F460737

General Info

Members Datasets Scaffolds Average Seq Length
536 320 1072 401

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10004791|JGI25151J46595_100047913
Length 445
Sequence MRAPATLPNLPVASPPQSATAVDSVDNPDHSPRLRASGRAFAQIVQYHPELTAFRRDLHAHPELGFEEVYTSSRVVHALKLCGVDEVHTGIGKTGVVAVIKGQQPAKAGARPMVGLRADMDALPMTEHNEFGWKSSKAGLMHGCGHDGHTTMLVGAARYLAETRNFAGDAVLVFQPAEEGRGGADAMIKDGLFERFPVQAIXAMXNWPAMRPGTIGINPGPMMAAADRITIEVTGKGGHGAHAYLTVDPVLVAAHIITAVQGIVSRNVKAMDNAVISICAVQAGDLGAMSVVPETALLVGTVRTFKPEVQDLVERRLKELCAAVAQGFGATATVKYERIYPATINSPAEYALATAVADQLVGAENVVSNLEPSMGSEDFSFMLRVKPGAYLRLGQGEQLPDGKGGTTGGVGSRFLHNSCYDFNDSVLPLGSALFAGIVERSLPLA

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
76 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
117 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
120 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
126 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
127 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
128 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
160 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
163 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
167 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
168 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
169 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
170 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
171 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
196 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
238 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
247 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
248 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
249 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
250 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
251 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
252 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
253 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
257 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
260 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
261 2547132374 Acidovorax radicis N35 Isolate Unclassified
262 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
263 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
264 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
265 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
266 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
267 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
268 2643221570 Acidovorax sp. Root568 Isolate Unclassified
269 2643221596 Acidovorax sp. Root70 Isolate Unclassified
270 2643221609 Acidovorax sp. Root217 Isolate Unclassified
271 2643221611 Acidovorax sp. Root219 Isolate Unclassified
272 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
273 2643221652 Acidovorax sp. Root402 Isolate Unclassified
274 2643221658 Variovorax sp. Root411 Isolate Unclassified
275 2643221672 Variovorax sp. Root434 Isolate Unclassified
276 2643221683 Variovorax sp. Root473 Isolate Unclassified
277 2643221717 Acidovorax sp. Root267 Isolate Unclassified
278 2721755523 Delftia sp. HK171 Isolate Unclassified
279 2738541277 Variovorax sp. GV051 Isolate Unclassified
280 2738541307 Variovorax sp. GV008 Isolate Unclassified
281 2738543012 Acidovorax sp. CF301 Isolate Unclassified
282 2738543013 Variovorax sp. BT01 Isolate Unclassified
283 2738543019 Variovorax sp. GV040 Isolate Unclassified
284 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
285 2816332133 Acidovorax radicis 2721A Isolate Unclassified
286 2818991446 Variovorax sp. 1180 Isolate Unclassified
287 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
288 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
289 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
290 2842677519 Variovorax sp. R-72495 Isolate Unclassified
291 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
292 2842733646 Variovorax sp. R-72446 Isolate Unclassified
293 2842747753 Variovorax sp. R-72060 Isolate Unclassified
294 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
295 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
296 2885198086 Variovorax sp. 679 Isolate Unclassified
297 2885211737 Variovorax sp. 553 Isolate Unclassified
298 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
299 2899924645 Variovorax sp. 369 Isolate Unclassified
300 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
301 2904456579 Variovorax sp. 2002 Isolate Unclassified
302 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
303 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
304 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
305 2928037797 Variovorax sp. 1126 Isolate Unclassified
306 2928044640 Variovorax sp. 1128 Isolate Unclassified
307 2928051484 Variovorax sp. 1133 Isolate Unclassified
308 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
309 2928070936 Variovorax gossypii 1167 Isolate Unclassified
310 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
311 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
312 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
313 2929520902 Variovorax beijingensis 502 Isolate Unclassified
314 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
315 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
316 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
317 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
318 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
319 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
320 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.06
Metatranscriptomes 0.37
Isolates 11.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.96
Nodule 1.12
Rhizoplane 2.43
Rhizosphere 50
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10004791 3300003187 Bacteria 7090
2 JGI24740J21852_10005572 3300001979 Bacteria 5305
3 JGI25155J39150_1000024 3300002704 Bacteria 133561
4 JGI25156J39149_1000005 3300002705 Bacteria 263980
5 JGI25154J39366_1000017 3300002738 Bacteria 252448
6 JGI25157J39369_1000003 3300002741 Bacteria 274935
7 JGI25157J39369_1000054 3300002741 Bacteria 108825
8 JGI25152J39213_1000858 3300002773 Bacteria 15014
9 JGI25152J39213_1002510 3300002773 Bacteria 6929
10 JGI25152J39213_1005970 3300002773 Bacteria 3421
11 JGI25150J39212_1001367 3300002774 Bacteria 6921
12 JGI25150J39212_1001784 3300002774 Bacteria 5729
13 JGI25150J39212_1004229 3300002774 Bacteria 3222
14 JGI25159J45721_1001101 3300002987 Bacteria 11539
15 JGI25159J45721_1005607 3300002987 Bacteria 3915
16 JGI25151J46595_10001474 3300003187 Bacteria 15895
17 JGI25151J46595_10006208 3300003187 Bacteria 6046
18 JGI25151J46595_10017940 3300003187 Bacteria 3053
19 JGI25151J46595_10019926 3300003187 Bacteria 2836
20 JGI25153J46596_10001217 3300003215 Bacteria 15547
21 JGI25153J46596_10006297 3300003215 Bacteria 6046
22 JGI25153J46596_10008077 3300003215 Bacteria 5074
23 JGI25160J50197_1001413 3300003354 Bacteria 12036
24 JGI25160J50197_1012947 3300003354 Bacteria 2866
25 JGI25161J50226_1000098 3300003374 Bacteria 71121
26 JGI25161J50226_1001950 3300003374 Bacteria 5680
27 Ga0006562J51391_1101850 3300003578 Bacteria 2833
28 Ga0006562J51391_1118585 3300003578 Bacteria 3641
29 Ga0055535_1000286 3300003761 Bacteria 53400
30 Ga0055542_1000080 3300003762 Bacteria 129634
31 Ga0055526_1002766 3300003771 Bacteria 11628
32 Ga0055526_1005706 3300003771 Bacteria 7054
33 Ga0055526_1006053 3300003771 Bacteria 6699
34 Ga0055526_1006900 3300003771 Bacteria 6046
35 Ga0055537_1000566 3300003773 Bacteria 20771
36 Ga0055537_1000839 3300003773 Bacteria 14956
37 Ga0055537_1002536 3300003773 Bacteria 6046
38 Ga0055537_1003986 3300003773 Bacteria 4358
39 Ga0055524_1000111 3300003775 Bacteria 96812
40 Ga0055524_1004494 3300003775 Bacteria 6428
41 Ga0055524_1004940 3300003775 Bacteria 6046
42 Ga0055536_1005460 3300003781 Bacteria 6210
43 Ga0055536_1007269 3300003781 Bacteria 4987
44 Ga0055536_1009486 3300003781 Bacteria 4021
45 Ga0055534_1000520 3300003784 Bacteria 20771
46 Ga0055534_1004084 3300003784 Bacteria 4355
47 Ga0055528_1005285 3300003790 Bacteria 6046
48 Ga0055528_1010462 3300003790 Bacteria 3770
49 Ga0055530_10002162 3300003791 Bacteria 13026
50 Ga0055530_10002631 3300003791 Bacteria 11258
51 Ga0055540_1000059 3300003792 Bacteria 132075
52 Ga0055540_1002272 3300003792 Bacteria 10359
53 Ga0055540_1005075 3300003792 Bacteria 5683
54 Ga0055540_1005596 3300003792 Bacteria 5230
55 Ga0055540_1005875 3300003792 Bacteria 5024
56 Ga0055540_1007534 3300003792 Bacteria 4085
57 Ga0055531_10000252 3300003794 Bacteria 57457
58 Ga0055531_10001578 3300003794 Bacteria 16647
59 Ga0055531_10003800 3300003794 Bacteria 9474
60 Ga0055531_10007466 3300003794 Bacteria 5959
61 Ga0055531_10007944 3300003794 Bacteria 5688
62 Ga0055543_1000144 3300004625 Bacteria 59417
63 Ga0055543_1002450 3300004625 Bacteria 6125
64 Ga0065165_1006523 3300005262 Bacteria 6084
65 Ga0065165_1007082 3300005262 Bacteria 5633
66 Ga0065165_1007083 3300005262 Bacteria 5633
67 Ga0065165_1013668 3300005262 Bacteria 3210
68 Ga0065714_10010127 3300005288 Bacteria 2763
69 Ga0070660_100002557 3300005339 Bacteria 12469
70 Ga0070668_100116373 3300005347 Bacteria 2132
71 Ga0070674_100269667 3300005356 Bacteria 1345
72 Ga0070659_100062335 3300005366 Bacteria 2947
73 Ga0070678_100187276 3300005456 Bacteria 1699
74 Ga0070662_100030693 3300005457 Bacteria 3765
75 Ga0070662_100145798 3300005457 Bacteria 1839
76 Ga0070681_10000894 3300005458 Bacteria 25211
77 Ga0070706_100075849 3300005467 Bacteria 3112
78 Ga0070698_100231829 3300005471 Bacteria 1779
79 Ga0070679_100017302 3300005530 Bacteria 6977
80 Ga0070679_100033609 3300005530 Bacteria 5079
81 Ga0068853_100021008 3300005539 Bacteria 5435
82 Ga0068853_100218857 3300005539 Bacteria 1738
83 Ga0068855_100013718 3300005563 Bacteria 9769
84 Ga0068856_100299731 3300005614 Bacteria 1625
85 Ga0068852_100150493 3300005616 Bacteria 2164
86 Ga0075365_10104335 3300006038 Bacteria 1944
87 Ga0075368_10007153 3300006042 Bacteria 3931
88 Ga0075363_100034252 3300006048 Bacteria 2650
89 Ga0075364_10083749 3300006051 Bacteria 2111
90 Ga0075432_10002580 3300006058 Bacteria 6048
91 Ga0075362_10004581 3300006177 Bacteria 4981
92 Ga0075362_10010348 3300006177 Bacteria 3640
93 Ga0075362_10012757 3300006177 Bacteria 3346
94 Ga0075367_10133710 3300006178 Bacteria 1534
95 Ga0075369_10026542 3300006186 Bacteria 2415
96 Ga0075366_10013503 3300006195 Bacteria 4653
97 Ga0075366_10017138 3300006195 Bacteria 4166
98 Ga0075366_10017486 3300006195 Bacteria 4126
99 Ga0075366_10032148 3300006195 Bacteria 3089
100 Ga0097621_100099031 3300006237 Bacteria 2450
101 Ga0075370_10000357 3300006353 Bacteria 16682
102 Ga0075370_10006387 3300006353 Bacteria 5923
103 Ga0075370_10008718 3300006353 Bacteria 5231
104 Ga0075370_10009178 3300006353 Bacteria 5122
105 Ga0075370_10010061 3300006353 Bacteria 4934
106 Ga0075370_10031226 3300006353 Bacteria 2973
107 Ga0079104_1000016 3300006946 Bacteria 313865
108 Ga0099826_10045219 3300006948 Bacteria 3012
109 Ga0105244_10014218 3300009036 Bacteria 4613
110 Ga0105244_10015247 3300009036 Bacteria 4412
111 Ga0105250_10000520 3300009092 Bacteria 26952
112 Ga0105240_10002070 3300009093 Bacteria 32876
113 Ga0105240_10135957 3300009093 Bacteria 2944
114 Ga0105240_10168373 3300009093 Bacteria 2597
115 Ga0114129_10017238 3300009147 Bacteria 10287
116 Ga0105243_10013936 3300009148 Bacteria 6083
117 Ga0105243_10018550 3300009148 Bacteria 5273
118 Ga0105241_10047524 3300009174 Bacteria 3264
119 Ga0105241_10141087 3300009174 Bacteria 1962
120 Ga0105242_10013009 3300009176 Bacteria 6419
121 Ga0105239_10082631 3300010375 Bacteria 3537
122 Ga0105246_10046519 3300011119 Bacteria 2960
123 Ga0105246_10218234 3300011119 Bacteria 1493
124 Ga0157347_1001261 3300012502 Bacteria 1952
125 Ga0157373_10007417 3300013100 Bacteria 8156
126 Ga0157370_10028372 3300013104 Bacteria 5506
127 Ga0157370_10133878 3300013104 Bacteria 2311
128 Ga0157369_10006688 3300013105 Bacteria 13314
129 Ga0163162_10256908 3300013306 Bacteria 1879
130 Ga0157372_10022243 3300013307 Bacteria 6860
131 Ga0182008_10004056 3300014497 Bacteria 8642
132 Ga0182008_10004905 3300014497 Bacteria 7713
133 Ga0182008_10016183 3300014497 Bacteria 3880
134 Ga0157376_10002116 3300014969 Bacteria 13365
135 Ga0157376_10213777 3300014969 Bacteria 1782
136 Ga0182006_1001607 3300015261 Bacteria 13385
137 Ga0182007_10000590 3300015262 Bacteria 21308
138 Ga0182007_10005039 3300015262 Bacteria 5865
139 Ga0163161_10007178 3300017792 Bacteria 7705
140 Ga0163161_10035775 3300017792 Bacteria 3555
141 Ga0163161_10041498 3300017792 Bacteria 3306
142 Ga0163161_10041959 3300017792 Bacteria 3289
143 Ga0209435_100002 3300025206 Bacteria 794178
144 Ga0209672_101613 3300025228 Bacteria 7535
145 Ga0209147_102419 3300025229 Bacteria 4654
146 Ga0209258_100093 3300025242 Bacteria 223559
147 Ga0207425_1000307 3300025245 Bacteria 35391
148 Ga0207425_1000919 3300025245 Bacteria 14036
149 Ga0207425_1002793 3300025245 Bacteria 5913
150 Ga0209646_1000001 3300025246 Bacteria 3092932
151 Ga0209026_1000001 3300025250 Bacteria 1228671
152 Ga0209148_1000007 3300025254 Bacteria 1592273
153 Ga0209759_1000001 3300025256 Bacteria 2799452
154 Ga0209129_1000012 3300025258 Bacteria 541516
155 Ga0209129_1003219 3300025258 Bacteria 7284
156 Ga0209129_1003299 3300025258 Bacteria 7125
157 Ga0209129_1003650 3300025258 Bacteria 6554
158 Ga0209565_1000016 3300025263 Bacteria 477707
159 Ga0209565_1000098 3300025263 Bacteria 132021
160 Ga0209565_1000203 3300025263 Bacteria 69824
161 Ga0209565_1000388 3300025263 Bacteria 37308
162 Ga0209565_1001173 3300025263 Bacteria 12545
163 Ga0209673_1000008 3300025273 Bacteria 626013
164 Ga0209673_1000058 3300025273 Bacteria 269028
165 Ga0209673_1000555 3300025273 Bacteria 60035
166 Ga0209673_1000659 3300025273 Bacteria 50504
167 Ga0209130_1000104 3300025284 Bacteria 136694
168 Ga0209130_1000161 3300025284 Bacteria 100375
169 Ga0209130_1000247 3300025284 Bacteria 68383
170 Ga0209675_1000010 3300025291 Bacteria 541927
171 Ga0209675_1000099 3300025291 Bacteria 128911
172 Ga0209675_1000230 3300025291 Bacteria 56831
173 Ga0209675_1001576 3300025291 Bacteria 12918
174 Ga0209675_1001851 3300025291 Bacteria 11492
175 Ga0209676_1000023 3300025292 Bacteria 589732
176 Ga0209676_1000028 3300025292 Bacteria 559745
177 Ga0209676_1000317 3300025292 Bacteria 94105
178 Ga0209676_1000367 3300025292 Bacteria 84271
179 Ga0209676_1002162 3300025292 Bacteria 14862
180 Ga0209676_1003718 3300025292 Bacteria 9095
181 Ga0209676_1007884 3300025292 Bacteria 4889
182 Ga0209025_1000194 3300025294 Bacteria 148593
183 Ga0209025_1000561 3300025294 Bacteria 68208
184 Ga0209025_1000665 3300025294 Bacteria 59423
185 Ga0209025_1003330 3300025294 Bacteria 15434
186 Ga0209025_1003808 3300025294 Bacteria 13785
187 Ga0209025_1004247 3300025294 Bacteria 12612
188 Ga0209025_1006147 3300025294 Bacteria 9454
189 Ga0209564_1000022 3300025295 Bacteria 555109
190 Ga0209564_1000344 3300025295 Bacteria 88136
191 Ga0209564_1000543 3300025295 Bacteria 60959
192 Ga0209564_1001028 3300025295 Bacteria 34353
193 Ga0209564_1001769 3300025295 Bacteria 20104
194 Ga0209564_1003285 3300025295 Bacteria 11247
195 Ga0209758_1000234 3300025297 Bacteria 116217
196 Ga0209758_1000510 3300025297 Bacteria 62591
197 Ga0209758_1005138 3300025297 Bacteria 10330
198 Ga0209050_1000022 3300025298 Bacteria 565239
199 Ga0209050_1000072 3300025298 Bacteria 293619
200 Ga0209050_1000133 3300025298 Bacteria 184688
201 Ga0209256_1000001 3300025299 Bacteria 2166974
202 Ga0209256_1000151 3300025299 Bacteria 145299
203 Ga0209256_1000256 3300025299 Bacteria 94699
204 Ga0207426_1000049 3300025302 Bacteria 401954
205 Ga0207426_1000156 3300025302 Bacteria 178646
206 Ga0207426_1000315 3300025302 Bacteria 94699
207 Ga0207426_1001121 3300025302 Bacteria 24462
208 Ga0209051_1000013 3300025303 Bacteria 565239
209 Ga0209051_1000015 3300025303 Bacteria 546798
210 Ga0209051_1000056 3300025303 Bacteria 271616
211 Ga0209051_1000819 3300025303 Bacteria 32216
212 Ga0209051_1002747 3300025303 Bacteria 12198
213 Ga0209051_1003983 3300025303 Bacteria 9377
214 Ga0209051_1006815 3300025303 Bacteria 6360
215 Ga0209051_1009266 3300025303 Bacteria 5089
216 Ga0209051_1018596 3300025303 Bacteria 3068
217 Ga0209257_1000015 3300025304 Bacteria 908141
218 Ga0209257_1000037 3300025304 Bacteria 612915
219 Ga0209257_1000042 3300025304 Bacteria 537149
220 Ga0209257_1004793 3300025304 Bacteria 10078
221 Ga0209257_1008252 3300025304 Bacteria 5989
222 Ga0209257_1010066 3300025304 Bacteria 4891
223 Ga0207696_1003578 3300025711 Bacteria 7017
224 Ga0207705_10117605 3300025909 Bacteria 1969
225 Ga0207654_10068687 3300025911 Bacteria 2097
226 Ga0207654_10079849 3300025911 Bacteria 1966
227 Ga0207707_10005192 3300025912 Bacteria 11415
228 Ga0207695_10152333 3300025913 Bacteria 2250
229 Ga0207657_10006245 3300025919 Bacteria 12388
230 Ga0207649_10010214 3300025920 Bacteria 5153
231 Ga0207652_10007481 3300025921 Bacteria 8800
232 Ga0207706_10143407 3300025933 Bacteria 2101
233 Ga0207686_10002916 3300025934 Bacteria 9221
234 Ga0207709_10000190 3300025935 Bacteria 82314
235 Ga0207709_10001267 3300025935 Bacteria 18083
236 Ga0207709_10002590 3300025935 Bacteria 11268
237 Ga0207679_10003609 3300025945 Bacteria 9599
238 Ga0207667_10083434 3300025949 Bacteria 3309
239 Ga0207658_10034319 3300025986 Bacteria 3626
240 Ga0207639_10027875 3300026041 Bacteria 4118
241 Ga0207639_10048714 3300026041 Bacteria 3209
242 Ga0207674_10044669 3300026116 Bacteria 4563
243 Ga0207683_10068318 3300026121 Bacteria 3137
244 Ga0207683_10177563 3300026121 Bacteria 1930
245 Ga0207698_10014740 3300026142 Bacteria 5208
246 Ga0209281_1000017 3300027111 Bacteria 583251
247 Ga0209973_1001259 3300027252 Bacteria 2171
248 Ga0209970_1000119 3300027614 Bacteria 11611
249 Ga0209282_1003156 3300027666 Bacteria 9736
250 Ga0209971_1012472 3300027682 Bacteria 2010
251 Ga0209974_10002763 3300027876 Bacteria 6360
252 Ga0209974_10010334 3300027876 Bacteria 3149
253 Ga0207428_10158280 3300027907 Bacteria 1721
254 Ga0268266_10035932 3300028379 Bacteria 4214
255 Ga0307515_10000282 3300028794 Bacteria 125216
256 Ga0307515_10001078 3300028794 Bacteria 62511
257 Ga0316176_1025080 3300030732 Bacteria 2909
258 Ga0316178_1062450 3300030735 Bacteria 2426
259 Ga0316183_1019722 3300030742 Bacteria 3654
260 Ga0316181_1037194 3300030744 Bacteria 3069
261 Ga0265330_10000973 3300031235 Bacteria 17544
262 Ga0265332_10000921 3300031238 Bacteria 17608
263 Ga0265332_10044933 3300031238 Bacteria 1904
264 Ga0265325_10019187 3300031241 Bacteria 3784
265 Ga0265329_10019545 3300031242 Bacteria 2298
266 Ga0265327_10001860 3300031251 Bacteria 24474
267 Ga0307513_10000038 3300031456 Bacteria 174780
268 Ga0307513_10013649 3300031456 Bacteria 9964
269 Ga0307408_100000343 3300031548 Bacteria 43705
270 Ga0307408_100013523 3300031548 Bacteria 5417
271 Ga0307408_100050473 3300031548 Bacteria 2992
272 Ga0307408_100051120 3300031548 Bacteria 2975
273 Ga0307408_100218936 3300031548 Bacteria 1552
274 Ga0307514_10001116 3300031649 Bacteria 37410
275 Ga0265314_10002757 3300031711 Bacteria 17549
276 Ga0265314_10004558 3300031711 Bacteria 12795
277 Ga0265314_10017369 3300031711 Bacteria 5650
278 Ga0265342_10106210 3300031712 Bacteria 1593
279 Ga0307516_10071206 3300031730 Bacteria 3338
280 Ga0307405_10016762 3300031731 Bacteria 4002
281 Ga0307405_10046927 3300031731 Bacteria 2657
282 Ga0307405_10064531 3300031731 Bacteria 2328
283 Ga0307405_10074492 3300031731 Bacteria 2195
284 Ga0307410_10022183 3300031852 Bacteria 3919
285 Ga0307406_10001360 3300031901 Bacteria 13682
286 Ga0307406_10005655 3300031901 Bacteria 6836
287 Ga0307406_10023309 3300031901 Bacteria 3681
288 Ga0307407_10010027 3300031903 Bacteria 4446
289 Ga0307407_10050996 3300031903 Bacteria 2370
290 Ga0307407_10068302 3300031903 Bacteria 2104
291 Ga0307412_10003074 3300031911 Bacteria 9253
292 Ga0307412_10025253 3300031911 Bacteria 3678
293 Ga0307412_10172881 3300031911 Bacteria 1617
294 Ga0307409_100026022 3300031995 Bacteria 4118
295 Ga0307416_100018336 3300032002 Bacteria 4928
296 Ga0307416_100062230 3300032002 Bacteria 3050
297 Ga0307416_100118307 3300032002 Bacteria 2354
298 Ga0307414_10031337 3300032004 Bacteria 3487
299 Ga0307411_10034105 3300032005 Bacteria 3163
300 Ga0307415_100106190 3300032126 Bacteria 2072
301 Ga0373957_0051155 3300035120 Bacteria 1580
302 Ga0373955_0046803 3300035172 Bacteria 2340
303 Ga0373937_0009248 3300036401 Bacteria 8554
304 Ga0395899_0005223 3300037312 Bacteria 10100
305 Ga0395899_0005752 3300037312 Bacteria 9623
306 Ga0395900_0007221 3300037418 Bacteria 11510
307 Ga0395900_0122704 3300037418 Bacteria 2665
308 Ga0395900_0287640 3300037418 Bacteria 1633
309 Ga0395898_0023556 3300037466 Bacteria 6219
310 Ga0395898_0062523 3300037466 Bacteria 3615
311 Ga0395898_0126376 3300037466 Bacteria 2450
312 Ga0395905_0000828 3300037471 Bacteria 40415
313 Ga0395905_0003300 3300037471 Bacteria 17321
314 Ga0395905_0003358 3300037471 Bacteria 17159
315 Ga0395905_0067000 3300037471 Bacteria 3362
316 Ga0395905_0106802 3300037471 Bacteria 2628
317 Ga0395905_0159878 3300037471 Bacteria 2117
318 Ga0395901_0021094 3300038443 Bacteria 6674
319 Ga0395901_0035158 3300038443 Bacteria 5177
320 Ga0395901_0048924 3300038443 Bacteria 4391
321 Ga0395901_0051717 3300038443 Bacteria 4272
322 Ga0395901_0073932 3300038443 Bacteria 3556
323 Ga0395901_0095206 3300038443 Bacteria 3120
324 Ga0395901_0115179 3300038443 Bacteria 2824
325 Ga0395901_0138907 3300038443 Bacteria 2554
326 Ga0395901_0165352 3300038443 Bacteria 2323
327 Ga0439436_0034401 3300041404 Bacteria 1465
328 Ga0439438_007072 3300041405 Bacteria 3878
329 Ga0439466_0023735 3300041411 Bacteria 2155
330 Ga0439465_0000146 3300041413 Bacteria 17383
331 Ga0451791_1480938 3300041451 Bacteria 1775
332 Ga0439433_0001179 3300041999 Bacteria 5364
333 Ga0439432_050519 3300042006 Bacteria 1298
334 Ga0439449_0001013 3300042007 Bacteria 11069
335 Ga0439449_0001121 3300042007 Bacteria 10531
336 Ga0439449_0006134 3300042007 Bacteria 4592
337 Ga0439452_002686 3300042010 Bacteria 6451
338 Ga0439457_008405 3300042014 Bacteria 2437
339 Ga0439462_0001668 3300042015 Bacteria 5002
340 Ga0439462_0010416 3300042015 Bacteria 2353
341 Ga0450911_000587 3300042115 Bacteria 11163
342 Ga0450923_005713 3300042125 Bacteria 2026
343 Ga0450923_006363 3300042125 Bacteria 1953
344 Ga0450898_006794 3300042134 Bacteria 1766
345 Ga0439446_0031741 3300042156 Bacteria 1529
346 Ga0450908_004895 3300042184 Bacteria 2572
347 Ga0439434_0001332 3300042435 Bacteria 7125
348 Ga0439434_0018709 3300042435 Bacteria 2075
349 Ga0439435_0023653 3300042436 Bacteria 1615
350 Ga0450893_0001152 3300042532 Bacteria 3981
351 Ga0451577_0001937 3300042876 Bacteria 26108
352 Ga0451577_0009638 3300042876 Bacteria 9270
353 Ga0451577_0015798 3300042876 Bacteria 7007
354 Ga0451577_0031401 3300042876 Bacteria 4792
355 Ga0466969_0000046 3300044656 Bacteria 63999
356 Ga0466969_0001773 3300044656 Bacteria 11498
357 Ga0453683_0005625 3300044673 Bacteria 8709
358 Ga0466966_0001000 3300044684 Bacteria 18038
359 Ga0466966_0013088 3300044684 Bacteria 5492
360 Ga0466966_0096752 3300044684 Bacteria 1828
361 Ga0466961_0126833 3300044693 Bacteria 1600
362 Ga0466961_0288052 3300044693 Bacteria 1004
363 Ga0466963_0005286 3300044694 Bacteria 7542
364 Ga0453684_0001952 3300044712 Bacteria 53204
365 Ga0453684_0051712 3300044712 Bacteria 5382
366 Ga0453684_0071561 3300044712 Bacteria 4384
367 Ga0453684_0115001 3300044712 Bacteria 3260
368 Ga0453684_0289265 3300044712 Bacteria 1866
369 Ga0466971_0031322 3300044719 Bacteria 2381
370 Ga0466971_0036705 3300044719 Bacteria 2198
371 Ga0466970_0011195 3300044765 Bacteria 4569
372 Ga0466970_0102515 3300044765 Bacteria 1559
373 Ga0466957_0031237 3300044842 Bacteria 3181
374 Ga0466959_0000174 3300045049 Bacteria 42543
375 Ga0466959_0086675 3300045049 Bacteria 2252
376 Ga0451576_0002149 3300045051 Bacteria 30527
377 Ga0451576_0002636 3300045051 Bacteria 26218
378 Ga0451576_0020764 3300045051 Bacteria 7148
379 Ga0451576_0023215 3300045051 Bacteria 6720
380 Ga0466958_0091461 3300045836 Bacteria 1884
381 Ga0495629_0062461 3300046459 Bacteria 2602
382 Ga0495638_0044859 3300046460 Bacteria 2784
383 Ga0495639_0004988 3300046475 Bacteria 5695
384 Ga0495610_0012536 3300046512 Bacteria 5095
385 Ga0495616_0006492 3300046513 Bacteria 7073
386 Ga0495631_0000152 3300046518 Bacteria 47290
387 Ga0495637_0004657 3300046520 Bacteria 7085
388 Ga0495663_0003986 3300046525 Bacteria 4195
389 Ga0495654_0007192 3300046530 Bacteria 6244
390 Ga0495621_0027435 3300046539 Bacteria 1928
391 Ga0495621_0063373 3300046539 Bacteria 1347
392 Ga0495656_0001340 3300046615 Bacteria 8024
393 Ga0495625_0000294 3300046660 Bacteria 77321
394 Ga0495625_0091666 3300046660 Bacteria 2100
395 Ga0495588_0017211 3300046674 Bacteria 3505
396 Ga0495588_0019118 3300046674 Bacteria 3353
397 Ga0495658_0019881 3300046683 Bacteria 3512
398 Ga0495669_0032082 3300046684 Bacteria 2308
399 Ga0495671_0003236 3300046692 Bacteria 10106
400 Ga0495676_0109602 3300047321 Bacteria 2028
401 Ga0495593_0000791 3300047673 Bacteria 18331
402 Ga0495614_0002171 3300048089 Bacteria 8684
403 Ga0496101_0045390 3300048904 Bacteria 3147
404 Ga0496103_0052635 3300048906 Bacteria 2521
405 Ga0496104_0050946 3300048907 Bacteria 3906
406 Ga0496105_0001585 3300048908 Bacteria 16114
407 Ga0496106_0040696 3300048909 Bacteria 3481
408 Ga0496107_0173488 3300048910 Bacteria 1600
409 Ga0496110_0216539 3300048913 Bacteria 1741
410 Ga0496114_0033617 3300048917 Bacteria 4226
411 Ga0496114_0161175 3300048917 Bacteria 1951
412 Ga0496116_0003140 3300048919 Bacteria 16569
413 Ga0496117_0022542 3300048920 Bacteria 5048
414 Ga0496117_0050080 3300048920 Bacteria 2964
415 Ga0496118_0059458 3300048921 Bacteria 2845
416 Ga0496118_0104106 3300048921 Bacteria 1906
417 Ga0496121_0031543 3300048924 Bacteria 4838
418 Ga0496122_0000319 3300048925 Bacteria 105543
419 Ga0496123_0000117 3300048926 Bacteria 161679
420 Ga0496124_0084575 3300048927 Bacteria 2601
421 Ga0496125_0009172 3300048928 Bacteria 10224
422 Ga0496125_0034190 3300048928 Bacteria 4484
423 Ga0496125_0043380 3300048928 Bacteria 3818
424 Ga0496125_0070682 3300048928 Bacteria 2731
425 Ga0501031_0003235 3300049568 Bacteria 10468
426 Ga0501041_0040788 3300049577 Bacteria 2819
427 Ga0501043_0152410 3300049579 Bacteria 1809
428 Ga0501046_0011663 3300049580 Bacteria 7512
429 Ga0501046_0025780 3300049580 Bacteria 4808
430 Ga0501047_0121039 3300049581 Bacteria 2499
431 Ga0501048_0066070 3300049582 Bacteria 2557
432 Ga0501072_0032680 3300049588 Bacteria 4075
433 Ga0501076_0040333 3300049592 Bacteria 3669
434 Ga0501079_0024027 3300049741 Bacteria 4676
435 Ga0501080_0008893 3300049742 Bacteria 9133
436 Ga0501080_0113815 3300049742 Bacteria 2508
437 Ga0501080_0207553 3300049742 Bacteria 1796
438 Ga0501081_0087107 3300049743 Bacteria 2193
439 Ga0501083_0043166 3300049744 Bacteria 3055
440 Ga0501263_002309 3300049760 Bacteria 1931
441 Ga0501266_003697 3300049763 Bacteria 1894
442 Ga0501035_0076889 3300049822 Bacteria 2951
443 Ga0501035_0254047 3300049822 Bacteria 1492
444 Ga0501044_0213810 3300049823 Bacteria 1881
445 nmdc:mga03n38_22363_c1 3300050490 Bacteria 2558
446 nmdc:mga03n38_29387_c1 3300050490 Bacteria 2300
447 nmdc:mga03n38_59432_c1 3300050490 Bacteria 1735
448 nmdc:mga00v17_21270_c1 3300050491 Bacteria 3728
449 nmdc:mga00v17_47249_c1 3300050491 Bacteria 2607
450 nmdc:mga0k408_12238_c1 3300050493 Bacteria 4689
451 nmdc:mga0k408_17555_c1 3300050493 Bacteria 3989
452 nmdc:mga0k408_47406_c1 3300050493 Bacteria 2484
453 nmdc:mga0k408_48696_c1 3300050493 Bacteria 2452
454 nmdc:mga0k408_90472_c1 3300050493 Bacteria 1797
455 nmdc:mga0k408_96567_c1 3300050493 Bacteria 1740
456 nmdc:mga07m45_16177_c2 3300050496 Bacteria 1568
457 nmdc:mga07m45_85986_c1 3300050496 Bacteria 1798
458 nmdc:mga05p37_72983_c1 3300050507 Bacteria 4223
459 Ga0500610_0018724 3300053079 Bacteria 3354
460 Ga0500643_010671 3300053087 Bacteria 3402
461 Ga0500651_0000046 3300053093 Bacteria 84379
462 Ga0500571_000155 3300053110 Bacteria 23845
463 Ga0500593_001378 3300053117 Bacteria 8747
464 Ga0500607_001588 3300053121 Bacteria 20081
465 Ga0500658_0000139 3300053134 Bacteria 34590
466 Ga0500658_0000438 3300053134 Bacteria 17884
467 Ga0500559_0019800 3300053136 Bacteria 2843
468 Ga0500568_0007359 3300053139 Bacteria 5410
469 Ga0500627_0000658 3300053158 Bacteria 9196
470 Ga0500636_0076214 3300053177 Bacteria 1939
471 Ga0500645_001417 3300053730 Bacteria 12194
472 Ga0500645_002171 3300053730 Bacteria 8985
473 Ga0501084_0030885 3300054114 Bacteria 4479
474 Ga0501084_0035376 3300054114 Bacteria 4176
475 2511246914 2511231002 Bacteria 5042903
476 2513229459 2513020051 Bacteria 6053213
477 2548499185 2547132374 Bacteria 5530232
478 2587725270 2585428057 Bacteria 6737412
479 2587731373 2585428058 Bacteria 6853932
480 2599620703 2599185214 Bacteria 8209958
481 2599674002 2599185226 Bacteria 8233575
482 2599678681 2599185227 Bacteria 8246414
483 2599690214 2599185229 Bacteria 8216126
484 2643866018 2643221570 Bacteria 5103772
485 2643994016 2643221596 Bacteria 5006805
486 2644057774 2643221609 Bacteria 6756331
487 2644072140 2643221611 Bacteria 6820941
488 2644161488 2643221628 Bacteria 5745828
489 2644292830 2643221652 Bacteria 5140275
490 2644324209 2643221658 Bacteria 6064537
491 2644399493 2643221672 Bacteria 6322190
492 2644465063 2643221683 Bacteria 5749203
493 2644647848 2643221717 Bacteria 5676132
494 2722881773 2721755523 Bacteria 6430384
495 2738720552 2738541277 Bacteria 7458140
496 2738884126 2738541307 Bacteria 8606193
497 2739242043 2738543012 Bacteria 7115078
498 2739250217 2738543013 Bacteria 5618633
499 2739279751 2738543019 Bacteria 7459457
500 2739354223 2738543032 Bacteria 5115625
501 2816470657 2816332133 Bacteria 7249298
502 2819601232 2818991446 Bacteria 7757362
503 2831269357 2831265667 Bacteria 7184833
504 2838055353 2838054893 Bacteria 7451788
505 2839144604 2839138175 Bacteria 6549354
506 2842682721 2842677519 Bacteria 5615038
507 2842721639 2842718218 Bacteria 4560148
508 2842737666 2842733646 Bacteria 5716726
509 2842749612 2842747753 Bacteria 5578255
510 2881104775 2881101125 Bacteria 4590519
511 2885197143 2885192300 Bacteria 5882526
512 2885201572 2885198086 Bacteria 7212419
513 2885215717 2885211737 Bacteria 7212420
514 2894024083 2894023352 Bacteria 5167372
515 2899927421 2899924645 Bacteria 7487985
516 2904450850 2904449895 Bacteria 6927402
517 2904459647 2904456579 Bacteria 6819253
518 2904549332 2904541872 Bacteria 8915136
519 2919462625 2919462493 Bacteria 5817112
520 2919707036 2919704043 Bacteria 5560311
521 2928042667 2928037797 Bacteria 7273642
522 2928048906 2928044640 Bacteria 7271509
523 2928055240 2928051484 Bacteria 7773759
524 2928068668 2928064002 Bacteria 7419480
525 2928073419 2928070936 Bacteria 8062541
526 2928090023 2928084124 Bacteria 7159212
527 2928121075 2928115317 Bacteria 6477646
528 2929161508 2929160207 Bacteria 9075316
529 2929521746 2929520902 Bacteria 6765052
530 2945914023 2945909444 Bacteria 7065066
531 2945949590 2945945610 Bacteria 5951079
532 2945973626 2945972063 Bacteria 6086495
533 2945990582 2945984333 Bacteria 7358892
534 2954770758 2954767861 Bacteria 5535784
535 2974322268 2974320154 Bacteria 4571377
536 2990714071 2990710928 Bacteria 5002431
537 JGI25151J46595_10004791
538 JGI24740J21852_10005572
539 JGI25155J39150_1000024
540 JGI25156J39149_1000005
541 JGI25154J39366_1000017
542 JGI25157J39369_1000003
543 JGI25157J39369_1000054
544 JGI25152J39213_1000858
545 JGI25152J39213_1002510
546 JGI25152J39213_1005970
547 JGI25150J39212_1001367
548 JGI25150J39212_1001784
549 JGI25150J39212_1004229
550 JGI25159J45721_1001101
551 JGI25159J45721_1005607
552 JGI25151J46595_10001474
553 JGI25151J46595_10006208
554 JGI25151J46595_10017940
555 JGI25151J46595_10019926
556 JGI25153J46596_10001217
557 JGI25153J46596_10006297
558 JGI25153J46596_10008077
559 JGI25160J50197_1001413
560 JGI25160J50197_1012947
561 JGI25161J50226_1000098
562 JGI25161J50226_1001950
563 Ga0006562J51391_1101850
564 Ga0006562J51391_1118585
565 Ga0055535_1000286
566 Ga0055542_1000080
567 Ga0055526_1002766
568 Ga0055526_1005706
569 Ga0055526_1006053
570 Ga0055526_1006900
571 Ga0055537_1000566
572 Ga0055537_1000839
573 Ga0055537_1002536
574 Ga0055537_1003986
575 Ga0055524_1000111
576 Ga0055524_1004494
577 Ga0055524_1004940
578 Ga0055536_1005460
579 Ga0055536_1007269
580 Ga0055536_1009486
581 Ga0055534_1000520
582 Ga0055534_1004084
583 Ga0055528_1005285
584 Ga0055528_1010462
585 Ga0055530_10002162
586 Ga0055530_10002631
587 Ga0055540_1000059
588 Ga0055540_1002272
589 Ga0055540_1005075
590 Ga0055540_1005596
591 Ga0055540_1005875
592 Ga0055540_1007534
593 Ga0055531_10000252
594 Ga0055531_10001578
595 Ga0055531_10003800
596 Ga0055531_10007466
597 Ga0055531_10007944
598 Ga0055543_1000144
599 Ga0055543_1002450
600 Ga0065165_1006523
601 Ga0065165_1007082
602 Ga0065165_1007083
603 Ga0065165_1013668
604 Ga0065714_10010127
605 Ga0070660_100002557
606 Ga0070668_100116373
607 Ga0070674_100269667
608 Ga0070659_100062335
609 Ga0070678_100187276
610 Ga0070662_100030693
611 Ga0070662_100145798
612 Ga0070681_10000894
613 Ga0070706_100075849
614 Ga0070698_100231829
615 Ga0070679_100017302
616 Ga0070679_100033609
617 Ga0068853_100021008
618 Ga0068853_100218857
619 Ga0068855_100013718
620 Ga0068856_100299731
621 Ga0068852_100150493
622 Ga0075365_10104335
623 Ga0075368_10007153
624 Ga0075363_100034252
625 Ga0075364_10083749
626 Ga0075432_10002580
627 Ga0075362_10004581
628 Ga0075362_10010348
629 Ga0075362_10012757
630 Ga0075367_10133710
631 Ga0075369_10026542
632 Ga0075366_10013503
633 Ga0075366_10017138
634 Ga0075366_10017486
635 Ga0075366_10032148
636 Ga0097621_100099031
637 Ga0075370_10000357
638 Ga0075370_10006387
639 Ga0075370_10008718
640 Ga0075370_10009178
641 Ga0075370_10010061
642 Ga0075370_10031226
643 Ga0079104_1000016
644 Ga0099826_10045219
645 Ga0105244_10014218
646 Ga0105244_10015247
647 Ga0105250_10000520
648 Ga0105240_10002070
649 Ga0105240_10135957
650 Ga0105240_10168373
651 Ga0114129_10017238
652 Ga0105243_10013936
653 Ga0105243_10018550
654 Ga0105241_10047524
655 Ga0105241_10141087
656 Ga0105242_10013009
657 Ga0105239_10082631
658 Ga0105246_10046519
659 Ga0105246_10218234
660 Ga0157347_1001261
661 Ga0157373_10007417
662 Ga0157370_10028372
663 Ga0157370_10133878
664 Ga0157369_10006688
665 Ga0163162_10256908
666 Ga0157372_10022243
667 Ga0182008_10004056
668 Ga0182008_10004905
669 Ga0182008_10016183
670 Ga0157376_10002116
671 Ga0157376_10213777
672 Ga0182006_1001607
673 Ga0182007_10000590
674 Ga0182007_10005039
675 Ga0163161_10007178
676 Ga0163161_10035775
677 Ga0163161_10041498
678 Ga0163161_10041959
679 Ga0209435_100002
680 Ga0209672_101613
681 Ga0209147_102419
682 Ga0209258_100093
683 Ga0207425_1000307
684 Ga0207425_1000919
685 Ga0207425_1002793
686 Ga0209646_1000001
687 Ga0209026_1000001
688 Ga0209148_1000007
689 Ga0209759_1000001
690 Ga0209129_1000012
691 Ga0209129_1003219
692 Ga0209129_1003299
693 Ga0209129_1003650
694 Ga0209565_1000016
695 Ga0209565_1000098
696 Ga0209565_1000203
697 Ga0209565_1000388
698 Ga0209565_1001173
699 Ga0209673_1000008
700 Ga0209673_1000058
701 Ga0209673_1000555
702 Ga0209673_1000659
703 Ga0209130_1000104
704 Ga0209130_1000161
705 Ga0209130_1000247
706 Ga0209675_1000010
707 Ga0209675_1000099
708 Ga0209675_1000230
709 Ga0209675_1001576
710 Ga0209675_1001851
711 Ga0209676_1000023
712 Ga0209676_1000028
713 Ga0209676_1000317
714 Ga0209676_1000367
715 Ga0209676_1002162
716 Ga0209676_1003718
717 Ga0209676_1007884
718 Ga0209025_1000194
719 Ga0209025_1000561
720 Ga0209025_1000665
721 Ga0209025_1003330
722 Ga0209025_1003808
723 Ga0209025_1004247
724 Ga0209025_1006147
725 Ga0209564_1000022
726 Ga0209564_1000344
727 Ga0209564_1000543
728 Ga0209564_1001028
729 Ga0209564_1001769
730 Ga0209564_1003285
731 Ga0209758_1000234
732 Ga0209758_1000510
733 Ga0209758_1005138
734 Ga0209050_1000022
735 Ga0209050_1000072
736 Ga0209050_1000133
737 Ga0209256_1000001
738 Ga0209256_1000151
739 Ga0209256_1000256
740 Ga0207426_1000049
741 Ga0207426_1000156
742 Ga0207426_1000315
743 Ga0207426_1001121
744 Ga0209051_1000013
745 Ga0209051_1000015
746 Ga0209051_1000056
747 Ga0209051_1000819
748 Ga0209051_1002747
749 Ga0209051_1003983
750 Ga0209051_1006815
751 Ga0209051_1009266
752 Ga0209051_1018596
753 Ga0209257_1000015
754 Ga0209257_1000037
755 Ga0209257_1000042
756 Ga0209257_1004793
757 Ga0209257_1008252
758 Ga0209257_1010066
759 Ga0207696_1003578
760 Ga0207705_10117605
761 Ga0207654_10068687
762 Ga0207654_10079849
763 Ga0207707_10005192
764 Ga0207695_10152333
765 Ga0207657_10006245
766 Ga0207649_10010214
767 Ga0207652_10007481
768 Ga0207706_10143407
769 Ga0207686_10002916
770 Ga0207709_10000190
771 Ga0207709_10001267
772 Ga0207709_10002590
773 Ga0207679_10003609
774 Ga0207667_10083434
775 Ga0207658_10034319
776 Ga0207639_10027875
777 Ga0207639_10048714
778 Ga0207674_10044669
779 Ga0207683_10068318
780 Ga0207683_10177563
781 Ga0207698_10014740
782 Ga0209281_1000017
783 Ga0209973_1001259
784 Ga0209970_1000119
785 Ga0209282_1003156
786 Ga0209971_1012472
787 Ga0209974_10002763
788 Ga0209974_10010334
789 Ga0207428_10158280
790 Ga0268266_10035932
791 Ga0307515_10000282
792 Ga0307515_10001078
793 Ga0316176_1025080
794 Ga0316178_1062450
795 Ga0316183_1019722
796 Ga0316181_1037194
797 Ga0265330_10000973
798 Ga0265332_10000921
799 Ga0265332_10044933
800 Ga0265325_10019187
801 Ga0265329_10019545
802 Ga0265327_10001860
803 Ga0307513_10000038
804 Ga0307513_10013649
805 Ga0307408_100000343
806 Ga0307408_100013523
807 Ga0307408_100050473
808 Ga0307408_100051120
809 Ga0307408_100218936
810 Ga0307514_10001116
811 Ga0265314_10002757
812 Ga0265314_10004558
813 Ga0265314_10017369
814 Ga0265342_10106210
815 Ga0307516_10071206
816 Ga0307405_10016762
817 Ga0307405_10046927
818 Ga0307405_10064531
819 Ga0307405_10074492
820 Ga0307410_10022183
821 Ga0307406_10001360
822 Ga0307406_10005655
823 Ga0307406_10023309
824 Ga0307407_10010027
825 Ga0307407_10050996
826 Ga0307407_10068302
827 Ga0307412_10003074
828 Ga0307412_10025253
829 Ga0307412_10172881
830 Ga0307409_100026022
831 Ga0307416_100018336
832 Ga0307416_100062230
833 Ga0307416_100118307
834 Ga0307414_10031337
835 Ga0307411_10034105
836 Ga0307415_100106190
837 Ga0373957_0051155
838 Ga0373955_0046803
839 Ga0373937_0009248
840 Ga0395899_0005223
841 Ga0395899_0005752
842 Ga0395900_0007221
843 Ga0395900_0122704
844 Ga0395900_0287640
845 Ga0395898_0023556
846 Ga0395898_0062523
847 Ga0395898_0126376
848 Ga0395905_0000828
849 Ga0395905_0003300
850 Ga0395905_0003358
851 Ga0395905_0067000
852 Ga0395905_0106802
853 Ga0395905_0159878
854 Ga0395901_0021094
855 Ga0395901_0035158
856 Ga0395901_0048924
857 Ga0395901_0051717
858 Ga0395901_0073932
859 Ga0395901_0095206
860 Ga0395901_0115179
861 Ga0395901_0138907
862 Ga0395901_0165352
863 Ga0439436_0034401
864 Ga0439438_007072
865 Ga0439466_0023735
866 Ga0439465_0000146
867 Ga0451791_1480938
868 Ga0439433_0001179
869 Ga0439432_050519
870 Ga0439449_0001013
871 Ga0439449_0001121
872 Ga0439449_0006134
873 Ga0439452_002686
874 Ga0439457_008405
875 Ga0439462_0001668
876 Ga0439462_0010416
877 Ga0450911_000587
878 Ga0450923_005713
879 Ga0450923_006363
880 Ga0450898_006794
881 Ga0439446_0031741
882 Ga0450908_004895
883 Ga0439434_0001332
884 Ga0439434_0018709
885 Ga0439435_0023653
886 Ga0450893_0001152
887 Ga0451577_0001937
888 Ga0451577_0009638
889 Ga0451577_0015798
890 Ga0451577_0031401
891 Ga0466969_0000046
892 Ga0466969_0001773
893 Ga0453683_0005625
894 Ga0466966_0001000
895 Ga0466966_0013088
896 Ga0466966_0096752
897 Ga0466961_0126833
898 Ga0466961_0288052
899 Ga0466963_0005286
900 Ga0453684_0001952
901 Ga0453684_0051712
902 Ga0453684_0071561
903 Ga0453684_0115001
904 Ga0453684_0289265
905 Ga0466971_0031322
906 Ga0466971_0036705
907 Ga0466970_0011195
908 Ga0466970_0102515
909 Ga0466957_0031237
910 Ga0466959_0000174
911 Ga0466959_0086675
912 Ga0451576_0002149
913 Ga0451576_0002636
914 Ga0451576_0020764
915 Ga0451576_0023215
916 Ga0466958_0091461
917 Ga0495629_0062461
918 Ga0495638_0044859
919 Ga0495639_0004988
920 Ga0495610_0012536
921 Ga0495616_0006492
922 Ga0495631_0000152
923 Ga0495637_0004657
924 Ga0495663_0003986
925 Ga0495654_0007192
926 Ga0495621_0027435
927 Ga0495621_0063373
928 Ga0495656_0001340
929 Ga0495625_0000294
930 Ga0495625_0091666
931 Ga0495588_0017211
932 Ga0495588_0019118
933 Ga0495658_0019881
934 Ga0495669_0032082
935 Ga0495671_0003236
936 Ga0495676_0109602
937 Ga0495593_0000791
938 Ga0495614_0002171
939 Ga0496101_0045390
940 Ga0496103_0052635
941 Ga0496104_0050946
942 Ga0496105_0001585
943 Ga0496106_0040696
944 Ga0496107_0173488
945 Ga0496110_0216539
946 Ga0496114_0033617
947 Ga0496114_0161175
948 Ga0496116_0003140
949 Ga0496117_0022542
950 Ga0496117_0050080
951 Ga0496118_0059458
952 Ga0496118_0104106
953 Ga0496121_0031543
954 Ga0496122_0000319
955 Ga0496123_0000117
956 Ga0496124_0084575
957 Ga0496125_0009172
958 Ga0496125_0034190
959 Ga0496125_0043380
960 Ga0496125_0070682
961 Ga0501031_0003235
962 Ga0501041_0040788
963 Ga0501043_0152410
964 Ga0501046_0011663
965 Ga0501046_0025780
966 Ga0501047_0121039
967 Ga0501048_0066070
968 Ga0501072_0032680
969 Ga0501076_0040333
970 Ga0501079_0024027
971 Ga0501080_0008893
972 Ga0501080_0113815
973 Ga0501080_0207553
974 Ga0501081_0087107
975 Ga0501083_0043166
976 Ga0501263_002309
977 Ga0501266_003697
978 Ga0501035_0076889
979 Ga0501035_0254047
980 Ga0501044_0213810
981 nmdc:mga03n38_22363_c1
982 nmdc:mga03n38_29387_c1
983 nmdc:mga03n38_59432_c1
984 nmdc:mga00v17_21270_c1
985 nmdc:mga00v17_47249_c1
986 nmdc:mga0k408_12238_c1
987 nmdc:mga0k408_17555_c1
988 nmdc:mga0k408_47406_c1
989 nmdc:mga0k408_48696_c1
990 nmdc:mga0k408_90472_c1
991 nmdc:mga0k408_96567_c1
992 nmdc:mga07m45_16177_c2
993 nmdc:mga07m45_85986_c1
994 nmdc:mga05p37_72983_c1
995 Ga0500610_0018724
996 Ga0500643_010671
997 Ga0500651_0000046
998 Ga0500571_000155
999 Ga0500593_001378
1000 Ga0500607_001588
1001 Ga0500658_0000139
1002 Ga0500658_0000438
1003 Ga0500559_0019800
1004 Ga0500568_0007359
1005 Ga0500627_0000658
1006 Ga0500636_0076214
1007 Ga0500645_001417
1008 Ga0500645_002171
1009 Ga0501084_0030885
1010 Ga0501084_0035376
1011 2511246914
1012 2513229459
1013 2548499185
1014 2587725270
1015 2587731373
1016 2599620703
1017 2599674002
1018 2599678681
1019 2599690214
1020 2643866018
1021 2643994016
1022 2644057774
1023 2644072140
1024 2644161488
1025 2644292830
1026 2644324209
1027 2644399493
1028 2644465063
1029 2644647848
1030 2722881773
1031 2738720552
1032 2738884126
1033 2739242043
1034 2739250217
1035 2739279751
1036 2739354223
1037 2816470657
1038 2819601232
1039 2831269357
1040 2838055353
1041 2839144604
1042 2842682721
1043 2842721639
1044 2842737666
1045 2842749612
1046 2881104775
1047 2885197143
1048 2885201572
1049 2885215717
1050 2894024083
1051 2899927421
1052 2904450850
1053 2904459647
1054 2904549332
1055 2919462625
1056 2919707036
1057 2928042667
1058 2928048906
1059 2928055240
1060 2928068668
1061 2928073419
1062 2928090023
1063 2928121075
1064 2929161508
1065 2929521746
1066 2945914023
1067 2945949590
1068 2945973626
1069 2945990582
1070 2954770758
1071 2974322268
1072 2990714071

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

115

439

0.94

PF07687

M20_dimer

Peptidase dimerisation domain

225

328

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6slf-assembly1.cif.gz_D nalpha-acylglutamine aminoacylase from corynebacterium sp.releasing human axilla odorants co-crystallised with high affinity inhibitor 0.8565 16 376
5vo3-assembly1.cif.gz_A-2 crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) 0.7981 21 376
6slf-assembly1.cif.gz_D nalpha-acylglutamine aminoacylase from corynebacterium sp.releasing human axilla odorants co-crystallised with high affinity inhibitor 0.7858 16 376
1ysj-assembly1.cif.gz_B crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family 0.7794 23 381
4ewt-assembly1.cif.gz_B the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus 0.7775 18 377
ID Description Score Start End Superfamily
4ewtB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9273 18 377 3.40.630.10
1ysjA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9182 23 377 3.40.630.10
af_A0A0R0IPM1_21_184_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9116 18 136 3.40.630.10
4ewtB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8998 18 377 3.40.630.10
2q43A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8939 16 381 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A847DRM8-F1-model_v4 Amidohydrolase 0.9873 14 163 GO:0016787
AF-A0A7X3Z8V1-F1-model_v4 Amidohydrolase 0.9832 20 188 GO:0016787
AF-A0A2E9A2V8-F1-model_v4 Peptidase M20 0.9777 19 167 GO:0016787
AF-A0A7H4PLC3-F1-model_v4 N-acyl-L-amino acid amidohydrolase (EC 3.5.1.14) 0.9756 23 191 GO:0004046
AF-A0A2W5QAW2-F1-model_v4 Amidohydrolase 0.9691 21 178 GO:0016787

Map