F460705

General Info

Members Datasets Scaffolds Average Seq Length
535 265 1070 277

Family's Representative Sequence

Representative Sequence 3300046513|Ga0495616_0000009|Ga0495616_0000009_119635_120543
Length 302
Sequence MGGLGLTEAEAQAAAEQERVSEAIEHGRYAIRVRGLRTSFGEQVVHEGLDIDVRKGEILGVVGGSGTGKSVLMRAIIGLQTPDEGEVEVFGESMVGRSDSDAVAIRKRWGVLFQGGALFSTLTVAENVEVPLREFYPNIGPQLRDEIAAYKIRMTGLPAEAGPKYPSELSGGMRKRAGLARALAIDPDLLFLDEPTAGLDPIGAAAFDDQTRKLQQTLGLTIFLITHDLDTLYSICDRVAVLADKKVIAVGTIDELLAMDHPWIQEYFNGPRARAAVAAQDRIKTTASKRKHEMDGDRPGGQ

Samples

Sample ID Description Type Environment
1 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
154 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
155 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
172 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
218 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
219 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
220 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
221 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
222 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
223 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
224 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
229 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
230 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
231 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
232 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
233 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
234 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
235 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
240 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
241 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
242 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
243 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
244 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
245 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
246 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
247 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
248 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
249 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
250 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
251 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
252 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
253 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
254 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
255 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
256 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
257 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
258 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
259 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
260 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
261 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
262 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
263 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
264 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
265 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.45
Metatranscriptomes 0
Isolates 3.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 9.72
Nodule 0
Rhizoplane 6.17
Rhizosphere 75.51
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495616_0000009 3300046513 Bacteria 225502
2 SwRhRL2b_contig_1336727 2162886007 Bacteria 4663
3 JGI24736J21556_1000034 3300001904 Bacteria 23064
4 JGI24736J21556_1000240 3300001904 Bacteria 9967
5 JGI24741J21665_1000209 3300001915 Bacteria 17448
6 JGI24752J21851_1000458 3300001976 Bacteria 5505
7 JGI24740J21852_10004585 3300001979 Bacteria 5941
8 JGI24739J22299_10005243 3300001989 Bacteria 4938
9 JGI24739J22299_10013804 3300001989 Bacteria 2945
10 JGI24737J22298_10003512 3300001990 Bacteria 5530
11 JGI24737J22298_10003586 3300001990 Bacteria 5474
12 JGI24737J22298_10006468 3300001990 Bacteria 4002
13 JGI24737J22298_10008075 3300001990 Bacteria 3537
14 JGI24735J21928_10001832 3300002067 Bacteria 7459
15 JGI24735J21928_10005147 3300002067 Bacteria 4351
16 JGI24735J21928_10046775 3300002067 Bacteria 1255
17 JGI24750J21931_1001148 3300002070 Bacteria 3401
18 JGI24748J21848_1000034 3300002074 Bacteria 74812
19 JGI24738J21930_10000114 3300002075 Bacteria 18967
20 JGI24738J21930_10001923 3300002075 Bacteria 5607
21 JGI24749J21850_1000890 3300002076 Bacteria 4305
22 JGI24749J21850_1001907 3300002076 Bacteria 2945
23 JGI24749J21850_1012930 3300002076 Bacteria 1171
24 JGI24035J26624_1000947 3300002126 Bacteria 2738
25 JGI24034J26672_10000018 3300002239 Bacteria 130180
26 JGI24742J22300_10005821 3300002244 Bacteria 2030
27 JGI24751J29686_10000752 3300002459 Bacteria 7718
28 JGI25153J46596_10000172 3300003215 Bacteria 64551
29 Ga0055525_1000123 3300003759 Bacteria 118289
30 Ga0055542_1001046 3300003762 Bacteria 17216
31 Ga0055529_1000186 3300003763 Bacteria 85165
32 Ga0055526_1000345 3300003771 Bacteria 38081
33 Ga0055537_1001256 3300003773 Bacteria 10590
34 Ga0055530_10000278 3300003791 Bacteria 46428
35 Ga0055531_10000094 3300003794 Bacteria 96266
36 Ga0065165_1002026 3300005262 Bacteria 18863
37 Ga0065165_1011279 3300005262 Bacteria 3751
38 Ga0065704_10001525 3300005289 Bacteria 16513
39 Ga0065704_10002970 3300005289 Bacteria 8928
40 Ga0065707_10100442 3300005295 Bacteria 2929
41 Ga0070658_10000235 3300005327 Bacteria 48982
42 Ga0070658_10000642 3300005327 Bacteria 30161
43 Ga0070658_10012042 3300005327 Bacteria 6947
44 Ga0070676_10122938 3300005328 Bacteria 1631
45 Ga0070690_100000008 3300005330 Bacteria 118441
46 Ga0070670_100000024 3300005331 Bacteria 189811
47 Ga0070670_100000280 3300005331 Bacteria 44818
48 Ga0070670_100007537 3300005331 Bacteria 9237
49 Ga0070670_100011886 3300005331 Bacteria 7445
50 Ga0070670_100030553 3300005331 Bacteria 4639
51 Ga0070666_10000032 3300005335 Bacteria 129142
52 Ga0070666_10000090 3300005335 Bacteria 64025
53 Ga0070666_10005661 3300005335 Bacteria 7670
54 Ga0070660_100001181 3300005339 Bacteria 17678
55 Ga0070661_100028489 3300005344 Bacteria 4029
56 Ga0070661_100107640 3300005344 Bacteria 2079
57 Ga0070668_100000015 3300005347 Bacteria 106650
58 Ga0070668_100000353 3300005347 Bacteria 30383
59 Ga0070668_100031804 3300005347 Bacteria 4015
60 Ga0070668_100286270 3300005347 Bacteria 1378
61 Ga0070669_100000024 3300005353 Bacteria 173107
62 Ga0070669_100000031 3300005353 Bacteria 154042
63 Ga0070669_100000211 3300005353 Bacteria 48717
64 Ga0070669_100031234 3300005353 Bacteria 3847
65 Ga0070669_100047678 3300005353 Bacteria 3125
66 Ga0070671_100000006 3300005355 Bacteria 250635
67 Ga0070671_100000382 3300005355 Bacteria 30575
68 Ga0070674_100023682 3300005356 Bacteria 3977
69 Ga0070688_100000278 3300005365 Bacteria 26547
70 Ga0070659_100059733 3300005366 Bacteria 3010
71 Ga0070659_100195794 3300005366 Bacteria 1662
72 Ga0070667_100000017 3300005367 Bacteria 230531
73 Ga0070667_100000423 3300005367 Bacteria 44812
74 Ga0070667_100000754 3300005367 Bacteria 30851
75 Ga0070667_100001630 3300005367 Bacteria 20097
76 Ga0070667_100004568 3300005367 Bacteria 11627
77 Ga0070705_100005700 3300005440 Bacteria 6084
78 Ga0070663_100032518 3300005455 Bacteria 3596
79 Ga0070663_100293384 3300005455 Bacteria 1299
80 Ga0070662_100069745 3300005457 Bacteria 2588
81 Ga0070662_100252839 3300005457 Bacteria 1417
82 Ga0070681_10328050 3300005458 Bacteria 1440
83 Ga0070685_10000046 3300005466 Bacteria 73999
84 Ga0070679_100176638 3300005530 Bacteria 2108
85 Ga0068853_100035644 3300005539 Bacteria 4227
86 Ga0068853_100128084 3300005539 Bacteria 2269
87 Ga0070686_100000030 3300005544 Bacteria 118308
88 Ga0070665_100000056 3300005548 Bacteria 242622
89 Ga0070665_100018812 3300005548 Bacteria 6925
90 Ga0070665_100031495 3300005548 Bacteria 5338
91 Ga0070665_100071797 3300005548 Bacteria 3468
92 Ga0070665_100120603 3300005548 Bacteria 2624
93 Ga0070665_100169738 3300005548 Bacteria 2183
94 Ga0070665_100341693 3300005548 Bacteria 1502
95 Ga0068855_100201153 3300005563 Bacteria 2242
96 Ga0070664_100045432 3300005564 Bacteria 3709
97 Ga0070664_100087897 3300005564 Bacteria 2687
98 Ga0068857_100031949 3300005577 Bacteria 4653
99 Ga0068857_100165328 3300005577 Bacteria 2009
100 Ga0068854_100004487 3300005578 Bacteria 8800
101 Ga0068854_100262450 3300005578 Bacteria 1383
102 Ga0068854_100268186 3300005578 Bacteria 1369
103 Ga0068856_100056019 3300005614 Bacteria 3890
104 Ga0068859_100003670 3300005617 Bacteria 15635
105 Ga0068859_100014948 3300005617 Bacteria 7790
106 Ga0068859_100021467 3300005617 Bacteria 6481
107 Ga0068859_100027950 3300005617 Bacteria 5655
108 Ga0068864_100000036 3300005618 Bacteria 189811
109 Ga0068864_100000264 3300005618 Bacteria 46968
110 Ga0068864_100010323 3300005618 Bacteria 7713
111 Ga0068864_100016732 3300005618 Bacteria 6111
112 Ga0068861_100001546 3300005719 Bacteria 14602
113 Ga0068861_100015736 3300005719 Bacteria 5339
114 Ga0068861_100597167 3300005719 Bacteria 1013
115 Ga0068851_10024010 3300005834 Bacteria 2983
116 Ga0068851_10047014 3300005834 Bacteria 2184
117 Ga0068851_10059429 3300005834 Bacteria 1955
118 Ga0068863_100000065 3300005841 Bacteria 117925
119 Ga0068863_100000385 3300005841 Bacteria 44821
120 Ga0068863_100000413 3300005841 Bacteria 43520
121 Ga0068863_100003320 3300005841 Bacteria 15888
122 Ga0068863_100006106 3300005841 Bacteria 11817
123 Ga0068863_100104170 3300005841 Bacteria 2699
124 Ga0068858_100001965 3300005842 Bacteria 20997
125 Ga0068858_100003591 3300005842 Bacteria 15350
126 Ga0068858_100005370 3300005842 Bacteria 12561
127 Ga0068860_100000013 3300005843 Bacteria 323055
128 Ga0068860_100000056 3300005843 Bacteria 202751
129 Ga0068860_100000132 3300005843 Bacteria 120657
130 Ga0068860_100005375 3300005843 Bacteria 12994
131 Ga0068860_100009633 3300005843 Bacteria 9600
132 Ga0068862_100000043 3300005844 Bacteria 164356
133 Ga0068862_100000108 3300005844 Bacteria 99413
134 Ga0068862_100000307 3300005844 Bacteria 53788
135 Ga0068862_100000356 3300005844 Bacteria 49670
136 Ga0068862_100000398 3300005844 Bacteria 46968
137 Ga0081455_10000384 3300005937 Bacteria 58399
138 Ga0075369_10013598 3300006186 Bacteria 3235
139 Ga0075366_10004887 3300006195 Bacteria 7230
140 Ga0097620_100003670 3300006931 Bacteria 15635
141 Ga0097620_100014948 3300006931 Bacteria 7790
142 Ga0097620_100021468 3300006931 Bacteria 6481
143 Ga0097620_100027948 3300006931 Bacteria 5655
144 Ga0105251_10000522 3300009011 Bacteria 36283
145 Ga0105251_10045503 3300009011 Bacteria 2115
146 Ga0105240_10850711 3300009093 Bacteria 985
147 Ga0105247_10004401 3300009101 Bacteria 8986
148 Ga0105247_10184045 3300009101 Bacteria 1396
149 Ga0105241_10004233 3300009174 Bacteria 10601
150 Ga0105241_10265394 3300009174 Bacteria 1460
151 Ga0105248_10000029 3300009177 Bacteria 223366
152 Ga0105248_10000081 3300009177 Bacteria 111105
153 Ga0105248_10004302 3300009177 Bacteria 15754
154 Ga0105248_10086530 3300009177 Bacteria 3526
155 Ga0105237_10002833 3300009545 Bacteria 21101
156 Ga0105237_10041422 3300009545 Bacteria 4644
157 Ga0105238_10820007 3300009551 Bacteria 946
158 Ga0105249_10000024 3300009553 Bacteria 232947
159 Ga0105249_10000109 3300009553 Bacteria 112308
160 Ga0105249_10011660 3300009553 Bacteria 7730
161 Ga0105148_100012 3300009978 Bacteria 29563
162 Ga0105239_10031719 3300010375 Bacteria 5806
163 Ga0157326_1000023 3300012513 Bacteria 13548
164 Ga0157373_10026616 3300013100 Bacteria 4175
165 Ga0157373_10037158 3300013100 Bacteria 3493
166 Ga0157371_10007153 3300013102 Bacteria 9064
167 Ga0157370_10053454 3300013104 Bacteria 3851
168 Ga0157370_10074621 3300013104 Bacteria 3199
169 Ga0157370_10142184 3300013104 Bacteria 2236
170 Ga0157369_10079446 3300013105 Bacteria 3513
171 Ga0157378_10023445 3300013297 Bacteria 5432
172 Ga0163162_10009197 3300013306 Bacteria 9617
173 Ga0163162_10039501 3300013306 Bacteria 4716
174 Ga0163163_10022162 3300014325 Bacteria 6009
175 Ga0157380_10000193 3300014326 Bacteria 35569
176 Ga0157380_10065351 3300014326 Bacteria 2924
177 Ga0157380_10075573 3300014326 Bacteria 2738
178 Ga0157379_10008054 3300014968 Bacteria 9149
179 Ga0183361_10979 3300016635 Bacteria 1396
180 Ga0163161_10000084 3300017792 Bacteria 93742
181 Ga0163161_10022238 3300017792 Bacteria 4463
182 Ga0207672_1000296 3300025223 Bacteria 6734
183 Ga0209147_101006 3300025229 Bacteria 12187
184 Ga0209563_100024 3300025230 Bacteria 601155
185 Ga0209646_1011523 3300025246 Bacteria 1368
186 Ga0209148_1000008 3300025254 Bacteria 1504371
187 Ga0209565_1000052 3300025263 Bacteria 212056
188 Ga0209455_1000002 3300025272 Bacteria 1505459
189 Ga0207673_1011475 3300025290 Bacteria 1147
190 Ga0209564_1000697 3300025295 Bacteria 49186
191 Ga0209758_1000007 3300025297 Bacteria 1270410
192 Ga0209050_1000071 3300025298 Bacteria 295478
193 Ga0209257_1000027 3300025304 Bacteria 703541
194 Ga0207697_10000244 3300025315 Bacteria 29795
195 Ga0207656_10001401 3300025321 Bacteria 7970
196 Ga0207656_10043373 3300025321 Bacteria 1918
197 Ga0207656_10059854 3300025321 Bacteria 1668
198 Ga0207713_1012760 3300025735 Bacteria 4469
199 Ga0207710_10095209 3300025900 Bacteria 1399
200 Ga0207710_10153901 3300025900 Bacteria 1117
201 Ga0207680_10000009 3300025903 Bacteria 464571
202 Ga0207680_10000439 3300025903 Bacteria 19657
203 Ga0207680_10203070 3300025903 Bacteria 1352
204 Ga0207680_10312007 3300025903 Bacteria 1098
205 Ga0207647_10000766 3300025904 Bacteria 25085
206 Ga0207647_10006491 3300025904 Bacteria 8498
207 Ga0207647_10030532 3300025904 Bacteria 3475
208 Ga0207645_10057406 3300025907 Bacteria 2485
209 Ga0207705_10000278 3300025909 Bacteria 48839
210 Ga0207705_10000407 3300025909 Bacteria 37762
211 Ga0207705_10021091 3300025909 Bacteria 4647
212 Ga0207654_10000868 3300025911 Bacteria 16743
213 Ga0207654_10002810 3300025911 Bacteria 8833
214 Ga0207695_10003070 3300025913 Bacteria 23930
215 Ga0207695_10083814 3300025913 Bacteria 3220
216 Ga0207671_10006894 3300025914 Bacteria 10023
217 Ga0207671_10227478 3300025914 Bacteria 1463
218 Ga0207671_10285287 3300025914 Bacteria 1303
219 Ga0207657_10000912 3300025919 Bacteria 31257
220 Ga0207657_10024247 3300025919 Bacteria 5626
221 Ga0207649_10003032 3300025920 Bacteria 9256
222 Ga0207649_10472577 3300025920 Bacteria 950
223 Ga0207681_10000004 3300025923 Bacteria 559005
224 Ga0207681_10000014 3300025923 Bacteria 353422
225 Ga0207681_10000965 3300025923 Bacteria 18765
226 Ga0207681_10009299 3300025923 Bacteria 6002
227 Ga0207681_10126107 3300025923 Bacteria 1885
228 Ga0207694_10001544 3300025924 Bacteria 19570
229 Ga0207694_10020339 3300025924 Bacteria 5020
230 Ga0207650_10000015 3300025925 Bacteria 369173
231 Ga0207650_10000162 3300025925 Bacteria 81071
232 Ga0207650_10001493 3300025925 Bacteria 16737
233 Ga0207650_10004421 3300025925 Bacteria 9604
234 Ga0207650_10250498 3300025925 Bacteria 1434
235 Ga0207644_10000009 3300025931 Bacteria 251643
236 Ga0207644_10000066 3300025931 Bacteria 76450
237 Ga0207644_10022796 3300025931 Bacteria 4280
238 Ga0207690_10000368 3300025932 Bacteria 29888
239 Ga0207690_10165335 3300025932 Bacteria 1653
240 Ga0207690_10166113 3300025932 Bacteria 1649
241 Ga0207706_10016796 3300025933 Bacteria 6606
242 Ga0207706_10154076 3300025933 Bacteria 2021
243 Ga0207711_10000004 3300025941 Bacteria 870636
244 Ga0207711_10003444 3300025941 Bacteria 13689
245 Ga0207711_10004477 3300025941 Bacteria 11910
246 Ga0207711_10016478 3300025941 Bacteria 6140
247 Ga0207711_10017539 3300025941 Bacteria 5946
248 Ga0207661_10652614 3300025944 Bacteria 967
249 Ga0207679_10106100 3300025945 Bacteria 2207
250 Ga0207679_10167122 3300025945 Bacteria 1807
251 Ga0207667_10000006 3300025949 Bacteria 679876
252 Ga0207667_10007311 3300025949 Bacteria 13302
253 Ga0207712_10000034 3300025961 Bacteria 202320
254 Ga0207712_10000046 3300025961 Bacteria 162468
255 Ga0207712_10008557 3300025961 Bacteria 6469
256 Ga0207668_10000012 3300025972 Bacteria 182541
257 Ga0207668_10000244 3300025972 Bacteria 36489
258 Ga0207668_10054806 3300025972 Bacteria 2769
259 Ga0207640_10012533 3300025981 Bacteria 4832
260 Ga0207640_10040666 3300025981 Bacteria 2951
261 Ga0207640_10171263 3300025981 Bacteria 1618
262 Ga0207658_10000011 3300025986 Bacteria 239620
263 Ga0207658_10000132 3300025986 Bacteria 80078
264 Ga0207658_10000436 3300025986 Bacteria 39447
265 Ga0207658_10000587 3300025986 Bacteria 32623
266 Ga0207658_10000784 3300025986 Bacteria 27123
267 Ga0207658_10004769 3300025986 Bacteria 9388
268 Ga0207658_10107414 3300025986 Bacteria 2199
269 Ga0207703_10000474 3300026035 Bacteria 42009
270 Ga0207703_10005251 3300026035 Bacteria 10446
271 Ga0207703_10006588 3300026035 Bacteria 9266
272 Ga0207703_10018154 3300026035 Bacteria 5495
273 Ga0207639_10000038 3300026041 Bacteria 145316
274 Ga0207639_10002008 3300026041 Bacteria 13705
275 Ga0207639_10026019 3300026041 Bacteria 4249
276 Ga0207639_10055383 3300026041 Bacteria 3035
277 Ga0207678_10000025 3300026067 Bacteria 119139
278 Ga0207678_10173214 3300026067 Bacteria 1842
279 Ga0207702_10000061 3300026078 Bacteria 125368
280 Ga0207702_10000369 3300026078 Bacteria 51295
281 Ga0207702_10001550 3300026078 Bacteria 22735
282 Ga0207702_10616343 3300026078 Bacteria 1065
283 Ga0207641_10000050 3300026088 Bacteria 175954
284 Ga0207641_10000063 3300026088 Bacteria 159283
285 Ga0207641_10000479 3300026088 Bacteria 45166
286 Ga0207641_10003880 3300026088 Bacteria 13083
287 Ga0207641_10011647 3300026088 Bacteria 7221
288 Ga0207641_10189022 3300026088 Bacteria 1891
289 Ga0207676_10000021 3300026095 Bacteria 296572
290 Ga0207676_10000036 3300026095 Bacteria 198447
291 Ga0207676_10003249 3300026095 Bacteria 11573
292 Ga0207676_10005078 3300026095 Bacteria 9310
293 Ga0207674_10014244 3300026116 Bacteria 8788
294 Ga0207674_10043138 3300026116 Bacteria 4653
295 Ga0207674_10063883 3300026116 Bacteria 3714
296 Ga0207674_10165923 3300026116 Bacteria 2162
297 Ga0207675_100000167 3300026118 Bacteria 58637
298 Ga0207675_100000199 3300026118 Bacteria 55487
299 Ga0207675_100008464 3300026118 Bacteria 9691
300 Ga0207675_100251498 3300026118 Bacteria 1711
301 Ga0207698_10000143 3300026142 Bacteria 45352
302 Ga0207698_10018372 3300026142 Bacteria 4762
303 Ga0207698_10077018 3300026142 Bacteria 2672
304 Ga0268266_10000036 3300028379 Bacteria 348910
305 Ga0268266_10000066 3300028379 Bacteria 242637
306 Ga0268266_10018119 3300028379 Bacteria 6003
307 Ga0268266_10021429 3300028379 Bacteria 5505
308 Ga0268266_10141574 3300028379 Bacteria 2159
309 Ga0268265_10000013 3300028380 Bacteria 341536
310 Ga0268265_10000109 3300028380 Bacteria 104063
311 Ga0268265_10000129 3300028380 Bacteria 96060
312 Ga0268265_10000386 3300028380 Bacteria 46975
313 Ga0268265_10000442 3300028380 Bacteria 43732
314 Ga0268264_10000039 3300028381 Bacteria 376641
315 Ga0268264_10000069 3300028381 Bacteria 270492
316 Ga0268264_10000089 3300028381 Bacteria 234760
317 Ga0268264_10000130 3300028381 Bacteria 181732
318 Ga0268264_10002280 3300028381 Bacteria 16989
319 Ga0307517_10103647 3300028786 Bacteria 2221
320 Ga0307408_100004512 3300031548 Bacteria 9439
321 Ga0307405_10000267 3300031731 Bacteria 19207
322 Ga0307405_10012902 3300031731 Bacteria 4442
323 Ga0307413_10057737 3300031824 Bacteria 2375
324 Ga0307406_10057921 3300031901 Bacteria 2487
325 Ga0307412_10000329 3300031911 Bacteria 30093
326 Ga0307412_10014862 3300031911 Bacteria 4601
327 Ga0307412_10052374 3300031911 Bacteria 2702
328 Ga0307412_10083641 3300031911 Bacteria 2213
329 Ga0307412_10459461 3300031911 Bacteria 1051
330 Ga0307409_100270504 3300031995 Bacteria 1564
331 Ga0307414_10000177 3300032004 Bacteria 43274
332 Ga0307411_10019196 3300032005 Bacteria 3944
333 Ga0307510_10003983 3300033180 Bacteria 17300
334 Ga0395899_0081060 3300037312 Bacteria 2362
335 Ga0237819_01101 3300038705 Bacteria 7913
336 Ga0237816_00448 3300039145 Bacteria 3502
337 Ga0450899_014416 3300042135 Bacteria 899
338 Ga0439434_0044101 3300042435 Bacteria 1373
339 Ga0451576_0000122 3300045051 Bacteria 197797
340 Ga0495617_011507 3300046452 Bacteria 3017
341 Ga0495627_000171 3300046453 Bacteria 74013
342 Ga0495627_000772 3300046453 Bacteria 23797
343 Ga0495638_0000029 3300046460 Bacteria 330201
344 Ga0495638_0146081 3300046460 Bacteria 1376
345 Ga0495650_0033905 3300046471 Bacteria 2266
346 Ga0495584_0017146 3300046491 Bacteria 3691
347 Ga0495607_0008697 3300046501 Bacteria 6920
348 Ga0495583_0000443 3300046506 Bacteria 62113
349 Ga0495583_0001690 3300046506 Bacteria 21347
350 Ga0495583_0003966 3300046506 Bacteria 10930
351 Ga0495583_0017346 3300046506 Bacteria 3825
352 Ga0495610_0000199 3300046512 Bacteria 67146
353 Ga0495616_0042612 3300046513 Bacteria 2310
354 Ga0495631_0013113 3300046518 Bacteria 4030
355 Ga0495632_0000070 3300046519 Bacteria 107264
356 Ga0495632_0000220 3300046519 Bacteria 58010
357 Ga0495637_0001042 3300046520 Bacteria 17378
358 Ga0495637_0003804 3300046520 Bacteria 7932
359 Ga0495643_0000010 3300046522 Bacteria 341431
360 Ga0495643_0014881 3300046522 Bacteria 4616
361 Ga0495643_0024007 3300046522 Bacteria 3461
362 Ga0495643_0155342 3300046522 Bacteria 1129
363 Ga0495648_0000020 3300046524 Bacteria 254330
364 Ga0495648_0000088 3300046524 Bacteria 115109
365 Ga0495648_0009631 3300046524 Bacteria 7453
366 Ga0495663_0000004 3300046525 Bacteria 355166
367 Ga0495663_0001067 3300046525 Bacteria 8944
368 Ga0495654_0000653 3300046530 Bacteria 27318
369 Ga0495597_0037278 3300046542 Bacteria 2184
370 Ga0495633_0000105 3300046558 Bacteria 113385
371 Ga0495633_0000243 3300046558 Bacteria 66073
372 Ga0495633_0000298 3300046558 Bacteria 56626
373 Ga0495633_0014875 3300046558 Bacteria 4049
374 Ga0495633_0034408 3300046558 Bacteria 2437
375 Ga0495633_0035493 3300046558 Bacteria 2393
376 Ga0495668_0000013 3300046616 Bacteria 452938
377 Ga0495668_0000801 3300046616 Bacteria 36223
378 Ga0495668_0003290 3300046616 Bacteria 12251
379 Ga0495668_0067575 3300046616 Bacteria 1966
380 Ga0495625_0012573 3300046660 Bacteria 6851
381 Ga0495625_0020830 3300046660 Bacteria 5055
382 Ga0495625_0065267 3300046660 Bacteria 2566
383 Ga0495625_0088189 3300046660 Bacteria 2150
384 Ga0495625_0133257 3300046660 Bacteria 1682
385 Ga0495669_0000100 3300046684 Bacteria 53888
386 Ga0495671_0000014 3300046692 Bacteria 341431
387 Ga0495671_0000022 3300046692 Bacteria 255591
388 Ga0495671_0005608 3300046692 Bacteria 7325
389 Ga0495671_0050077 3300046692 Bacteria 2081
390 Ga0495649_0026859 3300046694 Bacteria 3197
391 Ga0495660_0039553 3300046810 Bacteria 2619
392 Ga0495660_0055947 3300046810 Bacteria 2134
393 Ga0495683_0008871 3300047323 Bacteria 5365
394 Ga0495687_000084 3300047443 Bacteria 145072
395 Ga0495687_001113 3300047443 Bacteria 26128
396 Ga0495677_0001119 3300047445 Bacteria 10726
397 Ga0495673_0000051 3300047469 Bacteria 255511
398 Ga0495673_0013485 3300047469 Bacteria 4289
399 Ga0495681_0000038 3300047470 Bacteria 121100
400 Ga0495681_0001060 3300047470 Bacteria 20987
401 Ga0495686_0005685 3300047472 Bacteria 9753
402 Ga0496100_0187093 3300048903 Bacteria 1501
403 Ga0496102_0000066 3300048905 Bacteria 159020
404 Ga0496103_0000102 3300048906 Bacteria 93559
405 Ga0496103_0000788 3300048906 Bacteria 23326
406 Ga0496103_0037091 3300048906 Bacteria 2987
407 Ga0496103_0080501 3300048906 Bacteria 2048
408 Ga0496103_0116256 3300048906 Bacteria 1702
409 Ga0496104_0000195 3300048907 Bacteria 54198
410 Ga0496104_0015550 3300048907 Bacteria 6893
411 Ga0496104_0034967 3300048907 Bacteria 4689
412 Ga0496104_0047564 3300048907 Bacteria 4043
413 Ga0496105_0000068 3300048908 Bacteria 82800
414 Ga0496105_0001485 3300048908 Bacteria 16550
415 Ga0496105_0026161 3300048908 Bacteria 4757
416 Ga0496105_0055349 3300048908 Bacteria 3275
417 Ga0496108_0000725 3300048911 Bacteria 25619
418 Ga0496108_0158509 3300048911 Bacteria 1955
419 Ga0496108_0194486 3300048911 Bacteria 1759
420 Ga0496109_0032677 3300048912 Bacteria 4679
421 Ga0496109_0223058 3300048912 Bacteria 1773
422 Ga0496110_0013580 3300048913 Bacteria 6741
423 Ga0496110_0059928 3300048913 Bacteria 3356
424 Ga0496110_0235932 3300048913 Bacteria 1664
425 Ga0496110_0414542 3300048913 Bacteria 1228
426 Ga0496111_0194946 3300048914 Bacteria 1506
427 Ga0496111_0457204 3300048914 Bacteria 942
428 Ga0496112_0055600 3300048915 Bacteria 3892
429 Ga0496113_0020585 3300048916 Bacteria 4640
430 Ga0496113_0031371 3300048916 Bacteria 3857
431 Ga0496113_0335074 3300048916 Bacteria 1213
432 Ga0496115_0000054 3300048918 Bacteria 106423
433 Ga0496115_0013256 3300048918 Bacteria 6230
434 Ga0496116_0011493 3300048919 Bacteria 7319
435 Ga0496116_0016006 3300048919 Bacteria 5895
436 Ga0496117_0000225 3300048920 Bacteria 106485
437 Ga0496117_0002815 3300048920 Bacteria 21183
438 Ga0496117_0010678 3300048920 Bacteria 8316
439 Ga0496118_0000197 3300048921 Bacteria 106272
440 Ga0496118_0000335 3300048921 Bacteria 80253
441 Ga0496118_0008568 3300048921 Bacteria 10533
442 Ga0496119_0004407 3300048922 Bacteria 14034
443 Ga0496119_0016884 3300048922 Bacteria 5523
444 Ga0496119_0074140 3300048922 Bacteria 1983
445 Ga0496120_0197174 3300048923 Bacteria 977
446 Ga0496121_0000279 3300048924 Bacteria 106475
447 Ga0496121_0002204 3300048924 Bacteria 30425
448 Ga0496121_0032293 3300048924 Bacteria 4763
449 Ga0496122_0000385 3300048925 Bacteria 94046
450 Ga0496122_0016743 3300048925 Bacteria 6908
451 Ga0496122_0018852 3300048925 Bacteria 6342
452 Ga0496122_0089210 3300048925 Bacteria 2109
453 Ga0496123_0000220 3300048926 Bacteria 115824
454 Ga0496123_0029267 3300048926 Bacteria 4060
455 Ga0496123_0227987 3300048926 Bacteria 935
456 Ga0496124_0000240 3300048927 Bacteria 106486
457 Ga0496124_0002381 3300048927 Bacteria 24765
458 Ga0496124_0011196 3300048927 Bacteria 8993
459 Ga0496124_0163674 3300048927 Bacteria 1731
460 Ga0496125_0017360 3300048928 Bacteria 6865
461 Ga0496125_0025306 3300048928 Bacteria 5438
462 Ga0496125_0059236 3300048928 Bacteria 3087
463 Ga0496126_0000295 3300048929 Bacteria 106266
464 Ga0496126_0007550 3300048929 Bacteria 11893
465 Ga0496126_0079587 3300048929 Bacteria 2901
466 Ga0501034_0208524 3300049571 Bacteria 1910
467 Ga0501036_0243546 3300049572 Bacteria 1508
468 Ga0501039_0132163 3300049575 Unclassified 1959
469 Ga0501043_0023322 3300049579 Bacteria 4853
470 Ga0501046_0045393 3300049580 Bacteria 3492
471 Ga0501047_0009300 3300049581 Bacteria 9281
472 Ga0501048_0021911 3300049582 Bacteria 4677
473 Ga0501223_000016 3300049663 Bacteria 68443
474 Ga0501223_000079 3300049663 Bacteria 29419
475 Ga0501224_000001 3300049664 Bacteria 308131
476 Ga0501233_003902 3300049668 Bacteria 2702
477 Ga0501235_002098 3300049669 Bacteria 4284
478 Ga0501235_004555 3300049669 Bacteria 2995
479 Ga0501246_000351 3300049676 Bacteria 3251
480 Ga0501257_000048 3300049686 Bacteria 33778
481 Ga0501225_0000013 3300049705 Bacteria 71839
482 Ga0501225_0000547 3300049705 Bacteria 11747
483 Ga0501280_003313 3300049776 Bacteria 2495
484 Ga0501044_0076524 3300049823 Bacteria 3396
485 Ga0501226_000047 3300049853 Bacteria 54518
486 nmdc:mga0k408_20023_c1 3300050493 Bacteria 3744
487 Ga0500610_0000043 3300053079 Bacteria 41402
488 Ga0500643_000225 3300053087 Bacteria 52825
489 Ga0500643_000788 3300053087 Bacteria 20556
490 Ga0500643_002877 3300053087 Bacteria 8576
491 Ga0500643_003694 3300053087 Bacteria 7214
492 Ga0500643_007158 3300053087 Bacteria 4559
493 Ga0500643_008869 3300053087 Bacteria 3903
494 Ga0500644_0046414 3300053088 Bacteria 1469
495 Ga0500644_0091119 3300053088 Bacteria 1141
496 Ga0500566_0000089 3300053094 Bacteria 45622
497 Ga0500562_001944 3300053108 Bacteria 5181
498 Ga0500592_000617 3300053116 Bacteria 5821
499 Ga0500595_000642 3300053119 Bacteria 20986
500 Ga0500642_0049588 3300053130 Bacteria 1848
501 Ga0500658_0002625 3300053134 Bacteria 6919
502 Ga0500658_0007261 3300053134 Bacteria 4092
503 Ga0500658_0162224 3300053134 Bacteria 1012
504 Ga0500559_0002244 3300053136 Bacteria 10206
505 Ga0500559_0002376 3300053136 Bacteria 9811
506 Ga0500568_0006051 3300053139 Bacteria 6141
507 Ga0500604_0012033 3300053151 Bacteria 2332
508 Ga0500604_0054156 3300053151 Bacteria 1245
509 Ga0500624_000011 3300053157 Bacteria 168125
510 Ga0500627_0000150 3300053158 Bacteria 20535
511 Ga0500627_0002804 3300053158 Bacteria 5248
512 Ga0500636_0004435 3300053177 Bacteria 7942
513 Ga0500611_010089 3300053727 Bacteria 1519
514 Ga0500645_000192 3300053730 Bacteria 47665
515 Ga0500596_008407 3300053735 Bacteria 1647
516 Ga0500661_000955 3300055283 Bacteria 5410
517 2512641649 2512564014 Bacteria 4639632
518 2600203936 2599185354 Bacteria 4398675
519 2644040364 2643221605 Bacteria 4772303
520 2644127542 2643221622 Bacteria 4212502
521 2778125612 2775507255 Bacteria 3945731
522 2809063547 2808606401 Bacteria 4586670
523 2809079482 2808606404 Bacteria 4652788
524 2809083880 2808606405 Bacteria 4586632
525 2819715293 2818991466 Bacteria 4748179
526 2880521055 2880518877 Bacteria 5012590
527 2885432785 2885429604 Bacteria 3642894
528 2919711970 2919709256 Bacteria 4318106
529 2928030682 2928027323 Bacteria 4382488
530 2928972496 2928968154 Bacteria 4633371
531 2946789771 2946787523 Bacteria 4366789
532 2984557194 2984555340 Bacteria 4247089
533 2984568443 2984564862 Bacteria 4339992
534 2993359490 2993356040 Bacteria 4247105
535 8057102041 8057101203 Bacteria 5034064
536 Ga0495616_0000009
537 SwRhRL2b_contig_1336727
538 JGI24736J21556_1000034
539 JGI24736J21556_1000240
540 JGI24741J21665_1000209
541 JGI24752J21851_1000458
542 JGI24740J21852_10004585
543 JGI24739J22299_10005243
544 JGI24739J22299_10013804
545 JGI24737J22298_10003512
546 JGI24737J22298_10003586
547 JGI24737J22298_10006468
548 JGI24737J22298_10008075
549 JGI24735J21928_10001832
550 JGI24735J21928_10005147
551 JGI24735J21928_10046775
552 JGI24750J21931_1001148
553 JGI24748J21848_1000034
554 JGI24738J21930_10000114
555 JGI24738J21930_10001923
556 JGI24749J21850_1000890
557 JGI24749J21850_1001907
558 JGI24749J21850_1012930
559 JGI24035J26624_1000947
560 JGI24034J26672_10000018
561 JGI24742J22300_10005821
562 JGI24751J29686_10000752
563 JGI25153J46596_10000172
564 Ga0055525_1000123
565 Ga0055542_1001046
566 Ga0055529_1000186
567 Ga0055526_1000345
568 Ga0055537_1001256
569 Ga0055530_10000278
570 Ga0055531_10000094
571 Ga0065165_1002026
572 Ga0065165_1011279
573 Ga0065704_10001525
574 Ga0065704_10002970
575 Ga0065707_10100442
576 Ga0070658_10000235
577 Ga0070658_10000642
578 Ga0070658_10012042
579 Ga0070676_10122938
580 Ga0070690_100000008
581 Ga0070670_100000024
582 Ga0070670_100000280
583 Ga0070670_100007537
584 Ga0070670_100011886
585 Ga0070670_100030553
586 Ga0070666_10000032
587 Ga0070666_10000090
588 Ga0070666_10005661
589 Ga0070660_100001181
590 Ga0070661_100028489
591 Ga0070661_100107640
592 Ga0070668_100000015
593 Ga0070668_100000353
594 Ga0070668_100031804
595 Ga0070668_100286270
596 Ga0070669_100000024
597 Ga0070669_100000031
598 Ga0070669_100000211
599 Ga0070669_100031234
600 Ga0070669_100047678
601 Ga0070671_100000006
602 Ga0070671_100000382
603 Ga0070674_100023682
604 Ga0070688_100000278
605 Ga0070659_100059733
606 Ga0070659_100195794
607 Ga0070667_100000017
608 Ga0070667_100000423
609 Ga0070667_100000754
610 Ga0070667_100001630
611 Ga0070667_100004568
612 Ga0070705_100005700
613 Ga0070663_100032518
614 Ga0070663_100293384
615 Ga0070662_100069745
616 Ga0070662_100252839
617 Ga0070681_10328050
618 Ga0070685_10000046
619 Ga0070679_100176638
620 Ga0068853_100035644
621 Ga0068853_100128084
622 Ga0070686_100000030
623 Ga0070665_100000056
624 Ga0070665_100018812
625 Ga0070665_100031495
626 Ga0070665_100071797
627 Ga0070665_100120603
628 Ga0070665_100169738
629 Ga0070665_100341693
630 Ga0068855_100201153
631 Ga0070664_100045432
632 Ga0070664_100087897
633 Ga0068857_100031949
634 Ga0068857_100165328
635 Ga0068854_100004487
636 Ga0068854_100262450
637 Ga0068854_100268186
638 Ga0068856_100056019
639 Ga0068859_100003670
640 Ga0068859_100014948
641 Ga0068859_100021467
642 Ga0068859_100027950
643 Ga0068864_100000036
644 Ga0068864_100000264
645 Ga0068864_100010323
646 Ga0068864_100016732
647 Ga0068861_100001546
648 Ga0068861_100015736
649 Ga0068861_100597167
650 Ga0068851_10024010
651 Ga0068851_10047014
652 Ga0068851_10059429
653 Ga0068863_100000065
654 Ga0068863_100000385
655 Ga0068863_100000413
656 Ga0068863_100003320
657 Ga0068863_100006106
658 Ga0068863_100104170
659 Ga0068858_100001965
660 Ga0068858_100003591
661 Ga0068858_100005370
662 Ga0068860_100000013
663 Ga0068860_100000056
664 Ga0068860_100000132
665 Ga0068860_100005375
666 Ga0068860_100009633
667 Ga0068862_100000043
668 Ga0068862_100000108
669 Ga0068862_100000307
670 Ga0068862_100000356
671 Ga0068862_100000398
672 Ga0081455_10000384
673 Ga0075369_10013598
674 Ga0075366_10004887
675 Ga0097620_100003670
676 Ga0097620_100014948
677 Ga0097620_100021468
678 Ga0097620_100027948
679 Ga0105251_10000522
680 Ga0105251_10045503
681 Ga0105240_10850711
682 Ga0105247_10004401
683 Ga0105247_10184045
684 Ga0105241_10004233
685 Ga0105241_10265394
686 Ga0105248_10000029
687 Ga0105248_10000081
688 Ga0105248_10004302
689 Ga0105248_10086530
690 Ga0105237_10002833
691 Ga0105237_10041422
692 Ga0105238_10820007
693 Ga0105249_10000024
694 Ga0105249_10000109
695 Ga0105249_10011660
696 Ga0105148_100012
697 Ga0105239_10031719
698 Ga0157326_1000023
699 Ga0157373_10026616
700 Ga0157373_10037158
701 Ga0157371_10007153
702 Ga0157370_10053454
703 Ga0157370_10074621
704 Ga0157370_10142184
705 Ga0157369_10079446
706 Ga0157378_10023445
707 Ga0163162_10009197
708 Ga0163162_10039501
709 Ga0163163_10022162
710 Ga0157380_10000193
711 Ga0157380_10065351
712 Ga0157380_10075573
713 Ga0157379_10008054
714 Ga0183361_10979
715 Ga0163161_10000084
716 Ga0163161_10022238
717 Ga0207672_1000296
718 Ga0209147_101006
719 Ga0209563_100024
720 Ga0209646_1011523
721 Ga0209148_1000008
722 Ga0209565_1000052
723 Ga0209455_1000002
724 Ga0207673_1011475
725 Ga0209564_1000697
726 Ga0209758_1000007
727 Ga0209050_1000071
728 Ga0209257_1000027
729 Ga0207697_10000244
730 Ga0207656_10001401
731 Ga0207656_10043373
732 Ga0207656_10059854
733 Ga0207713_1012760
734 Ga0207710_10095209
735 Ga0207710_10153901
736 Ga0207680_10000009
737 Ga0207680_10000439
738 Ga0207680_10203070
739 Ga0207680_10312007
740 Ga0207647_10000766
741 Ga0207647_10006491
742 Ga0207647_10030532
743 Ga0207645_10057406
744 Ga0207705_10000278
745 Ga0207705_10000407
746 Ga0207705_10021091
747 Ga0207654_10000868
748 Ga0207654_10002810
749 Ga0207695_10003070
750 Ga0207695_10083814
751 Ga0207671_10006894
752 Ga0207671_10227478
753 Ga0207671_10285287
754 Ga0207657_10000912
755 Ga0207657_10024247
756 Ga0207649_10003032
757 Ga0207649_10472577
758 Ga0207681_10000004
759 Ga0207681_10000014
760 Ga0207681_10000965
761 Ga0207681_10009299
762 Ga0207681_10126107
763 Ga0207694_10001544
764 Ga0207694_10020339
765 Ga0207650_10000015
766 Ga0207650_10000162
767 Ga0207650_10001493
768 Ga0207650_10004421
769 Ga0207650_10250498
770 Ga0207644_10000009
771 Ga0207644_10000066
772 Ga0207644_10022796
773 Ga0207690_10000368
774 Ga0207690_10165335
775 Ga0207690_10166113
776 Ga0207706_10016796
777 Ga0207706_10154076
778 Ga0207711_10000004
779 Ga0207711_10003444
780 Ga0207711_10004477
781 Ga0207711_10016478
782 Ga0207711_10017539
783 Ga0207661_10652614
784 Ga0207679_10106100
785 Ga0207679_10167122
786 Ga0207667_10000006
787 Ga0207667_10007311
788 Ga0207712_10000034
789 Ga0207712_10000046
790 Ga0207712_10008557
791 Ga0207668_10000012
792 Ga0207668_10000244
793 Ga0207668_10054806
794 Ga0207640_10012533
795 Ga0207640_10040666
796 Ga0207640_10171263
797 Ga0207658_10000011
798 Ga0207658_10000132
799 Ga0207658_10000436
800 Ga0207658_10000587
801 Ga0207658_10000784
802 Ga0207658_10004769
803 Ga0207658_10107414
804 Ga0207703_10000474
805 Ga0207703_10005251
806 Ga0207703_10006588
807 Ga0207703_10018154
808 Ga0207639_10000038
809 Ga0207639_10002008
810 Ga0207639_10026019
811 Ga0207639_10055383
812 Ga0207678_10000025
813 Ga0207678_10173214
814 Ga0207702_10000061
815 Ga0207702_10000369
816 Ga0207702_10001550
817 Ga0207702_10616343
818 Ga0207641_10000050
819 Ga0207641_10000063
820 Ga0207641_10000479
821 Ga0207641_10003880
822 Ga0207641_10011647
823 Ga0207641_10189022
824 Ga0207676_10000021
825 Ga0207676_10000036
826 Ga0207676_10003249
827 Ga0207676_10005078
828 Ga0207674_10014244
829 Ga0207674_10043138
830 Ga0207674_10063883
831 Ga0207674_10165923
832 Ga0207675_100000167
833 Ga0207675_100000199
834 Ga0207675_100008464
835 Ga0207675_100251498
836 Ga0207698_10000143
837 Ga0207698_10018372
838 Ga0207698_10077018
839 Ga0268266_10000036
840 Ga0268266_10000066
841 Ga0268266_10018119
842 Ga0268266_10021429
843 Ga0268266_10141574
844 Ga0268265_10000013
845 Ga0268265_10000109
846 Ga0268265_10000129
847 Ga0268265_10000386
848 Ga0268265_10000442
849 Ga0268264_10000039
850 Ga0268264_10000069
851 Ga0268264_10000089
852 Ga0268264_10000130
853 Ga0268264_10002280
854 Ga0307517_10103647
855 Ga0307408_100004512
856 Ga0307405_10000267
857 Ga0307405_10012902
858 Ga0307413_10057737
859 Ga0307406_10057921
860 Ga0307412_10000329
861 Ga0307412_10014862
862 Ga0307412_10052374
863 Ga0307412_10083641
864 Ga0307412_10459461
865 Ga0307409_100270504
866 Ga0307414_10000177
867 Ga0307411_10019196
868 Ga0307510_10003983
869 Ga0395899_0081060
870 Ga0237819_01101
871 Ga0237816_00448
872 Ga0450899_014416
873 Ga0439434_0044101
874 Ga0451576_0000122
875 Ga0495617_011507
876 Ga0495627_000171
877 Ga0495627_000772
878 Ga0495638_0000029
879 Ga0495638_0146081
880 Ga0495650_0033905
881 Ga0495584_0017146
882 Ga0495607_0008697
883 Ga0495583_0000443
884 Ga0495583_0001690
885 Ga0495583_0003966
886 Ga0495583_0017346
887 Ga0495610_0000199
888 Ga0495616_0042612
889 Ga0495631_0013113
890 Ga0495632_0000070
891 Ga0495632_0000220
892 Ga0495637_0001042
893 Ga0495637_0003804
894 Ga0495643_0000010
895 Ga0495643_0014881
896 Ga0495643_0024007
897 Ga0495643_0155342
898 Ga0495648_0000020
899 Ga0495648_0000088
900 Ga0495648_0009631
901 Ga0495663_0000004
902 Ga0495663_0001067
903 Ga0495654_0000653
904 Ga0495597_0037278
905 Ga0495633_0000105
906 Ga0495633_0000243
907 Ga0495633_0000298
908 Ga0495633_0014875
909 Ga0495633_0034408
910 Ga0495633_0035493
911 Ga0495668_0000013
912 Ga0495668_0000801
913 Ga0495668_0003290
914 Ga0495668_0067575
915 Ga0495625_0012573
916 Ga0495625_0020830
917 Ga0495625_0065267
918 Ga0495625_0088189
919 Ga0495625_0133257
920 Ga0495669_0000100
921 Ga0495671_0000014
922 Ga0495671_0000022
923 Ga0495671_0005608
924 Ga0495671_0050077
925 Ga0495649_0026859
926 Ga0495660_0039553
927 Ga0495660_0055947
928 Ga0495683_0008871
929 Ga0495687_000084
930 Ga0495687_001113
931 Ga0495677_0001119
932 Ga0495673_0000051
933 Ga0495673_0013485
934 Ga0495681_0000038
935 Ga0495681_0001060
936 Ga0495686_0005685
937 Ga0496100_0187093
938 Ga0496102_0000066
939 Ga0496103_0000102
940 Ga0496103_0000788
941 Ga0496103_0037091
942 Ga0496103_0080501
943 Ga0496103_0116256
944 Ga0496104_0000195
945 Ga0496104_0015550
946 Ga0496104_0034967
947 Ga0496104_0047564
948 Ga0496105_0000068
949 Ga0496105_0001485
950 Ga0496105_0026161
951 Ga0496105_0055349
952 Ga0496108_0000725
953 Ga0496108_0158509
954 Ga0496108_0194486
955 Ga0496109_0032677
956 Ga0496109_0223058
957 Ga0496110_0013580
958 Ga0496110_0059928
959 Ga0496110_0235932
960 Ga0496110_0414542
961 Ga0496111_0194946
962 Ga0496111_0457204
963 Ga0496112_0055600
964 Ga0496113_0020585
965 Ga0496113_0031371
966 Ga0496113_0335074
967 Ga0496115_0000054
968 Ga0496115_0013256
969 Ga0496116_0011493
970 Ga0496116_0016006
971 Ga0496117_0000225
972 Ga0496117_0002815
973 Ga0496117_0010678
974 Ga0496118_0000197
975 Ga0496118_0000335
976 Ga0496118_0008568
977 Ga0496119_0004407
978 Ga0496119_0016884
979 Ga0496119_0074140
980 Ga0496120_0197174
981 Ga0496121_0000279
982 Ga0496121_0002204
983 Ga0496121_0032293
984 Ga0496122_0000385
985 Ga0496122_0016743
986 Ga0496122_0018852
987 Ga0496122_0089210
988 Ga0496123_0000220
989 Ga0496123_0029267
990 Ga0496123_0227987
991 Ga0496124_0000240
992 Ga0496124_0002381
993 Ga0496124_0011196
994 Ga0496124_0163674
995 Ga0496125_0017360
996 Ga0496125_0025306
997 Ga0496125_0059236
998 Ga0496126_0000295
999 Ga0496126_0007550
1000 Ga0496126_0079587
1001 Ga0501034_0208524
1002 Ga0501036_0243546
1003 Ga0501039_0132163
1004 Ga0501043_0023322
1005 Ga0501046_0045393
1006 Ga0501047_0009300
1007 Ga0501048_0021911
1008 Ga0501223_000016
1009 Ga0501223_000079
1010 Ga0501224_000001
1011 Ga0501233_003902
1012 Ga0501235_002098
1013 Ga0501235_004555
1014 Ga0501246_000351
1015 Ga0501257_000048
1016 Ga0501225_0000013
1017 Ga0501225_0000547
1018 Ga0501280_003313
1019 Ga0501044_0076524
1020 Ga0501226_000047
1021 nmdc:mga0k408_20023_c1
1022 Ga0500610_0000043
1023 Ga0500643_000225
1024 Ga0500643_000788
1025 Ga0500643_002877
1026 Ga0500643_003694
1027 Ga0500643_007158
1028 Ga0500643_008869
1029 Ga0500644_0046414
1030 Ga0500644_0091119
1031 Ga0500566_0000089
1032 Ga0500562_001944
1033 Ga0500592_000617
1034 Ga0500595_000642
1035 Ga0500642_0049588
1036 Ga0500658_0002625
1037 Ga0500658_0007261
1038 Ga0500658_0162224
1039 Ga0500559_0002244
1040 Ga0500559_0002376
1041 Ga0500568_0006051
1042 Ga0500604_0012033
1043 Ga0500604_0054156
1044 Ga0500624_000011
1045 Ga0500627_0000150
1046 Ga0500627_0002804
1047 Ga0500636_0004435
1048 Ga0500611_010089
1049 Ga0500645_000192
1050 Ga0500596_008407
1051 Ga0500661_000955
1052 2512641649
1053 2600203936
1054 2644040364
1055 2644127542
1056 2778125612
1057 2809063547
1058 2809079482
1059 2809083880
1060 2819715293
1061 2880521055
1062 2885432785
1063 2919711970
1064 2928030682
1065 2928972496
1066 2946789771
1067 2984557194
1068 2984568443
1069 2993359490
1070 8057102041

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

46

197

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9677 12 250
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9662 12 250
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9599 12 250
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9543 10 250
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9491 11 255
ID Description Score Start End Superfamily
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.965 10 254 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9517 28 253 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9516 14 251 3.40.50.300
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9485 14 230 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9464 12 233 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3B9RKA9-F1-model_v4 deleted 0.9927 152 262
AF-A0A1B6Z4L2-F1-model_v4 ABC transporter ATP-binding protein 0.9925 11 264 GO:0005524
GO:0016887
AF-A0A4P6FWW7-F1-model_v4 ABC transporter ATP-binding protein 0.9773 12 268 GO:0005524
GO:0016887
AF-A0A3C0PHH4-F1-model_v4 ABC transporter ATP-binding protein 0.9714 9 252 GO:0005524
GO:0016887
AF-A0A0A8XEL2-F1-model_v4 Toluene tolerance efflux transporter ABC superfamily, ATP-bind 0.9702 9 253 GO:0005524
GO:0016887

Map