F460754

General Info

Members Datasets Scaffolds Average Seq Length
536 383 1072 412

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10015867|Ga0070681_100158673
Length 470
Sequence MGSFFSRVRFVDTRKRFGKFHKIVIANPAWAGLPNRRAVRYSVRNIRFLAEDFAHVRTFDRFFAGPYLVTDGTPSRPYARSAMAYVLAGGRGSRLLELTDKRAKPAVYFGCKSRIIDFALSNALNSGIRHIGVATQYKAHSLIRHLQRGWNFLRPERNESFDILPASQRVSETEWYAGTADAVYQNIDIIESYAPRHIIILAGDHIYKMDYEPMLQQHVAQEADVTVGCLEVPLAEAQAFGVMHVDASDRILAFVEKPKDPPSMPGKPDRALASIGIYVFDTKFLFDQLRRDAADPNSARDFGKDIIPYLVRNAKAVAHPYSRSCVRSAVQRHSYWRDVGTLDAYWSANLDLTDVLPELDLYDRHWPIWSYAEITPPAKFVYDVDGRRGTAISSLVSGGCIVSGATVIRSLLFTGTYLHSYSRVENAVILPYIPAGLVVGEDPALDAQRFRRTESGICLITKPMIDQLQA

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
229 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
234 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
238 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
252 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
253 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
254 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
255 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
256 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
257 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
258 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
259 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
260 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
261 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
265 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
266 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
267 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
268 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
269 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
270 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
271 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
272 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
273 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
274 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
275 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
276 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
277 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
278 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
279 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
280 2738543024 Aminobacter sp. AP02 Isolate Unclassified
281 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
282 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
283 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
284 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
285 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
286 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
287 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
288 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
289 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
290 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
291 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
292 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
293 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
294 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
295 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
296 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
297 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
298 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
299 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
300 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
301 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
302 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
303 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
304 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
305 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
306 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
307 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
308 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
309 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
310 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
311 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
312 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
313 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
314 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
315 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
316 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
317 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
318 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
319 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
320 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
321 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
322 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
323 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
324 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
325 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
326 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
327 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
328 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
329 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
330 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
331 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
332 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
333 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
334 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
335 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
336 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
337 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
338 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
339 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
340 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
341 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
342 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
343 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
344 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
345 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
346 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
347 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
348 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
349 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
350 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
351 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
352 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
353 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
354 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
355 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
356 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
357 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
358 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
359 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
360 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
361 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
362 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
363 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
364 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
365 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
366 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
367 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
368 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
369 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
370 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
371 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
372 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
373 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
374 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
375 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
376 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
377 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
378 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
379 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
380 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
381 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
382 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
383 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.61
Metatranscriptomes 0
Isolates 22.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.46
Nodule 17.72
Rhizoplane 2.24
Rhizosphere 65.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10015867 3300005458 Bacteria 7510
2 JGI24740J21852_10037570 3300001979 Bacteria 1493
3 JGI24739J22299_10018324 3300001989 Bacteria 2517
4 JGI24751J29686_10000002 3300002459 Bacteria 160619
5 JGI25156J39149_1001723 3300002705 Bacteria 8780
6 JGI25157J39369_1001529 3300002741 Bacteria 8392
7 JGI25406J46586_10000403 3300003203 Bacteria 19890
8 JGI25406J46586_10014481 3300003203 Bacteria 3353
9 JGI25165J46597_1000016 3300003214 Bacteria 377866
10 Ga0055542_1001310 3300003762 Bacteria 13179
11 Ga0065707_10082484 3300005295 Bacteria 14611
12 Ga0070658_10051154 3300005327 Bacteria 3348
13 Ga0070658_10091862 3300005327 Bacteria 2502
14 Ga0070676_10109368 3300005328 Bacteria 1719
15 Ga0070670_100000012 3300005331 Bacteria 256314
16 Ga0070670_100000863 3300005331 Bacteria 23798
17 Ga0070670_100002996 3300005331 Bacteria 13980
18 Ga0070670_100013630 3300005331 Bacteria 6966
19 Ga0070670_100121101 3300005331 Bacteria 2257
20 Ga0070677_10000500 3300005333 Bacteria 13513
21 Ga0070666_10013035 3300005335 Bacteria 5264
22 Ga0070660_100033819 3300005339 Bacteria 3857
23 Ga0070668_100000004 3300005347 Bacteria 189408
24 Ga0070669_100000041 3300005353 Bacteria 127426
25 Ga0070669_100001204 3300005353 Bacteria 18831
26 Ga0070669_100023365 3300005353 Bacteria 4427
27 Ga0070675_100000605 3300005354 Bacteria 24695
28 Ga0070671_100000289 3300005355 Bacteria 34220
29 Ga0070671_100000441 3300005355 Bacteria 28883
30 Ga0070671_100016874 3300005355 Bacteria 5907
31 Ga0070674_100003278 3300005356 Bacteria 9053
32 Ga0070674_100013585 3300005356 Bacteria 5038
33 Ga0070674_100202117 3300005356 Bacteria 1535
34 Ga0070674_100212632 3300005356 Bacteria 1500
35 Ga0070673_100010448 3300005364 Bacteria 6286
36 Ga0070659_100027452 3300005366 Bacteria 4387
37 Ga0070667_100000037 3300005367 Bacteria 172343
38 Ga0070667_100014025 3300005367 Bacteria 6624
39 Ga0070714_100215557 3300005435 Bacteria 1762
40 Ga0070713_100013956 3300005436 Bacteria 5948
41 Ga0070713_100052881 3300005436 Bacteria 3364
42 Ga0070713_100065338 3300005436 Bacteria 3056
43 Ga0070711_100032567 3300005439 Bacteria 3466
44 Ga0070663_100166460 3300005455 Bacteria 1701
45 Ga0070678_100006466 3300005456 Bacteria 6881
46 Ga0070678_100109081 3300005456 Bacteria 2162
47 Ga0070681_10082256 3300005458 Bacteria 3175
48 Ga0068867_100012142 3300005459 Bacteria 6085
49 Ga0068867_100012571 3300005459 Bacteria 5986
50 Ga0070679_100033626 3300005530 Bacteria 5078
51 Ga0070679_100073201 3300005530 Bacteria 3418
52 Ga0070679_100145518 3300005530 Bacteria 2348
53 Ga0070672_100011953 3300005543 Bacteria 6069
54 Ga0070696_100049205 3300005546 Bacteria 2927
55 Ga0070665_100018129 3300005548 Bacteria 7063
56 Ga0070665_100080766 3300005548 Bacteria 3257
57 Ga0070665_100195818 3300005548 Bacteria 2022
58 Ga0068855_100002478 3300005563 Bacteria 22773
59 Ga0068857_100015748 3300005577 Bacteria 6616
60 Ga0068856_100044311 3300005614 Bacteria 4378
61 Ga0068856_100123655 3300005614 Bacteria 2590
62 Ga0068859_100007063 3300005617 Bacteria 11405
63 Ga0068859_100009326 3300005617 Bacteria 9906
64 Ga0068859_100056730 3300005617 Bacteria 3943
65 Ga0068864_100000010 3300005618 Bacteria 358723
66 Ga0068864_100272330 3300005618 Bacteria 1578
67 Ga0068861_100047771 3300005719 Bacteria 3232
68 Ga0068863_100004471 3300005841 Bacteria 13781
69 Ga0068863_100015027 3300005841 Bacteria 7437
70 Ga0068858_100000466 3300005842 Bacteria 42207
71 Ga0068858_100058649 3300005842 Bacteria 3560
72 Ga0068860_100000002 3300005843 Bacteria 627849
73 Ga0068860_100000073 3300005843 Bacteria 173235
74 Ga0068860_100142467 3300005843 Bacteria 2305
75 Ga0068862_100000016 3300005844 Bacteria 250031
76 Ga0068862_100001423 3300005844 Bacteria 22170
77 Ga0068862_100002964 3300005844 Bacteria 14824
78 Ga0068862_100289115 3300005844 Bacteria 1505
79 Ga0081455_10001156 3300005937 Bacteria 33081
80 Ga0081455_10104551 3300005937 Bacteria 2265
81 Ga0081455_10171900 3300005937 Bacteria 1650
82 Ga0081540_1015968 3300005983 Bacteria 4730
83 Ga0081539_10003049 3300005985 Bacteria 21640
84 Ga0070717_10038744 3300006028 Bacteria 3875
85 Ga0075363_100000506 3300006048 Bacteria 12473
86 Ga0075364_10001185 3300006051 Bacteria 13972
87 Ga0075362_10000008 3300006177 Bacteria 112391
88 Ga0075369_10003005 3300006186 Bacteria 6100
89 Ga0075366_10000332 3300006195 Bacteria 21695
90 Ga0097621_100001534 3300006237 Bacteria 15825
91 Ga0097621_100256637 3300006237 Bacteria 1532
92 Ga0075370_10000040 3300006353 Bacteria 41531
93 Ga0068871_100000172 3300006358 Bacteria 43437
94 Ga0068871_100011199 3300006358 Bacteria 6573
95 Ga0068871_100153053 3300006358 Bacteria 1968
96 Ga0075428_100140703 3300006844 Bacteria 2624
97 Ga0075430_100015722 3300006846 Bacteria 6447
98 Ga0075434_100084236 3300006871 Bacteria 3178
99 Ga0097620_100007063 3300006931 Bacteria 11405
100 Ga0097620_100009325 3300006931 Bacteria 9906
101 Ga0097620_100056731 3300006931 Bacteria 3943
102 Ga0105240_10002394 3300009093 Bacteria 30190
103 Ga0105240_10004750 3300009093 Bacteria 20518
104 Ga0105245_10201675 3300009098 Bacteria 1911
105 Ga0105243_10065613 3300009148 Bacteria 2917
106 Ga0105242_10137994 3300009176 Bacteria 2113
107 Ga0105248_10000053 3300009177 Bacteria 143972
108 Ga0105248_10051997 3300009177 Bacteria 4597
109 Ga0105248_10126736 3300009177 Bacteria 2880
110 Ga0105249_10068243 3300009553 Bacteria 3279
111 Ga0157378_10035796 3300013297 Bacteria 4393
112 Ga0163162_10192278 3300013306 Bacteria 2168
113 Ga0163163_10082470 3300014325 Bacteria 3219
114 Ga0157380_10000134 3300014326 Bacteria 41479
115 Ga0182008_10007111 3300014497 Bacteria 6197
116 Ga0157376_10183235 3300014969 Bacteria 1916
117 Ga0163161_10076413 3300017792 Bacteria 2458
118 Ga0213874_10005839 3300021377 Bacteria 2888
119 Ga0213876_10048517 3300021384 Bacteria 2243
120 Ga0213875_10001139 3300021388 Bacteria 18280
121 Ga0209026_1000005 3300025250 Bacteria 731387
122 Ga0209148_1000056 3300025254 Bacteria 363380
123 Ga0209759_1000106 3300025256 Bacteria 149959
124 Ga0209233_1000068 3300025261 Bacteria 377969
125 Ga0209455_1000285 3300025272 Bacteria 54489
126 Ga0209051_1004063 3300025303 Bacteria 9221
127 Ga0209257_1030208 3300025304 Bacteria 1753
128 Ga0207682_10002636 3300025893 Bacteria 7984
129 Ga0207692_10010580 3300025898 Bacteria 3893
130 Ga0207710_10110744 3300025900 Bacteria 1303
131 Ga0207688_10115687 3300025901 Bacteria 1561
132 Ga0207680_10009243 3300025903 Bacteria 4878
133 Ga0207647_10030768 3300025904 Bacteria 3460
134 Ga0207645_10005832 3300025907 Bacteria 8881
135 Ga0207705_10049952 3300025909 Bacteria 3010
136 Ga0207707_10020749 3300025912 Bacteria 5739
137 Ga0207707_10064752 3300025912 Bacteria 3182
138 Ga0207695_10011987 3300025913 Bacteria 10431
139 Ga0207695_10264431 3300025913 Bacteria 1617
140 Ga0207693_10004153 3300025915 Bacteria 12285
141 Ga0207663_10024609 3300025916 Bacteria 3469
142 Ga0207657_10013301 3300025919 Bacteria 8072
143 Ga0207657_10046657 3300025919 Bacteria 3794
144 Ga0207657_10119785 3300025919 Bacteria 2166
145 Ga0207652_10039205 3300025921 Bacteria 4020
146 Ga0207681_10000013 3300025923 Bacteria 357411
147 Ga0207681_10001625 3300025923 Bacteria 14491
148 Ga0207681_10011344 3300025923 Bacteria 5476
149 Ga0207650_10000008 3300025925 Bacteria 498534
150 Ga0207650_10000326 3300025925 Bacteria 46321
151 Ga0207650_10001003 3300025925 Bacteria 21229
152 Ga0207659_10005507 3300025926 Bacteria 7681
153 Ga0207687_10226183 3300025927 Bacteria 1476
154 Ga0207700_10048387 3300025928 Bacteria 3157
155 Ga0207644_10000011 3300025931 Bacteria 223950
156 Ga0207644_10000424 3300025931 Bacteria 27437
157 Ga0207690_10017629 3300025932 Bacteria 4365
158 Ga0207709_10020125 3300025935 Bacteria 3761
159 Ga0207669_10002254 3300025937 Bacteria 8197
160 Ga0207669_10046532 3300025937 Bacteria 2564
161 Ga0207669_10130897 3300025937 Bacteria 1724
162 Ga0207669_10162377 3300025937 Bacteria 1580
163 Ga0207691_10000049 3300025940 Bacteria 94813
164 Ga0207711_10006215 3300025941 Bacteria 10089
165 Ga0207711_10036889 3300025941 Bacteria 4149
166 Ga0207711_10078615 3300025941 Bacteria 2878
167 Ga0207711_10176114 3300025941 Bacteria 1943
168 Ga0207679_10125338 3300025945 Bacteria 2051
169 Ga0207667_10004694 3300025949 Bacteria 16723
170 Ga0207667_10415198 3300025949 Bacteria 1369
171 Ga0207712_10028976 3300025961 Bacteria 3709
172 Ga0207668_10000122 3300025972 Bacteria 54614
173 Ga0207668_10013605 3300025972 Bacteria 5018
174 Ga0207668_10144258 3300025972 Bacteria 1835
175 Ga0207640_10004035 3300025981 Bacteria 7931
176 Ga0207658_10000002 3300025986 Bacteria 1364188
177 Ga0207658_10000025 3300025986 Bacteria 182470
178 Ga0207658_10008204 3300025986 Bacteria 7115
179 Ga0207703_10001057 3300026035 Bacteria 26252
180 Ga0207703_10009799 3300026035 Bacteria 7515
181 Ga0207678_10115181 3300026067 Bacteria 2293
182 Ga0207678_10136584 3300026067 Bacteria 2092
183 Ga0207702_10021612 3300026078 Bacteria 5329
184 Ga0207641_10000557 3300026088 Bacteria 41685
185 Ga0207641_10007125 3300026088 Bacteria 9340
186 Ga0207641_10064387 3300026088 Bacteria 3133
187 Ga0207676_10000012 3300026095 Bacteria 353971
188 Ga0207676_10220582 3300026095 Bacteria 1688
189 Ga0207674_10014812 3300026116 Bacteria 8601
190 Ga0207674_10074948 3300026116 Bacteria 3394
191 Ga0207675_100022318 3300026118 Bacteria 5894
192 Ga0207675_100042438 3300026118 Bacteria 4247
193 Ga0268265_10000006 3300028380 Bacteria 466482
194 Ga0268265_10000849 3300028380 Bacteria 28736
195 Ga0268265_10002420 3300028380 Bacteria 14090
196 Ga0268264_10000001 3300028381 Bacteria 1221000
197 Ga0268264_10000120 3300028381 Bacteria 191138
198 Ga0268264_10074689 3300028381 Bacteria 2880
199 Ga0265318_10004967 3300028577 Bacteria 6333
200 Ga0265338_10006711 3300028800 Bacteria 14542
201 Ga0265338_10078184 3300028800 Bacteria 2792
202 Ga0265328_10003792 3300031239 Bacteria 6644
203 Ga0265320_10062514 3300031240 Bacteria 1773
204 Ga0265325_10042651 3300031241 Bacteria 2371
205 Ga0265325_10050947 3300031241 Bacteria 2130
206 Ga0265339_10023123 3300031249 Bacteria 3595
207 Ga0265339_10060562 3300031249 Bacteria 2040
208 Ga0265327_10007946 3300031251 Bacteria 8028
209 Ga0265316_10021301 3300031344 Bacteria 5494
210 Ga0265316_10190047 3300031344 Bacteria 1526
211 Ga0307408_100048163 3300031548 Bacteria 3056
212 Ga0265313_10013165 3300031595 Bacteria 4985
213 Ga0265314_10028015 3300031711 Bacteria 4207
214 Ga0265314_10030964 3300031711 Bacteria 3954
215 Ga0265314_10059937 3300031711 Bacteria 2600
216 Ga0307405_10006227 3300031731 Bacteria 5848
217 Ga0307405_10076885 3300031731 Bacteria 2167
218 Ga0307413_10090061 3300031824 Bacteria 1995
219 Ga0307413_10131598 3300031824 Bacteria 1713
220 Ga0307410_10044209 3300031852 Bacteria 2957
221 Ga0307406_10054295 3300031901 Bacteria 2556
222 Ga0307407_10006887 3300031903 Bacteria 5102
223 Ga0307412_10001365 3300031911 Bacteria 13577
224 Ga0307412_10027709 3300031911 Bacteria 3536
225 Ga0307409_100234830 3300031995 Bacteria 1665
226 Ga0307416_100010692 3300032002 Bacteria 6079
227 Ga0307415_100029346 3300032126 Bacteria 3514
228 Ga0307510_10041475 3300033180 Bacteria 5031
229 Ga0373944_0021439 3300035089 Bacteria 1870
230 Ga0373923_0028874 3300035111 Bacteria 2221
231 Ga0373953_0002266 3300035117 Bacteria 5782
232 Ga0373953_0039785 3300035117 Bacteria 1865
233 Ga0373954_0008602 3300035118 Bacteria 4488
234 Ga0373956_0011867 3300035119 Bacteria 3600
235 Ga0373957_0002105 3300035120 Bacteria 5590
236 Ga0373946_0016941 3300035171 Bacteria 2783
237 Ga0373924_0013636 3300035410 Bacteria 3056
238 Ga0373931_0008252 3300035691 Bacteria 4934
239 Ga0373931_0034403 3300035691 Bacteria 2630
240 Ga0373935_0005848 3300035692 Bacteria 7286
241 Ga0373935_0023300 3300035692 Bacteria 3804
242 Ga0373927_0028829 3300035695 Bacteria 3620
243 Ga0373927_0041734 3300035695 Bacteria 2975
244 Ga0373933_0027463 3300035724 Bacteria 3277
245 Ga0373947_0046720 3300035725 Bacteria 2593
246 Ga0373937_0000312 3300036401 Bacteria 45975
247 Ga0373937_0031997 3300036401 Bacteria 4769
248 Ga0373937_0056432 3300036401 Bacteria 3607
249 Ga0373925_0065346 3300037068 Bacteria 2740
250 Ga0373925_0073261 3300037068 Bacteria 2592
251 Ga0395898_0022622 3300037466 Bacteria 6365
252 Ga0436364_0252111 3300037853 Bacteria 9253
253 Ga0436364_1518815 3300037853 Bacteria 35900
254 Ga0395901_0050057 3300038443 Bacteria 4341
255 Ga0436365_0090053 3300039437 Bacteria 2357
256 Ga0436365_1805499 3300039437 Bacteria 3389
257 Ga0436360_0333527 3300039438 Bacteria 4057
258 Ga0436361_0251163 3300039447 Bacteria 2836
259 Ga0436363_0345584 3300039450 Bacteria 2171
260 Ga0436363_1166451 3300039450 Bacteria 7352
261 Ga0436362_0250154 3300039453 Bacteria 1639
262 Ga0451577_0011282 3300042876 Bacteria 8462
263 Ga0451577_0059376 3300042876 Bacteria 3410
264 Ga0466972_0013486 3300044658 Bacteria 4103
265 Ga0453684_0001014 3300044712 Bacteria 90517
266 Ga0453684_0047993 3300044712 Bacteria 5653
267 Ga0453684_0265872 3300044712 Bacteria 1962
268 Ga0466967_0371718 3300045976 Bacteria 1387
269 Ga0495629_0052423 3300046459 Bacteria 2855
270 Ga0495638_0062922 3300046460 Bacteria 2289
271 Ga0495662_0053762 3300046476 Bacteria 1945
272 Ga0495664_0008025 3300046477 Bacteria 5877
273 Ga0495585_0034993 3300046492 Bacteria 2840
274 Ga0495608_0024937 3300046511 Bacteria 4086
275 Ga0495608_0038798 3300046511 Bacteria 3196
276 Ga0495610_0000527 3300046512 Bacteria 38468
277 Ga0495628_0193241 3300046516 Bacteria 1536
278 Ga0495637_0037246 3300046520 Bacteria 2113
279 Ga0495643_0000027 3300046522 Bacteria 266446
280 Ga0495643_0025873 3300046522 Bacteria 3317
281 Ga0495640_0081850 3300046533 Bacteria 2146
282 Ga0495640_0121929 3300046533 Bacteria 1694
283 Ga0495587_0029876 3300046536 Bacteria 3307
284 Ga0495645_0002014 3300046543 Bacteria 13845
285 Ga0495645_0097649 3300046543 Bacteria 2092
286 Ga0495622_0000566 3300046557 Bacteria 22206
287 Ga0495667_0011135 3300046559 Bacteria 6087
288 Ga0495667_0016988 3300046559 Bacteria 4913
289 Ga0495625_0040966 3300046660 Bacteria 3373
290 Ga0495599_0005757 3300046678 Bacteria 7437
291 Ga0495599_0043980 3300046678 Bacteria 2802
292 Ga0495646_0007807 3300046680 Bacteria 6794
293 Ga0495604_0067379 3300047317 Bacteria 2720
294 Ga0495680_0038995 3300047322 Bacteria 3793
295 Ga0495675_0083963 3300047444 Bacteria 2004
296 Ga0495681_0000102 3300047470 Bacteria 75370
297 Ga0495686_0004233 3300047472 Bacteria 11897
298 Ga0495686_0018453 3300047472 Bacteria 4681
299 Ga0495686_0036627 3300047472 Bacteria 3149
300 Ga0495602_0000195 3300048088 Bacteria 57149
301 Ga0495602_0101950 3300048088 Bacteria 2353
302 Ga0496100_0008367 3300048903 Bacteria 5766
303 Ga0496101_0008317 3300048904 Bacteria 6780
304 Ga0496104_0032561 3300048907 Bacteria 4852
305 Ga0496106_0007764 3300048909 Bacteria 7936
306 Ga0496107_0000473 3300048910 Bacteria 22078
307 Ga0496108_0084372 3300048911 Bacteria 2696
308 Ga0496109_0053690 3300048912 Bacteria 3676
309 Ga0496109_0149249 3300048912 Bacteria 2188
310 Ga0496110_0057720 3300048913 Bacteria 3417
311 Ga0496110_0081669 3300048913 Bacteria 2882
312 Ga0496112_0007768 3300048915 Bacteria 9543
313 Ga0496113_0000241 3300048916 Bacteria 25760
314 Ga0496118_0097394 3300048921 Bacteria 2002
315 Ga0496121_0000031 3300048924 Bacteria 384119
316 Ga0496122_0006557 3300048925 Bacteria 13307
317 Ga0496123_0035943 3300048926 Bacteria 3522
318 Ga0496125_0022459 3300048928 Bacteria 5859
319 Ga0501031_0000104 3300049568 Bacteria 45024
320 Ga0501031_0011297 3300049568 Bacteria 5818
321 Ga0501032_0000008 3300049569 Bacteria 240313
322 Ga0501032_0052913 3300049569 Bacteria 2735
323 Ga0501033_0000012 3300049570 Bacteria 241599
324 Ga0501033_0054691 3300049570 Bacteria 2952
325 Ga0501034_0000035 3300049571 Bacteria 241623
326 Ga0501034_0009529 3300049571 Bacteria 10166
327 Ga0501034_0064066 3300049571 Bacteria 3689
328 Ga0501034_0077302 3300049571 Bacteria 3334
329 Ga0501034_0078510 3300049571 Bacteria 3305
330 Ga0501034_0290354 3300049571 Bacteria 1573
331 Ga0501036_0000006 3300049572 Bacteria 241623
332 Ga0501036_0004724 3300049572 Bacteria 10989
333 Ga0501037_0000072 3300049573 Bacteria 94452
334 Ga0501037_0035932 3300049573 Bacteria 3651
335 Ga0501037_0048548 3300049573 Bacteria 3110
336 Ga0501037_0088794 3300049573 Bacteria 2237
337 Ga0501038_0000007 3300049574 Bacteria 210775
338 Ga0501038_0012015 3300049574 Bacteria 7908
339 Ga0501038_0090139 3300049574 Bacteria 2571
340 Ga0501038_0120726 3300049574 Bacteria 2162
341 Ga0501039_0000012 3300049575 Bacteria 241623
342 Ga0501039_0004953 3300049575 Bacteria 10100
343 Ga0501042_0006052 3300049578 Bacteria 7836
344 Ga0501043_0000211 3300049579 Bacteria 53464
345 Ga0501043_0058059 3300049579 Bacteria 3038
346 Ga0501043_0066668 3300049579 Bacteria 2827
347 Ga0501043_0121263 3300049579 Bacteria 2051
348 Ga0501046_0023978 3300049580 Bacteria 5010
349 Ga0501046_0079145 3300049580 Bacteria 2541
350 Ga0501047_0007361 3300049581 Bacteria 10351
351 Ga0501047_0013458 3300049581 Bacteria 7755
352 Ga0501047_0036759 3300049581 Bacteria 4734
353 Ga0501047_0051297 3300049581 Bacteria 3985
354 Ga0501047_0053241 3300049581 Bacteria 3912
355 Ga0501047_0080081 3300049581 Bacteria 3140
356 Ga0501048_0033951 3300049582 Bacteria 3683
357 Ga0501069_0002147 3300049585 Bacteria 9931
358 Ga0501070_0008858 3300049586 Bacteria 8505
359 Ga0501070_0124535 3300049586 Bacteria 2130
360 Ga0501070_0258523 3300049586 Bacteria 1423
361 Ga0501073_0006521 3300049589 Bacteria 8682
362 Ga0501073_0046151 3300049589 Bacteria 3065
363 Ga0501073_0096703 3300049589 Bacteria 2051
364 Ga0501073_0102625 3300049589 Bacteria 1986
365 Ga0501074_0031381 3300049590 Bacteria 3849
366 Ga0501235_008716 3300049669 Bacteria 2213
367 Ga0501249_000044 3300049679 Bacteria 52592
368 Ga0501079_0017654 3300049741 Bacteria 5450
369 Ga0501080_0004939 3300049742 Bacteria 11876
370 Ga0501080_0164202 3300049742 Bacteria 2050
371 Ga0501083_0004503 3300049744 Bacteria 9843
372 Ga0501083_0048139 3300049744 Bacteria 2878
373 Ga0501241_003814 3300049758 Bacteria 2841
374 Ga0501264_002199 3300049761 Bacteria 1848
375 Ga0501035_0000035 3300049822 Bacteria 166916
376 Ga0501035_0004343 3300049822 Bacteria 13453
377 Ga0501035_0074121 3300049822 Bacteria 3011
378 Ga0501044_0000015 3300049823 Bacteria 241623
379 Ga0501044_0028797 3300049823 Bacteria 5859
380 Ga0501044_0039951 3300049823 Bacteria 4891
381 Ga0501044_0047829 3300049823 Bacteria 4423
382 nmdc:mga03683_15_c1 3300050489 Bacteria 102058
383 nmdc:mga03n38_397_c1 3300050490 Bacteria 10773
384 nmdc:mga00v17_5301_c1 3300050491 Bacteria 6794
385 nmdc:mga0yw44_97741_c1 3300050492 Bacteria 1866
386 nmdc:mga0k408_21_c1 3300050493 Bacteria 107428
387 nmdc:mga0k408_68201_c1 3300050493 Bacteria 2074
388 nmdc:mga06z11_39133_c1 3300050494 Bacteria 2358
389 nmdc:mga07m45_14_c1 3300050496 Bacteria 154035
390 nmdc:mga07m45_63734_c1 3300050496 Bacteria 2090
391 nmdc:mga0n895_91354_c1 3300050512 Bacteria 3047
392 nmdc:mga0sz30_2946_c1 3300050516 Bacteria 6100
393 Ga0495601_0001883 3300053077 Bacteria 11717
394 Ga0495612_0004884 3300053078 Bacteria 5551
395 Ga0500643_000008 3300053087 Bacteria 457931
396 Ga0500643_002856 3300053087 Bacteria 8608
397 Ga0500647_0012561 3300053091 Bacteria 3815
398 Ga0500651_0034421 3300053093 Bacteria 3194
399 Ga0500555_001529 3300053103 Bacteria 7002
400 Ga0500556_0000013 3300053104 Bacteria 243797
401 Ga0500595_000892 3300053119 Bacteria 17000
402 Ga0500618_003282 3300053125 Bacteria 5614
403 Ga0500618_006442 3300053125 Bacteria 3446
404 Ga0500642_0008136 3300053130 Bacteria 3569
405 Ga0500655_000081 3300053133 Bacteria 25123
406 Ga0500568_0000125 3300053139 Bacteria 68806
407 Ga0500590_000198 3300053148 Bacteria 18343
408 Ga0500636_0001280 3300053177 Bacteria 13646
409 Ga0500636_0007674 3300053177 Bacteria 6239
410 Ga0500570_000014 3300053724 Bacteria 52194
411 Ga0500645_000575 3300053730 Bacteria 23790
412 Ga0501084_0001034 3300054114 Bacteria 21610
413 Ga0501084_0036850 3300054114 Bacteria 4086
414 Ga0501084_0082979 3300054114 Bacteria 2690
415 Ga0501082_0002250 3300060353 Bacteria 16900
416 Ga0501082_0083449 3300060353 Bacteria 2757
417 2503203511 2503198000 Bacteria 6884444
418 2509397928 2509276022 Bacteria 6200534
419 2510316507 2510065059 Bacteria 6847884
420 2512929599 2512875016 Bacteria 6529530
421 2513608201 2513237090 Bacteria 7096802
422 2514422848 2513237305 Bacteria 7293571
423 2585263602 2582581305 Bacteria 4895574
424 2588515171 2588253730 Bacteria 6881675
425 2597815901 2597489875 Bacteria 7010078
426 2643774135 2643221550 Bacteria 4619371
427 2644037275 2643221605 Bacteria 4772303
428 2644041185 2643221606 Bacteria 5588032
429 2644394724 2643221671 Bacteria 5496681
430 2694632515 2693429783 Bacteria 7019804
431 2694639754 2693429784 Bacteria 7241525
432 2723577633 2721755686 Bacteria 7343952
433 2739308600 2738543024 Bacteria 5603683
434 2841734959 2841734538 Bacteria 6784580
435 2847672025 2847670302 Bacteria 6165597
436 2856318235 2856314179 Bacteria 6477897
437 2856324203 2856320880 Bacteria 7263508
438 2856345366 2856342000 Bacteria 7176905
439 2856360343 2856356410 Bacteria 6297484
440 2869168114 2869162929 Bacteria 6399702
441 2869281799 2869278585 Bacteria 7077053
442 2871477064 2871474448 Bacteria 6806570
443 2871494135 2871488783 Bacteria 6929816
444 2871498997 2871495908 Bacteria 6935695
445 2874110936 2874109183 Bacteria 6517025
446 2874127766 2874123672 Bacteria 7238285
447 2874140523 2874139085 Bacteria 7021506
448 2876366839 2876363079 Bacteria 6544991
449 2876375293 2876369609 Bacteria 6807521
450 2876427004 2876420981 Bacteria 6687741
451 2878037547 2878035449 Bacteria 6555736
452 2878739469 2878738818 Bacteria 7136951
453 2878756710 2878753008 Bacteria 6922523
454 2878763207 2878760144 Bacteria 6823465
455 2878770185 2878767105 Bacteria 6898628
456 2878796647 2878788777 Bacteria 6567085
457 2881153954 2881147464 Bacteria 7779814
458 2881157660 2881155292 Bacteria 6461656
459 2881862437 2881861095 Bacteria 7128710
460 2882636936 2882632389 Bacteria 8154593
461 2882913514 2882912400 Bacteria 6801539
462 2885311962 2885305155 Bacteria 7348390
463 2885315942 2885312484 Bacteria 6415165
464 2885320942 2885318864 Bacteria 6729568
465 2885331746 2885326080 Bacteria 7134805
466 2885342087 2885334103 Bacteria 7216818
467 2885342702 2885342637 Bacteria 7011821
468 2885352699 2885350715 Bacteria 6787678
469 2888341716 2888337043 Bacteria 6629336
470 2888349008 2888343758 Bacteria 6611049
471 2889021941 2889016732 Bacteria 6700763
472 2894776726 2894772417 Bacteria 5305674
473 2894817544 2894817345 Bacteria 4892941
474 2896255862 2896253425 Bacteria 3418029
475 2903453693 2903448605 Bacteria 7357801
476 2903502361 2903492973 Bacteria 13473544
477 2903524706 2903521522 Bacteria 6525694
478 2903531051 2903528002 Bacteria 6586099
479 2903543798 2903540706 Bacteria 7062119
480 2906418272 2906414383 Bacteria 6580790
481 2919711475 2919709256 Bacteria 4318106
482 2924718998 2924718760 Bacteria 6331356
483 2924741297 2924741084 Bacteria 6661321
484 2924776994 2924776078 Bacteria 7492003
485 2924788299 2924784321 Bacteria 7416538
486 2937838566 2937836603 Bacteria 6811263
487 2937850648 2937848649 Bacteria 6983481
488 2937880299 2937877337 Bacteria 7246526
489 2937976164 2937972304 Bacteria 7532020
490 2937997648 2937994558 Bacteria 7036190
491 2958037760 2958034702 Bacteria 6989922
492 2958047472 2958041894 Bacteria 13082850
493 2958074606 2958071322 Bacteria 6815895
494 2958087435 2958084443 Bacteria 7312792
495 2958104022 2958100919 Bacteria 6800575
496 2958149069 2958144490 Bacteria 6677056
497 2958168122 2958165035 Bacteria 6906348
498 2958175326 2958172287 Bacteria 6716688
499 2961134133 2961127735 Bacteria 7196641
500 2961166587 2961163497 Bacteria 6901077
501 2961173000 2961170736 Bacteria 7072258
502 2963649633 2963644680 Bacteria 6530403
503 2965021410 2965018300 Bacteria 6883036
504 2965121162 2965119406 Bacteria 6956431
505 2967998211 2967996073 Bacteria 6787468
506 2968008863 2968003550 Bacteria 6929263
507 2968019392 2968016561 Bacteria 7022047
508 2968087057 2968083720 Bacteria 7351627
509 2968174992 2968171901 Bacteria 6894245
510 2970472713 2970469710 Bacteria 6969209
511 2970494720 2970489779 Bacteria 6517260
512 2970505594 2970503327 Bacteria 7099517
513 2970529210 2970524798 Bacteria 6840927
514 2970544237 2970540015 Bacteria 6977556
515 2970558051 2970554993 Bacteria 6814252
516 2970596403 2970593180 Bacteria 7073582
517 2977825890 2977821940 Bacteria 6906439
518 2977834859 2977828996 Bacteria 7007971
519 2977869120 2977864932 Bacteria 7534097
520 2977927663 2977922695 Bacteria 6956781
521 2979711939 2979710463 Bacteria 6785254
522 2979810315 2979808191 Bacteria 7179355
523 2987662598 2987659509 Bacteria 6966464
524 2996340112 2996336353 Bacteria 5511628
525 2996352154 2996348954 Bacteria 7239054
526 3004191649 3004188549 Bacteria 6952365
527 3004213943 3004211236 Bacteria 7417683
528 3004223534 3004218560 Bacteria 7421728
529 3004278852 3004275668 Bacteria 7114440
530 3004289524 3004289098 Bacteria 6135450
531 3004339180 3004334049 Bacteria 8449246
532 637079345 637000159 Bacteria 7596297
533 8002288008 8002285264 Bacteria 6717907
534 8004378298 8004374579 Bacteria 6898112
535 8004401386 8004395343 Bacteria 6620908
536 8055623277 8055617313 Bacteria 7548464
537 Ga0070681_10015867
538 JGI24740J21852_10037570
539 JGI24739J22299_10018324
540 JGI24751J29686_10000002
541 JGI25156J39149_1001723
542 JGI25157J39369_1001529
543 JGI25406J46586_10000403
544 JGI25406J46586_10014481
545 JGI25165J46597_1000016
546 Ga0055542_1001310
547 Ga0065707_10082484
548 Ga0070658_10051154
549 Ga0070658_10091862
550 Ga0070676_10109368
551 Ga0070670_100000012
552 Ga0070670_100000863
553 Ga0070670_100002996
554 Ga0070670_100013630
555 Ga0070670_100121101
556 Ga0070677_10000500
557 Ga0070666_10013035
558 Ga0070660_100033819
559 Ga0070668_100000004
560 Ga0070669_100000041
561 Ga0070669_100001204
562 Ga0070669_100023365
563 Ga0070675_100000605
564 Ga0070671_100000289
565 Ga0070671_100000441
566 Ga0070671_100016874
567 Ga0070674_100003278
568 Ga0070674_100013585
569 Ga0070674_100202117
570 Ga0070674_100212632
571 Ga0070673_100010448
572 Ga0070659_100027452
573 Ga0070667_100000037
574 Ga0070667_100014025
575 Ga0070714_100215557
576 Ga0070713_100013956
577 Ga0070713_100052881
578 Ga0070713_100065338
579 Ga0070711_100032567
580 Ga0070663_100166460
581 Ga0070678_100006466
582 Ga0070678_100109081
583 Ga0070681_10082256
584 Ga0068867_100012142
585 Ga0068867_100012571
586 Ga0070679_100033626
587 Ga0070679_100073201
588 Ga0070679_100145518
589 Ga0070672_100011953
590 Ga0070696_100049205
591 Ga0070665_100018129
592 Ga0070665_100080766
593 Ga0070665_100195818
594 Ga0068855_100002478
595 Ga0068857_100015748
596 Ga0068856_100044311
597 Ga0068856_100123655
598 Ga0068859_100007063
599 Ga0068859_100009326
600 Ga0068859_100056730
601 Ga0068864_100000010
602 Ga0068864_100272330
603 Ga0068861_100047771
604 Ga0068863_100004471
605 Ga0068863_100015027
606 Ga0068858_100000466
607 Ga0068858_100058649
608 Ga0068860_100000002
609 Ga0068860_100000073
610 Ga0068860_100142467
611 Ga0068862_100000016
612 Ga0068862_100001423
613 Ga0068862_100002964
614 Ga0068862_100289115
615 Ga0081455_10001156
616 Ga0081455_10104551
617 Ga0081455_10171900
618 Ga0081540_1015968
619 Ga0081539_10003049
620 Ga0070717_10038744
621 Ga0075363_100000506
622 Ga0075364_10001185
623 Ga0075362_10000008
624 Ga0075369_10003005
625 Ga0075366_10000332
626 Ga0097621_100001534
627 Ga0097621_100256637
628 Ga0075370_10000040
629 Ga0068871_100000172
630 Ga0068871_100011199
631 Ga0068871_100153053
632 Ga0075428_100140703
633 Ga0075430_100015722
634 Ga0075434_100084236
635 Ga0097620_100007063
636 Ga0097620_100009325
637 Ga0097620_100056731
638 Ga0105240_10002394
639 Ga0105240_10004750
640 Ga0105245_10201675
641 Ga0105243_10065613
642 Ga0105242_10137994
643 Ga0105248_10000053
644 Ga0105248_10051997
645 Ga0105248_10126736
646 Ga0105249_10068243
647 Ga0157378_10035796
648 Ga0163162_10192278
649 Ga0163163_10082470
650 Ga0157380_10000134
651 Ga0182008_10007111
652 Ga0157376_10183235
653 Ga0163161_10076413
654 Ga0213874_10005839
655 Ga0213876_10048517
656 Ga0213875_10001139
657 Ga0209026_1000005
658 Ga0209148_1000056
659 Ga0209759_1000106
660 Ga0209233_1000068
661 Ga0209455_1000285
662 Ga0209051_1004063
663 Ga0209257_1030208
664 Ga0207682_10002636
665 Ga0207692_10010580
666 Ga0207710_10110744
667 Ga0207688_10115687
668 Ga0207680_10009243
669 Ga0207647_10030768
670 Ga0207645_10005832
671 Ga0207705_10049952
672 Ga0207707_10020749
673 Ga0207707_10064752
674 Ga0207695_10011987
675 Ga0207695_10264431
676 Ga0207693_10004153
677 Ga0207663_10024609
678 Ga0207657_10013301
679 Ga0207657_10046657
680 Ga0207657_10119785
681 Ga0207652_10039205
682 Ga0207681_10000013
683 Ga0207681_10001625
684 Ga0207681_10011344
685 Ga0207650_10000008
686 Ga0207650_10000326
687 Ga0207650_10001003
688 Ga0207659_10005507
689 Ga0207687_10226183
690 Ga0207700_10048387
691 Ga0207644_10000011
692 Ga0207644_10000424
693 Ga0207690_10017629
694 Ga0207709_10020125
695 Ga0207669_10002254
696 Ga0207669_10046532
697 Ga0207669_10130897
698 Ga0207669_10162377
699 Ga0207691_10000049
700 Ga0207711_10006215
701 Ga0207711_10036889
702 Ga0207711_10078615
703 Ga0207711_10176114
704 Ga0207679_10125338
705 Ga0207667_10004694
706 Ga0207667_10415198
707 Ga0207712_10028976
708 Ga0207668_10000122
709 Ga0207668_10013605
710 Ga0207668_10144258
711 Ga0207640_10004035
712 Ga0207658_10000002
713 Ga0207658_10000025
714 Ga0207658_10008204
715 Ga0207703_10001057
716 Ga0207703_10009799
717 Ga0207678_10115181
718 Ga0207678_10136584
719 Ga0207702_10021612
720 Ga0207641_10000557
721 Ga0207641_10007125
722 Ga0207641_10064387
723 Ga0207676_10000012
724 Ga0207676_10220582
725 Ga0207674_10014812
726 Ga0207674_10074948
727 Ga0207675_100022318
728 Ga0207675_100042438
729 Ga0268265_10000006
730 Ga0268265_10000849
731 Ga0268265_10002420
732 Ga0268264_10000001
733 Ga0268264_10000120
734 Ga0268264_10074689
735 Ga0265318_10004967
736 Ga0265338_10006711
737 Ga0265338_10078184
738 Ga0265328_10003792
739 Ga0265320_10062514
740 Ga0265325_10042651
741 Ga0265325_10050947
742 Ga0265339_10023123
743 Ga0265339_10060562
744 Ga0265327_10007946
745 Ga0265316_10021301
746 Ga0265316_10190047
747 Ga0307408_100048163
748 Ga0265313_10013165
749 Ga0265314_10028015
750 Ga0265314_10030964
751 Ga0265314_10059937
752 Ga0307405_10006227
753 Ga0307405_10076885
754 Ga0307413_10090061
755 Ga0307413_10131598
756 Ga0307410_10044209
757 Ga0307406_10054295
758 Ga0307407_10006887
759 Ga0307412_10001365
760 Ga0307412_10027709
761 Ga0307409_100234830
762 Ga0307416_100010692
763 Ga0307415_100029346
764 Ga0307510_10041475
765 Ga0373944_0021439
766 Ga0373923_0028874
767 Ga0373953_0002266
768 Ga0373953_0039785
769 Ga0373954_0008602
770 Ga0373956_0011867
771 Ga0373957_0002105
772 Ga0373946_0016941
773 Ga0373924_0013636
774 Ga0373931_0008252
775 Ga0373931_0034403
776 Ga0373935_0005848
777 Ga0373935_0023300
778 Ga0373927_0028829
779 Ga0373927_0041734
780 Ga0373933_0027463
781 Ga0373947_0046720
782 Ga0373937_0000312
783 Ga0373937_0031997
784 Ga0373937_0056432
785 Ga0373925_0065346
786 Ga0373925_0073261
787 Ga0395898_0022622
788 Ga0436364_0252111
789 Ga0436364_1518815
790 Ga0395901_0050057
791 Ga0436365_0090053
792 Ga0436365_1805499
793 Ga0436360_0333527
794 Ga0436361_0251163
795 Ga0436363_0345584
796 Ga0436363_1166451
797 Ga0436362_0250154
798 Ga0451577_0011282
799 Ga0451577_0059376
800 Ga0466972_0013486
801 Ga0453684_0001014
802 Ga0453684_0047993
803 Ga0453684_0265872
804 Ga0466967_0371718
805 Ga0495629_0052423
806 Ga0495638_0062922
807 Ga0495662_0053762
808 Ga0495664_0008025
809 Ga0495585_0034993
810 Ga0495608_0024937
811 Ga0495608_0038798
812 Ga0495610_0000527
813 Ga0495628_0193241
814 Ga0495637_0037246
815 Ga0495643_0000027
816 Ga0495643_0025873
817 Ga0495640_0081850
818 Ga0495640_0121929
819 Ga0495587_0029876
820 Ga0495645_0002014
821 Ga0495645_0097649
822 Ga0495622_0000566
823 Ga0495667_0011135
824 Ga0495667_0016988
825 Ga0495625_0040966
826 Ga0495599_0005757
827 Ga0495599_0043980
828 Ga0495646_0007807
829 Ga0495604_0067379
830 Ga0495680_0038995
831 Ga0495675_0083963
832 Ga0495681_0000102
833 Ga0495686_0004233
834 Ga0495686_0018453
835 Ga0495686_0036627
836 Ga0495602_0000195
837 Ga0495602_0101950
838 Ga0496100_0008367
839 Ga0496101_0008317
840 Ga0496104_0032561
841 Ga0496106_0007764
842 Ga0496107_0000473
843 Ga0496108_0084372
844 Ga0496109_0053690
845 Ga0496109_0149249
846 Ga0496110_0057720
847 Ga0496110_0081669
848 Ga0496112_0007768
849 Ga0496113_0000241
850 Ga0496118_0097394
851 Ga0496121_0000031
852 Ga0496122_0006557
853 Ga0496123_0035943
854 Ga0496125_0022459
855 Ga0501031_0000104
856 Ga0501031_0011297
857 Ga0501032_0000008
858 Ga0501032_0052913
859 Ga0501033_0000012
860 Ga0501033_0054691
861 Ga0501034_0000035
862 Ga0501034_0009529
863 Ga0501034_0064066
864 Ga0501034_0077302
865 Ga0501034_0078510
866 Ga0501034_0290354
867 Ga0501036_0000006
868 Ga0501036_0004724
869 Ga0501037_0000072
870 Ga0501037_0035932
871 Ga0501037_0048548
872 Ga0501037_0088794
873 Ga0501038_0000007
874 Ga0501038_0012015
875 Ga0501038_0090139
876 Ga0501038_0120726
877 Ga0501039_0000012
878 Ga0501039_0004953
879 Ga0501042_0006052
880 Ga0501043_0000211
881 Ga0501043_0058059
882 Ga0501043_0066668
883 Ga0501043_0121263
884 Ga0501046_0023978
885 Ga0501046_0079145
886 Ga0501047_0007361
887 Ga0501047_0013458
888 Ga0501047_0036759
889 Ga0501047_0051297
890 Ga0501047_0053241
891 Ga0501047_0080081
892 Ga0501048_0033951
893 Ga0501069_0002147
894 Ga0501070_0008858
895 Ga0501070_0124535
896 Ga0501070_0258523
897 Ga0501073_0006521
898 Ga0501073_0046151
899 Ga0501073_0096703
900 Ga0501073_0102625
901 Ga0501074_0031381
902 Ga0501235_008716
903 Ga0501249_000044
904 Ga0501079_0017654
905 Ga0501080_0004939
906 Ga0501080_0164202
907 Ga0501083_0004503
908 Ga0501083_0048139
909 Ga0501241_003814
910 Ga0501264_002199
911 Ga0501035_0000035
912 Ga0501035_0004343
913 Ga0501035_0074121
914 Ga0501044_0000015
915 Ga0501044_0028797
916 Ga0501044_0039951
917 Ga0501044_0047829
918 nmdc:mga03683_15_c1
919 nmdc:mga03n38_397_c1
920 nmdc:mga00v17_5301_c1
921 nmdc:mga0yw44_97741_c1
922 nmdc:mga0k408_21_c1
923 nmdc:mga0k408_68201_c1
924 nmdc:mga06z11_39133_c1
925 nmdc:mga07m45_14_c1
926 nmdc:mga07m45_63734_c1
927 nmdc:mga0n895_91354_c1
928 nmdc:mga0sz30_2946_c1
929 Ga0495601_0001883
930 Ga0495612_0004884
931 Ga0500643_000008
932 Ga0500643_002856
933 Ga0500647_0012561
934 Ga0500651_0034421
935 Ga0500555_001529
936 Ga0500556_0000013
937 Ga0500595_000892
938 Ga0500618_003282
939 Ga0500618_006442
940 Ga0500642_0008136
941 Ga0500655_000081
942 Ga0500568_0000125
943 Ga0500590_000198
944 Ga0500636_0001280
945 Ga0500636_0007674
946 Ga0500570_000014
947 Ga0500645_000575
948 Ga0501084_0001034
949 Ga0501084_0036850
950 Ga0501084_0082979
951 Ga0501082_0002250
952 Ga0501082_0083449
953 2503203511
954 2509397928
955 2510316507
956 2512929599
957 2513608201
958 2514422848
959 2585263602
960 2588515171
961 2597815901
962 2643774135
963 2644037275
964 2644041185
965 2644394724
966 2694632515
967 2694639754
968 2723577633
969 2739308600
970 2841734959
971 2847672025
972 2856318235
973 2856324203
974 2856345366
975 2856360343
976 2869168114
977 2869281799
978 2871477064
979 2871494135
980 2871498997
981 2874110936
982 2874127766
983 2874140523
984 2876366839
985 2876375293
986 2876427004
987 2878037547
988 2878739469
989 2878756710
990 2878763207
991 2878770185
992 2878796647
993 2881153954
994 2881157660
995 2881862437
996 2882636936
997 2882913514
998 2885311962
999 2885315942
1000 2885320942
1001 2885331746
1002 2885342087
1003 2885342702
1004 2885352699
1005 2888341716
1006 2888349008
1007 2889021941
1008 2894776726
1009 2894817544
1010 2896255862
1011 2903453693
1012 2903502361
1013 2903524706
1014 2903531051
1015 2903543798
1016 2906418272
1017 2919711475
1018 2924718998
1019 2924741297
1020 2924776994
1021 2924788299
1022 2937838566
1023 2937850648
1024 2937880299
1025 2937976164
1026 2937997648
1027 2958037760
1028 2958047472
1029 2958074606
1030 2958087435
1031 2958104022
1032 2958149069
1033 2958168122
1034 2958175326
1035 2961134133
1036 2961166587
1037 2961173000
1038 2963649633
1039 2965021410
1040 2965121162
1041 2967998211
1042 2968008863
1043 2968019392
1044 2968087057
1045 2968174992
1046 2970472713
1047 2970494720
1048 2970505594
1049 2970529210
1050 2970544237
1051 2970558051
1052 2970596403
1053 2977825890
1054 2977834859
1055 2977869120
1056 2977927663
1057 2979711939
1058 2979810315
1059 2987662598
1060 2996340112
1061 2996352154
1062 3004191649
1063 3004213943
1064 3004223534
1065 3004278852
1066 3004289524
1067 3004339180
1068 637079345
1069 8002288008
1070 8004378298
1071 8004401386
1072 8055623277

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

83

355

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c8v-assembly1.cif.gz_A crystal structure of putative acetyltransferase (yp_390128.1) from desulfovibrio desulfuricans g20 at 2.28 a resolution 0.9183 324 379
8gpp-assembly1.cif.gz_C acinetobacter baumannii carbonic anhydrase paay 0.9107 328 379
4mzu-assembly1.cif.gz_B crystal structure of fdtd, a bifunctional ketoisomerase/n-acetyltransferase from shewanella denitrificans 0.8493 323 379
5xhw-assembly1.cif.gz_A crystal structure of hddc from yersinia pseudotuberculosis 0.8441 16 286
5xhw-assembly1.cif.gz_A crystal structure of hddc from yersinia pseudotuberculosis 0.834 16 286
ID Description Score Start End Superfamily
af_Q2G1K1_7_207_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9809 339 380 2.160.10.10
af_P80361_292_404_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9487 325 383 2.160.10.10
af_P9WN43_3_286_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9456 16 296 3.90.550.10
5l6sO01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.941 12 296 3.90.550.10
af_Q8H1Q7_218_329_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9374 327 383 2.160.10.10
ID Description Score Start End GO Terms
AF-A0A383CJV2-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9828 143 242 GO:0005978
GO:0008878
AF-A0A4R9WVG3-F1-model_v4 Glucose-1-phosphate adenylyltransferase 0.9697 110 220 GO:0005524
GO:0005978
GO:0008878
AF-A0A383CJV2-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9638 143 242 GO:0005978
GO:0008878
AF-A0A2X4VZ65-F1-model_v4 Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27) 0.9616 148 302 GO:0005524
GO:0005978
GO:0008878
AF-A0A1G0DA34-F1-model_v4 deleted 0.9607 13 304

Map