95476_c1
1010 Ga0500618_000543
1011 Ga0500586_000310
1012 Ga0500622_0000011
1013 Ga0500661_010238
1014 2511250586
1015 2511387923
1016 2521560650
1017 2550697254
1018 2553008016
1019 2599907278
1020 2601667734
1021 2643863975
1022 2643982509
1023 2644026681
1024 2644121481
1025 2644249707
1026 2644356275
1027 2738739080
1028 2738830184
1029 2738846313
1030 2739153980
1031 2739195900
1032 2739275038
1033 2739322376
1034 2739340617
1035 2739344082
1036 2765571898
1037 2808982103
1038 2809034621
1039 2809130096
1040 2809148849
1041 2819542493
1042 2819595332
1043 2819618821
1044 2839098378
1045 2842712649
1046 2852618982
1047 2857541785
1048 2857544339
1049 2857550237
1050 2857561019
1051 2857568459
1052 2858953723
1053 2884839282
1054 2884856908
1055 2885086288
1056 2891092835
1057 2896158254
1058 2904425451
1059 2904442968
1060 2904534824
1061 2904588847
1062 2904594080
1063 2904605076
1064 2919048525
1065 2919083308
1066 2919477297
1067 2923514457
1068 2928133165
1069 2932411347
1070 2932419086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

44

332

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5092 47 351
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5068 46 362
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5034 47 351
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4889 46 362
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.2753 11 351
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7213 51 349 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.69 48 346 1.10.3470.10
af_P0AFS1_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6852 51 346 1.10.3470.10
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6832 51 349 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6812 48 346 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A838LSL8-F1-model_v4 Urea ABC transporter permease subunit UrtC 0.9406 12 362 GO:0005886
GO:0015658
AF-N6YWJ7-F1-model_v4 Urea ABC transporter permease UrtC 0.9388 12 362 GO:0005886
GO:0015658
AF-A0A1F3C9V3-F1-model_v4 Urea ABC transporter permease subunit UrtC 0.9374 15 367 GO:0005886
GO:0015658
AF-A0A261TAT8-F1-model_v4 Urea ABC transporter permease subunit UrtC 0.9358 4 362 GO:0005886
GO:0015658
AF-A0A5C5SFS0-F1-model_v4 Urea ABC transporter permease subunit UrtC 0.934 9 362 GO:0005886
GO:0015658

Map