F460759

General Info

Members Datasets Scaffolds Average Seq Length
536 264 536 80

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_102360187|Ga0068862_1023601872
Length 95
Sequence MRLSPPFDQENTLVAPEDVKRYIEDNLQCQHLEVIGDGHHFEAVIVSEAFVGKSRVQRHQLVYQALGDRMREEIHALSMQTLTPEDWAQRQSTNG

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
165 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
166 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
185 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
186 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
187 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 1.68
Rhizosphere 97.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10083056 3300002077 Bacteria 586
2 Ga0065707_10088911 3300005295 Bacteria 4518
3 Ga0065707_10223166 3300005295 Bacteria 1217
4 Ga0070676_10093043 3300005328 Bacteria 1850
5 Ga0070676_10739153 3300005328 Bacteria 721
6 Ga0070690_100197949 3300005330 Bacteria 1397
7 Ga0070677_10135380 3300005333 Bacteria 1130
8 Ga0070677_10631597 3300005333 Bacteria 596
9 Ga0068869_100001201 3300005334 Bacteria 15225
10 Ga0068869_100105095 3300005334 Bacteria 2141
11 Ga0068869_100342410 3300005334 Bacteria 1217
12 Ga0070666_10152902 3300005335 Bacteria 1610
13 Ga0070680_100206523 3300005336 Bacteria 1657
14 Ga0068868_100016446 3300005338 Bacteria 5494
15 Ga0068868_102041054 3300005338 Bacteria 545
16 Ga0070660_100250485 3300005339 Bacteria 1444
17 Ga0070660_100504870 3300005339 Bacteria 1006
18 Ga0070689_100184257 3300005340 Bacteria 1697
19 Ga0070691_10831995 3300005341 Bacteria 564
20 Ga0070661_100875878 3300005344 Bacteria 740
21 Ga0070692_10148052 3300005345 Bacteria 1335
22 Ga0070692_10213663 3300005345 Bacteria 1136
23 Ga0070692_11076091 3300005345 Bacteria 566
24 Ga0070668_100069650 3300005347 Bacteria 2737
25 Ga0070668_100338036 3300005347 Bacteria 1271
26 Ga0070669_100013100 3300005353 Bacteria 5891
27 Ga0070669_100347616 3300005353 Bacteria 1203
28 Ga0070675_100200676 3300005354 Bacteria 1731
29 Ga0070675_100566650 3300005354 Bacteria 1028
30 Ga0070671_101596208 3300005355 Bacteria 578
31 Ga0070674_100076652 3300005356 Bacteria 2377
32 Ga0070674_100254510 3300005356 Bacteria 1381
33 Ga0070674_100792270 3300005356 Bacteria 818
34 Ga0070673_100008213 3300005364 Bacteria 6930
35 Ga0070673_101067782 3300005364 Bacteria 753
36 Ga0070673_102014731 3300005364 Bacteria 548
37 Ga0070688_100153623 3300005365 Bacteria 1575
38 Ga0070688_100611907 3300005365 Bacteria 835
39 Ga0070688_101267764 3300005365 Bacteria 594
40 Ga0070659_101197030 3300005366 Bacteria 672
41 Ga0070667_100262726 3300005367 Bacteria 1546
42 Ga0070667_102371463 3300005367 Unclassified 500
43 Ga0070710_11128712 3300005437 Unclassified 577
44 Ga0070701_10788746 3300005438 Bacteria 647
45 Ga0070711_101036518 3300005439 Bacteria 705
46 Ga0070705_100178529 3300005440 Bacteria 1436
47 Ga0070705_100289532 3300005440 Bacteria 1169
48 Ga0070705_101166369 3300005440 Unclassified 633
49 Ga0070700_100002644 3300005441 Bacteria 9169
50 Ga0070700_100104867 3300005441 Bacteria 1868
51 Ga0070700_101285437 3300005441 Bacteria 614
52 Ga0070700_101896467 3300005441 Bacteria 515
53 Ga0070694_100012031 3300005444 Bacteria 5372
54 Ga0070694_100022166 3300005444 Bacteria 4067
55 Ga0070694_100501515 3300005444 Bacteria 966
56 Ga0070694_101802521 3300005444 Bacteria 521
57 Ga0070663_100270284 3300005455 Bacteria 1351
58 Ga0070663_100353540 3300005455 Bacteria 1190
59 Ga0070663_100356158 3300005455 Bacteria 1186
60 Ga0070678_100037268 3300005456 Bacteria 3413
61 Ga0070678_100481316 3300005456 Bacteria 1092
62 Ga0070678_101692301 3300005456 Unclassified 595
63 Ga0070662_101492952 3300005457 Bacteria 583
64 Ga0070681_10008547 3300005458 Bacteria 10028
65 Ga0068867_100002479 3300005459 Bacteria 12970
66 Ga0068867_100118237 3300005459 Bacteria 2045
67 Ga0068867_100289971 3300005459 Bacteria 1345
68 Ga0068867_100299756 3300005459 Bacteria 1325
69 Ga0070707_101136796 3300005468 Bacteria 747
70 Ga0070707_102140578 3300005468 Bacteria 527
71 Ga0070699_100213161 3300005518 Bacteria 1720
72 Ga0070679_100056005 3300005530 Bacteria 3928
73 Ga0070684_101514089 3300005535 Bacteria 632
74 Ga0070684_101534076 3300005535 Bacteria 628
75 Ga0070697_100435338 3300005536 Bacteria 1141
76 Ga0070697_100549313 3300005536 Bacteria 1013
77 Ga0070697_101547085 3300005536 Bacteria 593
78 Ga0068853_100077278 3300005539 Bacteria 2908
79 Ga0068853_100258840 3300005539 Bacteria 1599
80 Ga0068853_101081705 3300005539 Bacteria 773
81 Ga0068853_101888237 3300005539 Bacteria 579
82 Ga0070672_100305283 3300005543 Bacteria 1350
83 Ga0070672_100694083 3300005543 Bacteria 891
84 Ga0070686_100128000 3300005544 Bacteria 1753
85 Ga0070686_100245289 3300005544 Bacteria 1306
86 Ga0070695_100006828 3300005545 Bacteria 6757
87 Ga0070695_100160791 3300005545 Bacteria 1576
88 Ga0070695_100592886 3300005545 Bacteria 869
89 Ga0070696_100165850 3300005546 Bacteria 1630
90 Ga0070693_100696614 3300005547 Bacteria 743
91 Ga0070693_101011650 3300005547 Unclassified 629
92 Ga0070665_101149914 3300005548 Bacteria 787
93 Ga0070704_100001376 3300005549 Bacteria 12909
94 Ga0070704_100132799 3300005549 Bacteria 1932
95 Ga0070704_100216923 3300005549 Bacteria 1553
96 Ga0070704_100238206 3300005549 Bacteria 1488
97 Ga0070704_100329025 3300005549 Bacteria 1283
98 Ga0068855_100115321 3300005563 Bacteria 3080
99 Ga0068855_100561934 3300005563 Bacteria 1234
100 Ga0068855_100768514 3300005563 Bacteria 1026
101 Ga0070664_101104595 3300005564 Bacteria 747
102 Ga0070664_101374735 3300005564 Bacteria 667
103 Ga0068857_100129324 3300005577 Bacteria 2277
104 Ga0068857_100574909 3300005577 Bacteria 1063
105 Ga0068857_101635766 3300005577 Bacteria 629
106 Ga0068854_100718308 3300005578 Bacteria 864
107 Ga0068854_101068994 3300005578 Bacteria 718
108 Ga0068856_100346949 3300005614 Bacteria 1503
109 Ga0068856_100526191 3300005614 Bacteria 1203
110 Ga0068856_101532464 3300005614 Bacteria 680
111 Ga0070702_100204672 3300005615 Bacteria 1309
112 Ga0068852_100539922 3300005616 Bacteria 1165
113 Ga0068852_101492691 3300005616 Bacteria 698
114 Ga0068859_100006760 3300005617 Bacteria 11646
115 Ga0068859_100878260 3300005617 Bacteria 982
116 Ga0068859_102090790 3300005617 Bacteria 625
117 Ga0068864_100649452 3300005618 Bacteria 1027
118 Ga0068866_10324014 3300005718 Bacteria 970
119 Ga0068866_10431917 3300005718 Bacteria 857
120 Ga0068866_11099533 3300005718 Bacteria 569
121 Ga0068861_100011165 3300005719 Bacteria 6236
122 Ga0068861_100067026 3300005719 Bacteria 2769
123 Ga0068861_100303966 3300005719 Bacteria 1383
124 Ga0068870_10018126 3300005840 Bacteria 3395
125 Ga0068870_10080947 3300005840 Bacteria 1795
126 Ga0068863_100047153 3300005841 Bacteria 4089
127 Ga0068858_100100764 3300005842 Bacteria 2694
128 Ga0068860_100296315 3300005843 Bacteria 1584
129 Ga0068860_101999845 3300005843 Bacteria 601
130 Ga0068862_100008234 3300005844 Bacteria 8625
131 Ga0068862_101237957 3300005844 Bacteria 746
132 Ga0068862_102360187 3300005844 Bacteria 544
133 Ga0070715_10187572 3300006163 Bacteria 1042
134 Ga0070716_100101773 3300006173 Bacteria 1763
135 Ga0075366_10098718 3300006195 Bacteria 1752
136 Ga0097621_100088777 3300006237 Bacteria 2584
137 Ga0097621_100748888 3300006237 Bacteria 902
138 Ga0068871_100053074 3300006358 Bacteria 3285
139 Ga0068871_100630398 3300006358 Bacteria 977
140 Ga0075428_100060110 3300006844 Bacteria 4161
141 Ga0075428_100073010 3300006844 Bacteria 3747
142 Ga0075428_101055974 3300006844 Bacteria 859
143 Ga0075428_102729426 3300006844 Bacteria 503
144 Ga0075431_100035093 3300006847 Bacteria 5165
145 Ga0075431_100233261 3300006847 Bacteria 1874
146 Ga0075433_11367453 3300006852 Bacteria 613
147 Ga0075434_100811203 3300006871 Bacteria 952
148 Ga0075434_101680102 3300006871 Bacteria 643
149 Ga0075429_100000100 3300006880 Bacteria 47693
150 Ga0075429_100131012 3300006880 Bacteria 2193
151 Ga0075429_100312859 3300006880 Bacteria 1375
152 Ga0075429_101061128 3300006880 Bacteria 708
153 Ga0068865_100004107 3300006881 Bacteria 8751
154 Ga0068865_100341701 3300006881 Bacteria 1210
155 Ga0075436_100021802 3300006914 Bacteria 4396
156 Ga0075436_100157578 3300006914 Bacteria 1600
157 Ga0075436_101215357 3300006914 Bacteria 569
158 Ga0097620_100006760 3300006931 Bacteria 11646
159 Ga0097620_100878330 3300006931 Bacteria 982
160 Ga0097620_102090380 3300006931 Bacteria 625
161 Ga0075435_100689157 3300007076 Bacteria 888
162 Ga0075435_102046701 3300007076 Bacteria 503
163 Ga0099794_10003043 3300007265 Bacteria 6334
164 Ga0099794_10045250 3300007265 Bacteria 2106
165 Ga0099794_10221339 3300007265 Bacteria 972
166 Ga0099794_10750824 3300007265 Unclassified 521
167 Ga0099795_10050231 3300007788 Bacteria 1516
168 Ga0105240_12799507 3300009093 Unclassified 501
169 Ga0111539_10143608 3300009094 Bacteria 2794
170 Ga0111539_10521478 3300009094 Bacteria 1384
171 Ga0111539_10602289 3300009094 Bacteria 1280
172 Ga0111539_11121033 3300009094 Bacteria 914
173 Ga0111539_11747155 3300009094 Bacteria 721
174 Ga0111539_12744915 3300009094 Bacteria 571
175 Ga0105245_10092490 3300009098 Bacteria 2785
176 Ga0105245_10253133 3300009098 Bacteria 1712
177 Ga0105245_10863502 3300009098 Bacteria 945
178 Ga0105245_11540595 3300009098 Bacteria 716
179 Ga0105247_11129967 3300009101 Bacteria 620
180 Ga0105247_11884677 3300009101 Bacteria 500
181 Ga0114129_10023948 3300009147 Bacteria 8652
182 Ga0114129_10104526 3300009147 Bacteria 3914
183 Ga0114129_11243359 3300009147 Bacteria 925
184 Ga0114129_12283132 3300009147 Bacteria 650
185 Ga0105243_10027618 3300009148 Bacteria 4349
186 Ga0105243_10715827 3300009148 Bacteria 978
187 Ga0105243_10837107 3300009148 Bacteria 910
188 Ga0105243_11882075 3300009148 Bacteria 631
189 Ga0105243_12660328 3300009148 Unclassified 540
190 Ga0105241_10005246 3300009174 Bacteria 9569
191 Ga0105241_10058539 3300009174 Bacteria 2959
192 Ga0105241_11352188 3300009174 Bacteria 680
193 Ga0105241_12032009 3300009174 Bacteria 566
194 Ga0105242_10085237 3300009176 Bacteria 2649
195 Ga0105242_10318023 3300009176 Bacteria 1427
196 Ga0105242_10491790 3300009176 Bacteria 1165
197 Ga0105242_10760136 3300009176 Bacteria 955
198 Ga0105242_12503821 3300009176 Bacteria 564
199 Ga0105248_10129960 3300009177 Bacteria 2841
200 Ga0105248_13109156 3300009177 Unclassified 528
201 Ga0105237_10027017 3300009545 Bacteria 5861
202 Ga0105238_10294029 3300009551 Bacteria 1607
203 Ga0105238_13076460 3300009551 Bacteria 500
204 Ga0105249_10012644 3300009553 Bacteria 7443
205 Ga0105249_11255170 3300009553 Bacteria 812
206 Ga0105249_11991192 3300009553 Bacteria 654
207 Ga0099796_10014760 3300010159 Bacteria 2265
208 Ga0105239_10029649 3300010375 Bacteria 6016
209 Ga0105239_10261761 3300010375 Bacteria 1944
210 Ga0105239_10342169 3300010375 Bacteria 1688
211 Ga0105246_12188738 3300011119 Bacteria 538
212 Ga0157369_10577203 3300013105 Bacteria 1161
213 Ga0157374_10067986 3300013296 Bacteria 3351
214 Ga0157374_10084223 3300013296 Bacteria 3022
215 Ga0157374_10246795 3300013296 Bacteria 1756
216 Ga0157374_10366380 3300013296 Bacteria 1434
217 Ga0157378_10142360 3300013297 Bacteria 2228
218 Ga0157378_10513432 3300013297 Bacteria 1199
219 Ga0157378_10937928 3300013297 Bacteria 898
220 Ga0163162_10039189 3300013306 Bacteria 4734
221 Ga0163162_11207751 3300013306 Bacteria 858
222 Ga0163162_11910324 3300013306 Bacteria 680
223 Ga0157372_11496198 3300013307 Bacteria 778
224 Ga0157375_10013590 3300013308 Bacteria 7251
225 Ga0157375_10223414 3300013308 Bacteria 2042
226 Ga0157375_10351011 3300013308 Bacteria 1641
227 Ga0163163_10965491 3300014325 Bacteria 915
228 Ga0157380_10240862 3300014326 Bacteria 1631
229 Ga0157380_11151072 3300014326 Bacteria 817
230 Ga0157380_11806868 3300014326 Bacteria 670
231 Ga0157379_10162822 3300014968 Bacteria 2013
232 Ga0157379_10781332 3300014968 Bacteria 900
233 Ga0157376_10006736 3300014969 Bacteria 8133
234 Ga0157376_10114456 3300014969 Bacteria 2380
235 Ga0157376_11370039 3300014969 Bacteria 738
236 Ga0163161_11690569 3300017792 Bacteria 560
237 Ga0213872_10040424 3300021361 Bacteria 2129
238 Ga0207653_10188103 3300025885 Bacteria 774
239 Ga0207642_10051598 3300025899 Bacteria 1862
240 Ga0207688_10135782 3300025901 Bacteria 1445
241 Ga0207680_10812972 3300025903 Bacteria 670
242 Ga0207685_10124533 3300025905 Bacteria 1136
243 Ga0207645_10168224 3300025907 Bacteria 1436
244 Ga0207645_10882821 3300025907 Bacteria 608
245 Ga0207645_11081684 3300025907 Bacteria 541
246 Ga0207643_10049016 3300025908 Bacteria 2393
247 Ga0207654_11044186 3300025911 Unclassified 595
248 Ga0207707_10301215 3300025912 Bacteria 1386
249 Ga0207660_10310887 3300025917 Bacteria 1256
250 Ga0207662_10299822 3300025918 Bacteria 1068
251 Ga0207657_10331073 3300025919 Bacteria 1203
252 Ga0207652_10024484 3300025921 Bacteria 5009
253 Ga0207646_10720790 3300025922 Bacteria 891
254 Ga0207646_11019347 3300025922 Bacteria 731
255 Ga0207646_11702922 3300025922 Bacteria 541
256 Ga0207694_10192821 3300025924 Bacteria 1656
257 Ga0207659_10579109 3300025926 Bacteria 956
258 Ga0207687_10341882 3300025927 Bacteria 1217
259 Ga0207687_10520806 3300025927 Bacteria 995
260 Ga0207687_10733337 3300025927 Bacteria 840
261 Ga0207687_11179444 3300025927 Bacteria 658
262 Ga0207687_11496661 3300025927 Bacteria 580
263 Ga0207644_11107788 3300025931 Bacteria 665
264 Ga0207690_11215537 3300025932 Bacteria 629
265 Ga0207686_10162877 3300025934 Bacteria 1565
266 Ga0207686_10210507 3300025934 Bacteria 1397
267 Ga0207669_10008311 3300025937 Bacteria 4863
268 Ga0207669_10061995 3300025937 Bacteria 2301
269 Ga0207704_10211273 3300025938 Bacteria 1428
270 Ga0207704_11397781 3300025938 Bacteria 600
271 Ga0207665_10033641 3300025939 Bacteria 3399
272 Ga0207691_10725991 3300025940 Bacteria 837
273 Ga0207711_10012143 3300025941 Bacteria 7163
274 Ga0207689_10004692 3300025942 Bacteria 12333
275 Ga0207689_10119518 3300025942 Bacteria 2168
276 Ga0207689_10310932 3300025942 Bacteria 1307
277 Ga0207689_11704110 3300025942 Unclassified 522
278 Ga0207679_10498340 3300025945 Bacteria 1086
279 Ga0207679_11698440 3300025945 Bacteria 578
280 Ga0207667_10417276 3300025949 Bacteria 1366
281 Ga0207667_10497641 3300025949 Bacteria 1237
282 Ga0207651_10074406 3300025960 Bacteria 2419
283 Ga0207651_10570193 3300025960 Bacteria 986
284 Ga0207712_10908926 3300025961 Bacteria 778
285 Ga0207712_11894887 3300025961 Bacteria 534
286 Ga0207668_10793260 3300025972 Bacteria 838
287 Ga0207640_10351116 3300025981 Bacteria 1185
288 Ga0207640_10698619 3300025981 Bacteria 869
289 Ga0207640_11127634 3300025981 Bacteria 695
290 Ga0207658_10215500 3300025986 Bacteria 1612
291 Ga0207677_10265704 3300026023 Bacteria 1401
292 Ga0207677_10683320 3300026023 Bacteria 909
293 Ga0207703_10217240 3300026035 Bacteria 1707
294 Ga0207703_10507533 3300026035 Bacteria 1133
295 Ga0207703_12238689 3300026035 Bacteria 522
296 Ga0207639_10101399 3300026041 Bacteria 2328
297 Ga0207639_10789649 3300026041 Bacteria 884
298 Ga0207639_11381372 3300026041 Bacteria 661
299 Ga0207678_10333167 3300026067 Bacteria 1307
300 Ga0207678_10581766 3300026067 Bacteria 981
301 Ga0207678_10706938 3300026067 Bacteria 887
302 Ga0207708_10120724 3300026075 Bacteria 2042
303 Ga0207708_10864237 3300026075 Bacteria 781
304 Ga0207641_10115443 3300026088 Bacteria 2387
305 Ga0207648_10025233 3300026089 Bacteria 5296
306 Ga0207648_10077639 3300026089 Bacteria 2895
307 Ga0207648_10087948 3300026089 Bacteria 2712
308 Ga0207676_10721719 3300026095 Bacteria 967
309 Ga0207674_10014256 3300026116 Bacteria 8784
310 Ga0207674_10687025 3300026116 Bacteria 988
311 Ga0207675_100051988 3300026118 Bacteria 3823
312 Ga0207675_100520806 3300026118 Bacteria 1185
313 Ga0207683_10407048 3300026121 Bacteria 1252
314 Ga0207683_10637822 3300026121 Bacteria 987
315 Ga0207698_10611580 3300026142 Bacteria 1075
316 Ga0207698_11104472 3300026142 Bacteria 806
317 Ga0209179_1018901 3300027512 Bacteria 1321
318 Ga0209588_1131579 3300027671 Bacteria 798
319 Ga0209588_1161715 3300027671 Bacteria 707
320 Ga0209588_1167637 3300027671 Bacteria 692
321 Ga0207428_10585644 3300027907 Bacteria 805
322 Ga0207428_11242888 3300027907 Bacteria 517
323 Ga0268266_10708608 3300028379 Bacteria 970
324 Ga0268266_11694466 3300028379 Bacteria 607
325 Ga0268265_11880038 3300028380 Bacteria 605
326 Ga0268265_12440684 3300028380 Bacteria 529
327 Ga0268264_10036231 3300028381 Bacteria 4063
328 Ga0268264_10366661 3300028381 Bacteria 1376
329 Ga0268264_12519053 3300028381 Unclassified 520
330 Ga0265338_10740264 3300028800 Bacteria 676
331 Ga0307406_11161759 3300031901 Bacteria 669
332 Ga0307412_10233865 3300031911 Bacteria 1417
333 Ga0307416_103652228 3300032002 Bacteria 515
334 Ga0307411_10388576 3300032005 Bacteria 1150
335 Ga0316593_10173917 3300032168 Bacteria 790
336 Ga0373926_0001323 3300035083 Bacteria 7478
337 Ga0373934_0000473 3300035086 Bacteria 14038
338 Ga0373934_0005347 3300035086 Bacteria 4755
339 Ga0373934_0025114 3300035086 Bacteria 2306
340 Ga0373934_0236331 3300035086 Bacteria 754
341 Ga0373944_0075306 3300035089 Bacteria 1106
342 Ga0373923_0128362 3300035111 Bacteria 1138
343 Ga0373936_0002252 3300035113 Bacteria 7206
344 Ga0373936_0067515 3300035113 Bacteria 1469
345 Ga0373936_0388246 3300035113 Bacteria 639
346 Ga0373953_0010158 3300035117 Bacteria 3263
347 Ga0373953_0464989 3300035117 Bacteria 559
348 Ga0373954_0000088 3300035118 Bacteria 31362
349 Ga0373954_0000674 3300035118 Bacteria 13089
350 Ga0373954_0002148 3300035118 Bacteria 8184
351 Ga0373954_0060141 3300035118 Bacteria 1791
352 Ga0373954_0102339 3300035118 Bacteria 1383
353 Ga0373954_0287513 3300035118 Bacteria 810
354 Ga0373956_0000957 3300035119 Bacteria 12019
355 Ga0373956_0049234 3300035119 Bacteria 1889
356 Ga0373956_0071572 3300035119 Bacteria 1582
357 Ga0373957_0019860 3300035120 Bacteria 2368
358 Ga0373957_0036413 3300035120 Bacteria 1833
359 Ga0373957_0310690 3300035120 Bacteria 669
360 Ga0373957_0483128 3300035120 Bacteria 538
361 Ga0373943_0010754 3300035170 Bacteria 4107
362 Ga0373946_0035596 3300035171 Bacteria 2015
363 Ga0373946_0680943 3300035171 Bacteria 537
364 Ga0373955_0005223 3300035172 Bacteria 5820
365 Ga0373955_0006289 3300035172 Bacteria 5406
366 Ga0373955_0428521 3300035172 Bacteria 805
367 Ga0373955_0500041 3300035172 Bacteria 742
368 Ga0373924_0010125 3300035410 Bacteria 3471
369 Ga0373935_0003667 3300035692 Bacteria 8953
370 Ga0373935_0023441 3300035692 Bacteria 3793
371 Ga0373935_1107121 3300035692 Bacteria 589
372 Ga0373927_0023672 3300035695 Bacteria 4020
373 Ga0373933_0000611 3300035724 Bacteria 22317
374 Ga0373933_0002313 3300035724 Bacteria 10829
375 Ga0373933_0030051 3300035724 Bacteria 3144
376 Ga0373933_0093454 3300035724 Bacteria 1859
377 Ga0373933_0906086 3300035724 Bacteria 580
378 Ga0373947_0898383 3300035725 Bacteria 605
379 Ga0373947_1215191 3300035725 Bacteria 513
380 Ga0373937_0001313 3300036401 Bacteria 20818
381 Ga0373937_0003380 3300036401 Bacteria 13395
382 Ga0373937_0028552 3300036401 Bacteria 5049
383 Ga0373937_0060602 3300036401 Bacteria 3477
384 Ga0373937_0327101 3300036401 Bacteria 1450
385 Ga0373937_0863291 3300036401 Bacteria 853
386 Ga0373937_1359178 3300036401 Bacteria 658
387 Ga0373937_1376068 3300036401 Bacteria 653
388 Ga0373925_0038153 3300037068 Bacteria 3550
389 Ga0373925_1647403 3300037068 Bacteria 524
390 Ga0436361_1108147 3300039447 Bacteria 10468
391 Ga0439441_033647 3300042001 Bacteria 1004
392 Ga0439443_026695 3300042003 Bacteria 936
393 Ga0439435_0087321 3300042436 Bacteria 943
394 Ga0453683_0300205 3300044673 Bacteria 1027
395 Ga0451576_0000013 3300045051 Bacteria 665120
396 Ga0451576_0279946 3300045051 Bacteria 1744
397 Ga0451576_0298398 3300045051 Bacteria 1685
398 Ga0495592_0004566 3300046454 Bacteria 10141
399 Ga0495592_0010390 3300046454 Bacteria 7022
400 Ga0495592_0014717 3300046454 Bacteria 5939
401 Ga0495592_0680864 3300046454 Bacteria 620
402 Ga0495629_0026088 3300046459 Bacteria 4153
403 Ga0495641_0003418 3300046461 Bacteria 11897
404 Ga0495651_0000274 3300046462 Bacteria 40100
405 Ga0495651_0001676 3300046462 Bacteria 17133
406 Ga0495651_0633566 3300046462 Bacteria 672
407 Ga0495653_0563577 3300046463 Bacteria 703
408 Ga0495653_0766730 3300046463 Bacteria 582
409 Ga0495580_0026413 3300046472 Bacteria 4233
410 Ga0495582_0044561 3300046473 Bacteria 2443
411 Ga0495582_0136763 3300046473 Bacteria 1387
412 Ga0495639_0080842 3300046475 Bacteria 1513
413 Ga0495662_0044313 3300046476 Bacteria 2148
414 Ga0495664_0003652 3300046477 Bacteria 8387
415 Ga0495664_0263531 3300046477 Bacteria 1042
416 Ga0495664_0315072 3300046477 Bacteria 944
417 Ga0495584_0211268 3300046491 Bacteria 986
418 Ga0495594_0699664 3300046499 Bacteria 573
419 Ga0495608_0040303 3300046511 Bacteria 3129
420 Ga0495608_0152348 3300046511 Bacteria 1473
421 Ga0495618_0422599 3300046514 Bacteria 812
422 Ga0495628_0003354 3300046516 Bacteria 14318
423 Ga0495628_0018527 3300046516 Bacteria 5764
424 Ga0495628_0022320 3300046516 Bacteria 5199
425 Ga0495630_0014088 3300046517 Bacteria 5819
426 Ga0495630_0027336 3300046517 Bacteria 4231
427 Ga0495630_0189963 3300046517 Bacteria 1567
428 Ga0495630_0225063 3300046517 Bacteria 1432
429 Ga0495666_0031602 3300046526 Bacteria 2593
430 Ga0495666_0045620 3300046526 Bacteria 2114
431 Ga0495666_0485347 3300046526 Bacteria 552
432 Ga0495642_0352477 3300046528 Bacteria 647
433 Ga0495652_0041597 3300046529 Bacteria 3966
434 Ga0495652_0365141 3300046529 Bacteria 1030
435 Ga0495640_0011433 3300046533 Bacteria 6830
436 Ga0495640_0108132 3300046533 Bacteria 1819
437 Ga0495586_0135049 3300046535 Bacteria 1382
438 Ga0495586_0156822 3300046535 Bacteria 1282
439 Ga0495586_0170314 3300046535 Bacteria 1230
440 Ga0495587_0008999 3300046536 Bacteria 6409
441 Ga0495587_0031556 3300046536 Bacteria 3207
442 Ga0495587_0352629 3300046536 Bacteria 820
443 Ga0495598_0041052 3300046537 Bacteria 1352
444 Ga0495621_0089448 3300046539 Bacteria 1159
445 Ga0495645_0057927 3300046543 Bacteria 2811
446 Ga0495645_0692431 3300046543 Bacteria 619
447 Ga0495622_0004696 3300046557 Bacteria 6334
448 Ga0495667_0069915 3300046559 Bacteria 2290
449 Ga0495667_0071527 3300046559 Bacteria 2262
450 Ga0495667_0159592 3300046559 Bacteria 1450
451 Ga0495634_0004750 3300046642 Bacteria 10569
452 Ga0495634_0012881 3300046642 Bacteria 6053
453 Ga0495635_0007265 3300046663 Bacteria 7738
454 Ga0495635_0543350 3300046663 Bacteria 762
455 Ga0495635_0804672 3300046663 Bacteria 605
456 Ga0495657_0009194 3300046675 Bacteria 7501
457 Ga0495657_0364488 3300046675 Bacteria 854
458 Ga0495657_0626597 3300046675 Bacteria 621
459 Ga0495599_0179392 3300046678 Bacteria 1306
460 Ga0495599_0329793 3300046678 Bacteria 917
461 Ga0495647_0022043 3300046681 Bacteria 2299
462 Ga0495658_0008852 3300046683 Bacteria 5004
463 Ga0495658_0177750 3300046683 Bacteria 1319
464 Ga0495658_0727960 3300046683 Bacteria 635
465 Ga0495658_0755977 3300046683 Bacteria 622
466 Ga0495669_0128804 3300046684 Bacteria 1190
467 Ga0495613_0044134 3300046689 Bacteria 3298
468 Ga0495624_0175201 3300046690 Bacteria 1308
469 Ga0495624_0965513 3300046690 Bacteria 500
470 Ga0495600_0001253 3300046809 Bacteria 13976
471 Ga0495581_0458568 3300047315 Bacteria 742
472 Ga0495604_0003259 3300047317 Bacteria 12969
473 Ga0495604_0270249 3300047317 Bacteria 1152
474 Ga0495604_0895382 3300047317 Bacteria 554
475 Ga0495636_0047899 3300047318 Bacteria 1785
476 Ga0495674_0002852 3300047319 Bacteria 16784
477 Ga0495680_0009905 3300047322 Bacteria 8542
478 Ga0495680_0039477 3300047322 Bacteria 3765
479 Ga0495680_0189082 3300047322 Bacteria 1482
480 Ga0495675_0008097 3300047444 Bacteria 6504
481 Ga0495675_0123013 3300047444 Bacteria 1615
482 Ga0495684_0057947 3300047471 Bacteria 2951
483 Ga0495684_0183219 3300047471 Bacteria 1551
484 Ga0495684_0335795 3300047471 Bacteria 1077
485 Ga0496102_0230026 3300048905 Bacteria 1748
486 Ga0496104_1201226 3300048907 Bacteria 662
487 Ga0496106_0132300 3300048909 Bacteria 1957
488 Ga0496108_0540379 3300048911 Bacteria 1017
489 Ga0496109_0568382 3300048912 Bacteria 1069
490 Ga0496110_0410563 3300048913 Bacteria 1234
491 Ga0496113_1468188 3300048916 Bacteria 527
492 Ga0496114_1336238 3300048917 Bacteria 604
493 Ga0496115_0100198 3300048918 Bacteria 2375
494 Ga0501299_234072 3300049522 Bacteria 501
495 Ga0501037_0068291 3300049573 Bacteria 2588
496 Ga0501039_0550755 3300049575 Bacteria 905
497 Ga0501040_0868647 3300049576 Bacteria 653
498 Ga0501042_0049095 3300049578 Bacteria 3010
499 Ga0501080_0069646 3300049742 Bacteria 3272
500 Ga0501080_0726776 3300049742 Bacteria 875
501 Ga0501083_0343295 3300049744 Bacteria 971
502 Ga0501045_1279177 3300049824 Bacteria 534
503 nmdc:mga0k408_487168_c1 3300050493 Bacteria 731
504 nmdc:mga05p37_1059527_c1 3300050507 Bacteria 854
505 nmdc:mga05p37_1255_c1 3300050507 Bacteria 29442
506 nmdc:mga05p37_715074_c1 3300050507 Bacteria 1110
507 nmdc:mga05p37_86783_c1 3300050507 Bacteria 3857
508 nmdc:mga09592_109_c1 3300050508 Bacteria 51482
509 nmdc:mga09592_213946_c1 3300050508 Bacteria 1670
510 nmdc:mga09592_60104_c1 3300050508 Bacteria 3213
511 nmdc:mga06r32_47758_c1 3300050510 Bacteria 4090
512 nmdc:mga08y16_1619262_c1 3300050511 Bacteria 605
513 nmdc:mga08y16_41967_c1 3300050511 Bacteria 4791
514 nmdc:mga08y16_443537_c1 3300050511 Bacteria 1324
515 nmdc:mga0n895_1370186_c1 3300050512 Bacteria 676
516 nmdc:mga0n895_511118_c1 3300050512 Bacteria 1209
517 nmdc:mga0rr50_130945_c1 3300050513 Bacteria 2008
518 nmdc:mga0rr50_305052_c1 3300050513 Bacteria 1332
519 nmdc:mga08x19_1083327_c1 3300050514 Bacteria 569
520 nmdc:mga08x19_597499_c1 3300050514 Bacteria 782
521 nmdc:mga08x19_767164_c1 3300050514 Bacteria 685
522 Ga0495601_0003245 3300053077 Bacteria 9294
523 Ga0495601_0062710 3300053077 Bacteria 2361
524 Ga0495601_0152612 3300053077 Bacteria 1508
525 Ga0495601_0315962 3300053077 Bacteria 1017
526 Ga0495601_0522529 3300053077 Bacteria 765
527 Ga0495595_0000266 3300053084 Bacteria 20675
528 Ga0495595_0256766 3300053084 Bacteria 876
529 Ga0495619_0013952 3300053085 Bacteria 5069
530 Ga0495619_0178963 3300053085 Bacteria 1467
531 Ga0495619_0306810 3300053085 Bacteria 1099
532 Ga0495619_0616234 3300053085 Bacteria 742
533 Ga0500566_0093457 3300053094 Bacteria 1659
534 Ga0501084_1089978 3300054114 Bacteria 671
535 Ga0590075_050707 3300059424 Bacteria 1065
536 Ga0501082_0767071 3300060353 Bacteria 844

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005536 Ga0070697_101547085 Ga0070697_1015470852 77
2 3300026035 Ga0207703_12238689 Ga0207703_122386891 77
3 3300035725 Ga0373947_0898383 Ga0373947_0898383_88_321 77
4 3300046477 Ga0495664_0263531 Ga0495664_0263531_448_681 77
5 3300048918 Ga0496115_0100198 Ga0496115_0100198_196_432 77
6 3300005330 Ga0070690_100197949 Ga0070690_1001979492 78
7 3300005365 Ga0070688_100611907 Ga0070688_1006119072 78
8 3300005437 Ga0070710_11128712 Ga0070710_111287121 78
9 3300005438 Ga0070701_10788746 Ga0070701_107887462 78
10 3300005468 Ga0070707_102140578 Ga0070707_1021405781 78
11 3300005536 Ga0070697_100435338 Ga0070697_1004353382 78
12 3300005536 Ga0070697_100549313 Ga0070697_1005493132 78
13 3300005544 Ga0070686_100128000 Ga0070686_1001280002 78
14 3300005549 Ga0070704_100132799 Ga0070704_1001327991 78
15 3300005617 Ga0068859_100878260 Ga0068859_1008782602 78
16 3300006163 Ga0070715_10187572 Ga0070715_101875722 78
17 3300006173 Ga0070716_100101773 Ga0070716_1001017733 78
18 3300006871 Ga0075434_101680102 Ga0075434_1016801022 78
19 3300006880 Ga0075429_100312859 Ga0075429_1003128592 78
20 3300006914 Ga0075436_100021802 Ga0075436_1000218024 78
21 3300006914 Ga0075436_100157578 Ga0075436_1001575783 78
22 3300006931 Ga0097620_100878330 Ga0097620_1008783302 78
23 3300007265 Ga0099794_10003043 Ga0099794_100030435 78
24 3300007265 Ga0099794_10045250 Ga0099794_100452503 78
25 3300007265 Ga0099794_10221339 Ga0099794_102213392 78
26 3300007265 Ga0099794_10750824 Ga0099794_107508241 78
27 3300007788 Ga0099795_10050231 Ga0099795_100502312 78
28 3300009094 Ga0111539_10143608 Ga0111539_101436082 78
29 3300009094 Ga0111539_10521478 Ga0111539_105214782 78
30 3300009147 Ga0114129_12283132 Ga0114129_122831322 78
31 3300009148 Ga0105243_11882075 Ga0105243_118820752 78
32 3300009176 Ga0105242_10760136 Ga0105242_107601362 78
33 3300010159 Ga0099796_10014760 Ga0099796_100147602 78
34 3300025885 Ga0207653_10188103 Ga0207653_101881031 78
35 3300025905 Ga0207685_10124533 Ga0207685_101245332 78
36 3300025918 Ga0207662_10299822 Ga0207662_102998222 78
37 3300025922 Ga0207646_10720790 Ga0207646_107207902 78
38 3300025922 Ga0207646_11702922 Ga0207646_117029222 78
39 3300025939 Ga0207665_10033641 Ga0207665_100336414 78
40 3300027512 Ga0209179_1018901 Ga0209179_10189013 78
41 3300027671 Ga0209588_1131579 Ga0209588_11315792 78
42 3300027671 Ga0209588_1161715 Ga0209588_11617151 78
43 3300027671 Ga0209588_1167637 Ga0209588_11676372 78
44 3300027907 Ga0207428_10585644 Ga0207428_105856441 78
45 3300028800 Ga0265338_10740264 Ga0265338_107402642 78
46 3300035083 Ga0373926_0001323 Ga0373926_0001323_2539_2775 78
47 3300035086 Ga0373934_0000473 Ga0373934_0000473_946_1182 78
48 3300035086 Ga0373934_0005347 Ga0373934_0005347_4091_4327 78
49 3300035086 Ga0373934_0025114 Ga0373934_0025114_1093_1329 78
50 3300035086 Ga0373934_0236331 Ga0373934_0236331_90_326 78
51 3300035089 Ga0373944_0075306 Ga0373944_0075306_266_502 78
52 3300035113 Ga0373936_0002252 Ga0373936_0002252_291_527 78
53 3300035117 Ga0373953_0010158 Ga0373953_0010158_2104_2340 78
54 3300035117 Ga0373953_0464989 Ga0373953_0464989_183_419 78
55 3300035118 Ga0373954_0000674 Ga0373954_0000674_3556_3792 78
56 3300035118 Ga0373954_0002148 Ga0373954_0002148_5285_5521 78
57 3300035118 Ga0373954_0060141 Ga0373954_0060141_992_1228 78
58 3300035118 Ga0373954_0102339 Ga0373954_0102339_560_796 78
59 3300035118 Ga0373954_0287513 Ga0373954_0287513_291_527 78
60 3300035119 Ga0373956_0000957 Ga0373956_0000957_1478_1714 78
61 3300035119 Ga0373956_0049234 Ga0373956_0049234_429_665 78
62 3300035119 Ga0373956_0071572 Ga0373956_0071572_918_1154 78
63 3300035120 Ga0373957_0019860 Ga0373957_0019860_924_1160 78
64 3300035120 Ga0373957_0036413 Ga0373957_0036413_1082_1318 78
65 3300035120 Ga0373957_0310690 Ga0373957_0310690_171_407 78
66 3300035120 Ga0373957_0483128 Ga0373957_0483128_15_251 78
67 3300035170 Ga0373943_0010754 Ga0373943_0010754_2760_2996 78
68 3300035171 Ga0373946_0035596 Ga0373946_0035596_1352_1588 78
69 3300035172 Ga0373955_0005223 Ga0373955_0005223_3136_3372 78
70 3300035172 Ga0373955_0006289 Ga0373955_0006289_2320_2556 78
71 3300035172 Ga0373955_0500041 Ga0373955_0500041_360_596 78
72 3300035410 Ga0373924_0010125 Ga0373924_0010125_12_248 78
73 3300035692 Ga0373935_0003667 Ga0373935_0003667_6370_6606 78
74 3300035695 Ga0373927_0023672 Ga0373927_0023672_1824_2060 78
75 3300035724 Ga0373933_0000611 Ga0373933_0000611_20343_20579 78
76 3300035724 Ga0373933_0030051 Ga0373933_0030051_924_1160 78
77 3300035724 Ga0373933_0906086 Ga0373933_0906086_263_499 78
78 3300035725 Ga0373947_1215191 Ga0373947_1215191_35_271 78
79 3300036401 Ga0373937_0003380 Ga0373937_0003380_11810_12046 78
80 3300036401 Ga0373937_0028552 Ga0373937_0028552_2318_2554 78
81 3300036401 Ga0373937_0327101 Ga0373937_0327101_291_527 78
82 3300036401 Ga0373937_1359178 Ga0373937_1359178_111_347 78
83 3300037068 Ga0373925_1647403 Ga0373925_1647403_219_455 78
84 3300046454 Ga0495592_0004566 Ga0495592_0004566_1124_1360 78
85 3300046454 Ga0495592_0010390 Ga0495592_0010390_6467_6703 78
86 3300046454 Ga0495592_0014717 Ga0495592_0014717_1874_2110 78
87 3300046454 Ga0495592_0680864 Ga0495592_0680864_152_388 78
88 3300046459 Ga0495629_0026088 Ga0495629_0026088_472_708 78
89 3300046461 Ga0495641_0003418 Ga0495641_0003418_10362_10598 78
90 3300046462 Ga0495651_0000274 Ga0495651_0000274_12724_12960 78
91 3300046462 Ga0495651_0001676 Ga0495651_0001676_14501_14737 78
92 3300046463 Ga0495653_0563577 Ga0495653_0563577_82_318 78
93 3300046463 Ga0495653_0766730 Ga0495653_0766730_282_518 78
94 3300046472 Ga0495580_0026413 Ga0495580_0026413_924_1160 78
95 3300046473 Ga0495582_0044561 Ga0495582_0044561_661_897 78
96 3300046473 Ga0495582_0136763 Ga0495582_0136763_1041_1277 78
97 3300046475 Ga0495639_0080842 Ga0495639_0080842_430_666 78
98 3300046476 Ga0495662_0044313 Ga0495662_0044313_37_273 78
99 3300046477 Ga0495664_0003652 Ga0495664_0003652_6878_7114 78
100 3300046477 Ga0495664_0315072 Ga0495664_0315072_583_819 78
101 3300046499 Ga0495594_0699664 Ga0495594_0699664_116_352 78
102 3300046511 Ga0495608_0040303 Ga0495608_0040303_114_350 78
103 3300046514 Ga0495618_0422599 Ga0495618_0422599_427_663 78
104 3300046516 Ga0495628_0003354 Ga0495628_0003354_12910_13146 78
105 3300046516 Ga0495628_0018527 Ga0495628_0018527_713_949 78
106 3300046516 Ga0495628_0022320 Ga0495628_0022320_3239_3475 78
107 3300046517 Ga0495630_0014088 Ga0495630_0014088_5293_5529 78
108 3300046517 Ga0495630_0027336 Ga0495630_0027336_1448_1684 78
109 3300046517 Ga0495630_0189963 Ga0495630_0189963_576_812 78
110 3300046517 Ga0495630_0225063 Ga0495630_0225063_291_527 78
111 3300046526 Ga0495666_0031602 Ga0495666_0031602_429_665 78
112 3300046526 Ga0495666_0045620 Ga0495666_0045620_1332_1568 78
113 3300046526 Ga0495666_0485347 Ga0495666_0485347_120_356 78
114 3300046529 Ga0495652_0041597 Ga0495652_0041597_2059_2295 78
115 3300046529 Ga0495652_0365141 Ga0495652_0365141_388_624 78
116 3300046533 Ga0495640_0011433 Ga0495640_0011433_2097_2333 78
117 3300046533 Ga0495640_0108132 Ga0495640_0108132_1229_1465 78
118 3300046535 Ga0495586_0135049 Ga0495586_0135049_223_459 78
119 3300046535 Ga0495586_0156822 Ga0495586_0156822_597_833 78
120 3300046535 Ga0495586_0170314 Ga0495586_0170314_924_1160 78
121 3300046536 Ga0495587_0008999 Ga0495587_0008999_2360_2596 78
122 3300046536 Ga0495587_0031556 Ga0495587_0031556_2838_3074 78
123 3300046543 Ga0495645_0057927 Ga0495645_0057927_895_1131 78
124 3300046543 Ga0495645_0692431 Ga0495645_0692431_174_410 78
125 3300046557 Ga0495622_0004696 Ga0495622_0004696_4480_4716 78
126 3300046559 Ga0495667_0069915 Ga0495667_0069915_532_768 78
127 3300046559 Ga0495667_0071527 Ga0495667_0071527_1743_1979 78
128 3300046559 Ga0495667_0159592 Ga0495667_0159592_924_1160 78
129 3300046642 Ga0495634_0004750 Ga0495634_0004750_9882_10118 78
130 3300046642 Ga0495634_0012881 Ga0495634_0012881_2132_2368 78
131 3300046663 Ga0495635_0007265 Ga0495635_0007265_1936_2172 78
132 3300046663 Ga0495635_0804672 Ga0495635_0804672_106_342 78
133 3300046675 Ga0495657_0009194 Ga0495657_0009194_7205_7441 78
134 3300046675 Ga0495657_0626597 Ga0495657_0626597_231_467 78
135 3300046678 Ga0495599_0179392 Ga0495599_0179392_126_362 78
136 3300046678 Ga0495599_0329793 Ga0495599_0329793_509_745 78
137 3300046681 Ga0495647_0022043 Ga0495647_0022043_81_317 78
138 3300046683 Ga0495658_0008852 Ga0495658_0008852_2209_2445 78
139 3300046683 Ga0495658_0177750 Ga0495658_0177750_192_428 78
140 3300046683 Ga0495658_0727960 Ga0495658_0727960_367_603 78
141 3300046683 Ga0495658_0755977 Ga0495658_0755977_192_428 78
142 3300046689 Ga0495613_0044134 Ga0495613_0044134_1838_2074 78
143 3300046690 Ga0495624_0175201 Ga0495624_0175201_629_865 78
144 3300046690 Ga0495624_0965513 Ga0495624_0965513_221_457 78
145 3300046809 Ga0495600_0001253 Ga0495600_0001253_1839_2075 78
146 3300047315 Ga0495581_0458568 Ga0495581_0458568_447_683 78
147 3300047317 Ga0495604_0003259 Ga0495604_0003259_2793_3029 78
148 3300047317 Ga0495604_0270249 Ga0495604_0270249_234_470 78
149 3300047317 Ga0495604_0895382 Ga0495604_0895382_301_537 78
150 3300047318 Ga0495636_0047899 Ga0495636_0047899_283_519 78
151 3300047319 Ga0495674_0002852 Ga0495674_0002852_71_307 78
152 3300047322 Ga0495680_0009905 Ga0495680_0009905_4458_4694 78
153 3300047322 Ga0495680_0039477 Ga0495680_0039477_2452_2688 78
154 3300047322 Ga0495680_0189082 Ga0495680_0189082_575_811 78
155 3300047444 Ga0495675_0008097 Ga0495675_0008097_1434_1670 78
156 3300047444 Ga0495675_0123013 Ga0495675_0123013_666_902 78
157 3300047471 Ga0495684_0057947 Ga0495684_0057947_2425_2661 78
158 3300047471 Ga0495684_0183219 Ga0495684_0183219_1025_1261 78
159 3300047471 Ga0495684_0335795 Ga0495684_0335795_23_259 78
160 3300049522 Ga0501299_234072 Ga0501299_234072_139_375 78
161 3300049576 Ga0501040_0868647 Ga0501040_0868647_25_261 78
162 3300049742 Ga0501080_0726776 Ga0501080_0726776_512_748 78
163 3300049824 Ga0501045_1279177 Ga0501045_1279177_42_278 78
164 3300050508 nmdc:mga09592_213946_c1 nmdc:mga09592_213946_c1_599_835 78
165 3300050511 nmdc:mga08y16_41967_c1 nmdc:mga08y16_41967_c1_4005_4241 78
166 3300050512 nmdc:mga0n895_511118_c1 nmdc:mga0n895_511118_c1_755_991 78
167 3300050514 nmdc:mga08x19_597499_c1 nmdc:mga08x19_597499_c1_187_423 78
168 3300050514 nmdc:mga08x19_767164_c1 nmdc:mga08x19_767164_c1_345_581 78
169 3300053077 Ga0495601_0003245 Ga0495601_0003245_7480_7716 78
170 3300053077 Ga0495601_0062710 Ga0495601_0062710_1575_1811 78
171 3300053077 Ga0495601_0152612 Ga0495601_0152612_768_1004 78
172 3300053077 Ga0495601_0315962 Ga0495601_0315962_710_946 78
173 3300053084 Ga0495595_0000266 Ga0495595_0000266_427_663 78
174 3300053084 Ga0495595_0256766 Ga0495595_0256766_392_628 78
175 3300053085 Ga0495619_0013952 Ga0495619_0013952_3814_4050 78
176 3300053085 Ga0495619_0178963 Ga0495619_0178963_156_392 78
177 3300053085 Ga0495619_0306810 Ga0495619_0306810_542_778 78
178 3300053094 Ga0500566_0093457 Ga0500566_0093457_1105_1341 78
179 3300060353 Ga0501082_0767071 Ga0501082_0767071_343_579 78
180 3300005295 Ga0065707_10223166 Ga0065707_102231662 79
181 3300005334 Ga0068869_100342410 Ga0068869_1003424102 79
182 3300005339 Ga0070660_100250485 Ga0070660_1002504853 79
183 3300005344 Ga0070661_100875878 Ga0070661_1008758782 79
184 3300005365 Ga0070688_101267764 Ga0070688_1012677642 79
185 3300005439 Ga0070711_101036518 Ga0070711_1010365182 79
186 3300005440 Ga0070705_100289532 Ga0070705_1002895322 79
187 3300005440 Ga0070705_101166369 Ga0070705_1011663692 79
188 3300005441 Ga0070700_101285437 Ga0070700_1012854372 79
189 3300005444 Ga0070694_100012031 Ga0070694_1000120312 79
190 3300005444 Ga0070694_100022166 Ga0070694_1000221663 79
191 3300005444 Ga0070694_101802521 Ga0070694_1018025211 79
192 3300005456 Ga0070678_101692301 Ga0070678_1016923011 79
193 3300005458 Ga0070681_10008547 Ga0070681_100085472 79
194 3300005468 Ga0070707_101136796 Ga0070707_1011367962 79
195 3300005518 Ga0070699_100213161 Ga0070699_1002131613 79
196 3300005530 Ga0070679_100056005 Ga0070679_1000560055 79
197 3300005535 Ga0070684_101534076 Ga0070684_1015340761 79
198 3300005539 Ga0068853_100077278 Ga0068853_1000772782 79
199 3300005545 Ga0070695_100006828 Ga0070695_1000068283 79
200 3300005546 Ga0070696_100165850 Ga0070696_1001658501 79
201 3300005547 Ga0070693_101011650 Ga0070693_1010116502 79
202 3300005549 Ga0070704_100001376 Ga0070704_10000137611 79
203 3300005549 Ga0070704_100216923 Ga0070704_1002169232 79
204 3300005549 Ga0070704_100238206 Ga0070704_1002382062 79
205 3300005549 Ga0070704_100329025 Ga0070704_1003290252 79
206 3300005563 Ga0068855_100115321 Ga0068855_1001153214 79
207 3300005564 Ga0070664_101374735 Ga0070664_1013747352 79
208 3300005577 Ga0068857_100129324 Ga0068857_1001293242 79
209 3300005577 Ga0068857_101635766 Ga0068857_1016357662 79
210 3300005578 Ga0068854_100718308 Ga0068854_1007183082 79
211 3300005614 Ga0068856_100526191 Ga0068856_1005261912 79
212 3300005615 Ga0070702_100204672 Ga0070702_1002046722 79
213 3300005616 Ga0068852_101492691 Ga0068852_1014926911 79
214 3300006237 Ga0097621_100088777 Ga0097621_1000887772 79
215 3300006358 Ga0068871_100630398 Ga0068871_1006303981 79
216 3300006844 Ga0075428_100060110 Ga0075428_1000601102 79
217 3300006844 Ga0075428_100073010 Ga0075428_1000730106 79
218 3300006847 Ga0075431_100035093 Ga0075431_1000350936 79
219 3300006847 Ga0075431_100233261 Ga0075431_1002332612 79
220 3300006852 Ga0075433_11367453 Ga0075433_113674532 79
221 3300006871 Ga0075434_100811203 Ga0075434_1008112032 79
222 3300006880 Ga0075429_100000100 Ga0075429_10000010052 79
223 3300006880 Ga0075429_100131012 Ga0075429_1001310122 79
224 3300006914 Ga0075436_101215357 Ga0075436_1012153571 79
225 3300007076 Ga0075435_100689157 Ga0075435_1006891571 79
226 3300007076 Ga0075435_102046701 Ga0075435_1020467012 79
227 3300009093 Ga0105240_12799507 Ga0105240_127995072 79
228 3300009094 Ga0111539_12744915 Ga0111539_127449152 79
229 3300009098 Ga0105245_10253133 Ga0105245_102531332 79
230 3300009101 Ga0105247_11129967 Ga0105247_111299671 79
231 3300009147 Ga0114129_10023948 Ga0114129_100239487 79
232 3300009147 Ga0114129_10104526 Ga0114129_101045264 79
233 3300009174 Ga0105241_10005246 Ga0105241_100052463 79
234 3300009174 Ga0105241_12032009 Ga0105241_120320091 79
235 3300009176 Ga0105242_10085237 Ga0105242_100852373 79
236 3300009176 Ga0105242_12503821 Ga0105242_125038212 79
237 3300009177 Ga0105248_13109156 Ga0105248_131091562 79
238 3300009545 Ga0105237_10027017 Ga0105237_100270178 79
239 3300009551 Ga0105238_10294029 Ga0105238_102940292 79
240 3300010375 Ga0105239_10029649 Ga0105239_100296493 79
241 3300013105 Ga0157369_10577203 Ga0157369_105772032 79
242 3300013297 Ga0157378_10513432 Ga0157378_105134322 79
243 3300013307 Ga0157372_11496198 Ga0157372_114961982 79
244 3300021361 Ga0213872_10040424 Ga0213872_100404243 79
245 3300025911 Ga0207654_11044186 Ga0207654_110441862 79
246 3300025912 Ga0207707_10301215 Ga0207707_103012152 79
247 3300025917 Ga0207660_10310887 Ga0207660_103108872 79
248 3300025919 Ga0207657_10331073 Ga0207657_103310732 79
249 3300025921 Ga0207652_10024484 Ga0207652_100244847 79
250 3300025922 Ga0207646_11019347 Ga0207646_110193472 79
251 3300025924 Ga0207694_10192821 Ga0207694_101928212 79
252 3300025927 Ga0207687_10341882 Ga0207687_103418823 79
253 3300025934 Ga0207686_10162877 Ga0207686_101628772 79
254 3300025938 Ga0207704_11397781 Ga0207704_113977811 79
255 3300025942 Ga0207689_10310932 Ga0207689_103109322 79
256 3300025949 Ga0207667_10417276 Ga0207667_104172763 79
257 3300025981 Ga0207640_10698619 Ga0207640_106986192 79
258 3300026035 Ga0207703_10507533 Ga0207703_105075331 79
259 3300026041 Ga0207639_10101399 Ga0207639_101013992 79
260 3300026067 Ga0207678_10581766 Ga0207678_105817662 79
261 3300026075 Ga0207708_10120724 Ga0207708_101207242 79
262 3300026089 Ga0207648_10077639 Ga0207648_100776392 79
263 3300026116 Ga0207674_10014256 Ga0207674_100142563 79
264 3300026142 Ga0207698_11104472 Ga0207698_111044722 79
265 3300028381 Ga0268264_10366661 Ga0268264_103666612 79
266 3300031901 Ga0307406_11161759 Ga0307406_111617592 79
267 3300031911 Ga0307412_10233865 Ga0307412_102338652 79
268 3300032002 Ga0307416_103652228 Ga0307416_1036522282 79
269 3300035111 Ga0373923_0128362 Ga0373923_0128362_704_943 79
270 3300035113 Ga0373936_0388246 Ga0373936_0388246_362_601 79
271 3300035692 Ga0373935_1107121 Ga0373935_1107121_128_367 79
272 3300035724 Ga0373933_0093454 Ga0373933_0093454_60_299 79
273 3300036401 Ga0373937_0060602 Ga0373937_0060602_911_1150 79
274 3300036401 Ga0373937_0863291 Ga0373937_0863291_245_484 79
275 3300039447 Ga0436361_1108147 Ga0436361_1108147_3072_3311 79
276 3300042003 Ga0439443_026695 Ga0439443_026695_281_520 79
277 3300042436 Ga0439435_0087321 Ga0439435_0087321_526_765 79
278 3300045051 Ga0451576_0298398 Ga0451576_0298398_485_724 79
279 3300046663 Ga0495635_0543350 Ga0495635_0543350_366_605 79
280 3300048905 Ga0496102_0230026 Ga0496102_0230026_744_983 79
281 3300048907 Ga0496104_1201226 Ga0496104_1201226_122_361 79
282 3300050507 nmdc:mga05p37_1059527_c1 nmdc:mga05p37_1059527_c1_579_818 79
283 3300050507 nmdc:mga05p37_1255_c1 nmdc:mga05p37_1255_c1_15554_15793 79
284 3300050507 nmdc:mga05p37_715074_c1 nmdc:mga05p37_715074_c1_684_923 79
285 3300050507 nmdc:mga05p37_86783_c1 nmdc:mga05p37_86783_c1_2976_3215 79
286 3300050508 nmdc:mga09592_109_c1 nmdc:mga09592_109_c1_7720_7959 79
287 3300050508 nmdc:mga09592_60104_c1 nmdc:mga09592_60104_c1_2235_2474 79
288 3300050510 nmdc:mga06r32_47758_c1 nmdc:mga06r32_47758_c1_69_308 79
289 3300050513 nmdc:mga0rr50_130945_c1 nmdc:mga0rr50_130945_c1_1252_1491 79
290 3300050513 nmdc:mga0rr50_305052_c1 nmdc:mga0rr50_305052_c1_876_1115 79
291 3300050514 nmdc:mga08x19_1083327_c1 nmdc:mga08x19_1083327_c1_313_552 79
292 3300054114 Ga0501084_1089978 Ga0501084_1089978_272_511 79
293 3300059424 Ga0590075_050707 Ga0590075_050707_377_616 79
294 3300005333 Ga0070677_10631597 Ga0070677_106315971 80
295 3300005334 Ga0068869_100001201 Ga0068869_10000120114 80
296 3300005335 Ga0070666_10152902 Ga0070666_101529023 80
297 3300005338 Ga0068868_100016446 Ga0068868_1000164468 80
298 3300005345 Ga0070692_11076091 Ga0070692_110760912 80
299 3300005347 Ga0070668_100338036 Ga0070668_1003380362 80
300 3300005354 Ga0070675_100200676 Ga0070675_1002006763 80
301 3300005355 Ga0070671_101596208 Ga0070671_1015962081 80
302 3300005356 Ga0070674_100792270 Ga0070674_1007922702 80
303 3300005364 Ga0070673_100008213 Ga0070673_1000082135 80
304 3300005365 Ga0070688_100153623 Ga0070688_1001536232 80
305 3300005367 Ga0070667_100262726 Ga0070667_1002627262 80
306 3300005367 Ga0070667_102371463 Ga0070667_1023714632 80
307 3300005440 Ga0070705_100178529 Ga0070705_1001785292 80
308 3300005441 Ga0070700_101896467 Ga0070700_1018964671 80
309 3300005455 Ga0070663_100353540 Ga0070663_1003535402 80
310 3300005456 Ga0070678_100481316 Ga0070678_1004813162 80
311 3300005459 Ga0068867_100118237 Ga0068867_1001182372 80
312 3300005459 Ga0068867_100299756 Ga0068867_1002997562 80
313 3300005539 Ga0068853_101888237 Ga0068853_1018882372 80
314 3300005543 Ga0070672_100694083 Ga0070672_1006940832 80
315 3300005544 Ga0070686_100245289 Ga0070686_1002452891 80
316 3300005545 Ga0070695_100160791 Ga0070695_1001607912 80
317 3300005547 Ga0070693_100696614 Ga0070693_1006966142 80
318 3300005548 Ga0070665_101149914 Ga0070665_1011499141 80
319 3300005563 Ga0068855_100768514 Ga0068855_1007685142 80
320 3300005578 Ga0068854_101068994 Ga0068854_1010689942 80
321 3300005617 Ga0068859_100006760 Ga0068859_10000676010 80
322 3300005618 Ga0068864_100649452 Ga0068864_1006494522 80
323 3300005718 Ga0068866_10324014 Ga0068866_103240142 80
324 3300005719 Ga0068861_100067026 Ga0068861_1000670263 80
325 3300005840 Ga0068870_10080947 Ga0068870_100809472 80
326 3300005841 Ga0068863_100047153 Ga0068863_1000471534 80
327 3300005842 Ga0068858_100100764 Ga0068858_1001007643 80
328 3300005843 Ga0068860_100296315 Ga0068860_1002963153 80
329 3300006358 Ga0068871_100053074 Ga0068871_1000530742 80
330 3300006844 Ga0075428_101055974 Ga0075428_1010559742 80
331 3300006880 Ga0075429_101061128 Ga0075429_1010611282 80
332 3300006881 Ga0068865_100341701 Ga0068865_1003417012 80
333 3300006931 Ga0097620_100006760 Ga0097620_10000676010 80
334 3300009094 Ga0111539_11121033 Ga0111539_111210332 80
335 3300009098 Ga0105245_10092490 Ga0105245_100924902 80
336 3300009148 Ga0105243_10715827 Ga0105243_107158272 80
337 3300009148 Ga0105243_12660328 Ga0105243_126603281 80
338 3300009174 Ga0105241_11352188 Ga0105241_113521881 80
339 3300009176 Ga0105242_10318023 Ga0105242_103180232 80
340 3300009176 Ga0105242_10491790 Ga0105242_104917902 80
341 3300009177 Ga0105248_10129960 Ga0105248_101299602 80
342 3300009553 Ga0105249_11255170 Ga0105249_112551702 80
343 3300010375 Ga0105239_10342169 Ga0105239_103421692 80
344 3300013296 Ga0157374_10084223 Ga0157374_100842232 80
345 3300013297 Ga0157378_10142360 Ga0157378_101423602 80
346 3300013297 Ga0157378_10937928 Ga0157378_109379281 80
347 3300013306 Ga0163162_10039189 Ga0163162_100391897 80
348 3300013308 Ga0157375_10013590 Ga0157375_100135907 80
349 3300014325 Ga0163163_10965491 Ga0163163_109654912 80
350 3300014326 Ga0157380_11151072 Ga0157380_111510722 80
351 3300014968 Ga0157379_10162822 Ga0157379_101628221 80
352 3300014969 Ga0157376_10006736 Ga0157376_1000673610 80
353 3300014969 Ga0157376_10114456 Ga0157376_101144563 80
354 3300017792 Ga0163161_11690569 Ga0163161_116905692 80
355 3300025899 Ga0207642_10051598 Ga0207642_100515982 80
356 3300025901 Ga0207688_10135782 Ga0207688_101357822 80
357 3300025903 Ga0207680_10812972 Ga0207680_108129722 80
358 3300025908 Ga0207643_10049016 Ga0207643_100490162 80
359 3300025927 Ga0207687_10520806 Ga0207687_105208062 80
360 3300025931 Ga0207644_11107788 Ga0207644_111077881 80
361 3300025934 Ga0207686_10210507 Ga0207686_102105072 80
362 3300025937 Ga0207669_10008311 Ga0207669_100083111 80
363 3300025938 Ga0207704_10211273 Ga0207704_102112732 80
364 3300025940 Ga0207691_10725991 Ga0207691_107259912 80
365 3300025941 Ga0207711_10012143 Ga0207711_100121432 80
366 3300025942 Ga0207689_10004692 Ga0207689_100046922 80
367 3300025960 Ga0207651_10074406 Ga0207651_100744063 80
368 3300025961 Ga0207712_10908926 Ga0207712_109089262 80
369 3300025972 Ga0207668_10793260 Ga0207668_107932602 80
370 3300025981 Ga0207640_10351116 Ga0207640_103511162 80
371 3300025981 Ga0207640_11127634 Ga0207640_111276342 80
372 3300025986 Ga0207658_10215500 Ga0207658_102155001 80
373 3300026023 Ga0207677_10683320 Ga0207677_106833202 80
374 3300026035 Ga0207703_10217240 Ga0207703_102172402 80
375 3300026088 Ga0207641_10115443 Ga0207641_101154432 80
376 3300026089 Ga0207648_10025233 Ga0207648_100252337 80
377 3300026095 Ga0207676_10721719 Ga0207676_107217192 80
378 3300026118 Ga0207675_100051988 Ga0207675_1000519883 80
379 3300026121 Ga0207683_10407048 Ga0207683_104070482 80
380 3300028379 Ga0268266_10708608 Ga0268266_107086082 80
381 3300028381 Ga0268264_10036231 Ga0268264_100362313 80
382 3300032168 Ga0316593_10173917 Ga0316593_101739172 80
383 3300035172 Ga0373955_0428521 Ga0373955_0428521_201_443 80
384 3300048917 Ga0496114_1336238 Ga0496114_1336238_342_584 80
385 3300049575 Ga0501039_0550755 Ga0501039_0550755_552_794 80
386 3300050511 nmdc:mga08y16_443537_c1 nmdc:mga08y16_443537_c1_44_286 80
387 3300053077 Ga0495601_0522529 Ga0495601_0522529_162_404 80
388 3300005844 Ga0068862_101237957 Ga0068862_1012379571 81
389 3300006195 Ga0075366_10098718 Ga0075366_100987182 81
390 3300014326 Ga0157380_11806868 Ga0157380_118068682 81
391 3300028380 Ga0268265_11880038 Ga0268265_118800381 81
392 3300032005 Ga0307411_10388576 Ga0307411_103885761 81
393 3300050493 nmdc:mga0k408_487168_c1 nmdc:mga0k408_487168_c1_118_366 81
394 3300005545 Ga0070695_100592886 Ga0070695_1005928861 82
395 3300025927 Ga0207687_11179444 Ga0207687_111794442 82
396 3300035118 Ga0373954_0000088 Ga0373954_0000088_3691_3939 82
397 3300035724 Ga0373933_0002313 Ga0373933_0002313_6985_7233 82
398 3300036401 Ga0373937_0001313 Ga0373937_0001313_12467_12715 82
399 3300046462 Ga0495651_0633566 Ga0495651_0633566_245_493 82
400 3300046511 Ga0495608_0152348 Ga0495608_0152348_790_1038 82
401 3300046536 Ga0495587_0352629 Ga0495587_0352629_353_601 82
402 3300046675 Ga0495657_0364488 Ga0495657_0364488_337_585 82
403 3300049573 Ga0501037_0068291 Ga0501037_0068291_1148_1396 82
404 3300049578 Ga0501042_0049095 Ga0501042_0049095_2509_2757 82
405 3300049742 Ga0501080_0069646 Ga0501080_0069646_728_976 82
406 3300049744 Ga0501083_0343295 Ga0501083_0343295_601_849 82
407 3300002077 JGI24744J21845_10083056 JGI24744J21845_100830561 83
408 3300005295 Ga0065707_10088911 Ga0065707_100889112 83
409 3300005328 Ga0070676_10093043 Ga0070676_100930432 83
410 3300005328 Ga0070676_10739153 Ga0070676_107391531 83
411 3300005333 Ga0070677_10135380 Ga0070677_101353802 83
412 3300005334 Ga0068869_100105095 Ga0068869_1001050951 83
413 3300005336 Ga0070680_100206523 Ga0070680_1002065232 83
414 3300005338 Ga0068868_102041054 Ga0068868_1020410541 83
415 3300005339 Ga0070660_100504870 Ga0070660_1005048702 83
416 3300005340 Ga0070689_100184257 Ga0070689_1001842573 83
417 3300005341 Ga0070691_10831995 Ga0070691_108319951 83
418 3300005345 Ga0070692_10148052 Ga0070692_101480523 83
419 3300005345 Ga0070692_10213663 Ga0070692_102136632 83
420 3300005347 Ga0070668_100069650 Ga0070668_1000696505 83
421 3300005353 Ga0070669_100013100 Ga0070669_1000131002 83
422 3300005353 Ga0070669_100347616 Ga0070669_1003476161 83
423 3300005354 Ga0070675_100566650 Ga0070675_1005666502 83
424 3300005356 Ga0070674_100076652 Ga0070674_1000766523 83
425 3300005356 Ga0070674_100254510 Ga0070674_1002545102 83
426 3300005364 Ga0070673_101067782 Ga0070673_1010677822 83
427 3300005364 Ga0070673_102014731 Ga0070673_1020147311 83
428 3300005366 Ga0070659_101197030 Ga0070659_1011970301 83
429 3300005441 Ga0070700_100002644 Ga0070700_1000026447 83
430 3300005441 Ga0070700_100104867 Ga0070700_1001048672 83
431 3300005444 Ga0070694_100501515 Ga0070694_1005015151 83
432 3300005455 Ga0070663_100270284 Ga0070663_1002702842 83
433 3300005455 Ga0070663_100356158 Ga0070663_1003561582 83
434 3300005456 Ga0070678_100037268 Ga0070678_1000372682 83
435 3300005457 Ga0070662_101492952 Ga0070662_1014929522 83
436 3300005459 Ga0068867_100002479 Ga0068867_10000247911 83
437 3300005459 Ga0068867_100289971 Ga0068867_1002899712 83
438 3300005535 Ga0070684_101514089 Ga0070684_1015140892 83
439 3300005539 Ga0068853_100258840 Ga0068853_1002588402 83
440 3300005539 Ga0068853_101081705 Ga0068853_1010817051 83
441 3300005543 Ga0070672_100305283 Ga0070672_1003052832 83
442 3300005563 Ga0068855_100561934 Ga0068855_1005619342 83
443 3300005564 Ga0070664_101104595 Ga0070664_1011045952 83
444 3300005577 Ga0068857_100574909 Ga0068857_1005749092 83
445 3300005614 Ga0068856_100346949 Ga0068856_1003469493 83
446 3300005614 Ga0068856_101532464 Ga0068856_1015324642 83
447 3300005616 Ga0068852_100539922 Ga0068852_1005399222 83
448 3300005617 Ga0068859_102090790 Ga0068859_1020907902 83
449 3300005718 Ga0068866_10431917 Ga0068866_104319172 83
450 3300005718 Ga0068866_11099533 Ga0068866_110995332 83
451 3300005719 Ga0068861_100011165 Ga0068861_1000111652 83
452 3300005719 Ga0068861_100303966 Ga0068861_1003039663 83
453 3300005840 Ga0068870_10018126 Ga0068870_100181262 83
454 3300005843 Ga0068860_101999845 Ga0068860_1019998452 83
455 3300005844 Ga0068862_100008234 Ga0068862_1000082346 83
456 3300005844 Ga0068862_102360187 Ga0068862_1023601872 83
457 3300006237 Ga0097621_100748888 Ga0097621_1007488882 83
458 3300006844 Ga0075428_102729426 Ga0075428_1027294262 83
459 3300006881 Ga0068865_100004107 Ga0068865_1000041077 83
460 3300006931 Ga0097620_102090380 Ga0097620_1020903802 83
461 3300009094 Ga0111539_10602289 Ga0111539_106022892 83
462 3300009094 Ga0111539_11747155 Ga0111539_117471552 83
463 3300009098 Ga0105245_10863502 Ga0105245_108635022 83
464 3300009098 Ga0105245_11540595 Ga0105245_115405952 83
465 3300009101 Ga0105247_11884677 Ga0105247_118846772 83
466 3300009147 Ga0114129_11243359 Ga0114129_112433592 83
467 3300009148 Ga0105243_10027618 Ga0105243_100276183 83
468 3300009148 Ga0105243_10837107 Ga0105243_108371072 83
469 3300009174 Ga0105241_10058539 Ga0105241_100585393 83
470 3300009551 Ga0105238_13076460 Ga0105238_130764601 83
471 3300009553 Ga0105249_10012644 Ga0105249_100126448 83
472 3300009553 Ga0105249_11991192 Ga0105249_119911922 83
473 3300010375 Ga0105239_10261761 Ga0105239_102617613 83
474 3300011119 Ga0105246_12188738 Ga0105246_121887382 83
475 3300013296 Ga0157374_10067986 Ga0157374_100679861 83
476 3300013296 Ga0157374_10246795 Ga0157374_102467952 83
477 3300013296 Ga0157374_10366380 Ga0157374_103663802 83
478 3300013306 Ga0163162_11207751 Ga0163162_112077512 83
479 3300013306 Ga0163162_11910324 Ga0163162_119103242 83
480 3300013308 Ga0157375_10223414 Ga0157375_102234142 83
481 3300013308 Ga0157375_10351011 Ga0157375_103510113 83
482 3300014326 Ga0157380_10240862 Ga0157380_102408622 83
483 3300014968 Ga0157379_10781332 Ga0157379_107813322 83
484 3300014969 Ga0157376_11370039 Ga0157376_113700392 83
485 3300025907 Ga0207645_10168224 Ga0207645_101682242 83
486 3300025907 Ga0207645_10882821 Ga0207645_108828211 83
487 3300025907 Ga0207645_11081684 Ga0207645_110816842 83
488 3300025926 Ga0207659_10579109 Ga0207659_105791092 83
489 3300025927 Ga0207687_10733337 Ga0207687_107333372 83
490 3300025927 Ga0207687_11496661 Ga0207687_114966611 83
491 3300025932 Ga0207690_11215537 Ga0207690_112155371 83
492 3300025937 Ga0207669_10061995 Ga0207669_100619952 83
493 3300025942 Ga0207689_10119518 Ga0207689_101195183 83
494 3300025942 Ga0207689_11704110 Ga0207689_117041101 83
495 3300025945 Ga0207679_10498340 Ga0207679_104983402 83
496 3300025945 Ga0207679_11698440 Ga0207679_116984402 83
497 3300025949 Ga0207667_10497641 Ga0207667_104976412 83
498 3300025960 Ga0207651_10570193 Ga0207651_105701932 83
499 3300025961 Ga0207712_11894887 Ga0207712_118948872 83
500 3300026023 Ga0207677_10265704 Ga0207677_102657042 83
501 3300026041 Ga0207639_10789649 Ga0207639_107896492 83
502 3300026041 Ga0207639_11381372 Ga0207639_113813722 83
503 3300026067 Ga0207678_10333167 Ga0207678_103331672 83
504 3300026067 Ga0207678_10706938 Ga0207678_107069382 83
505 3300026075 Ga0207708_10864237 Ga0207708_108642372 83
506 3300026089 Ga0207648_10087948 Ga0207648_100879483 83
507 3300026116 Ga0207674_10687025 Ga0207674_106870252 83
508 3300026118 Ga0207675_100520806 Ga0207675_1005208062 83
509 3300026121 Ga0207683_10637822 Ga0207683_106378221 83
510 3300026142 Ga0207698_10611580 Ga0207698_106115802 83
511 3300027907 Ga0207428_11242888 Ga0207428_112428882 83
512 3300028379 Ga0268266_11694466 Ga0268266_116944662 83
513 3300028380 Ga0268265_12440684 Ga0268265_124406841 83
514 3300028381 Ga0268264_12519053 Ga0268264_125190531 83
515 3300035113 Ga0373936_0067515 Ga0373936_0067515_903_1175 83
516 3300035171 Ga0373946_0680943 Ga0373946_0680943_106_378 83
517 3300035692 Ga0373935_0023441 Ga0373935_0023441_1030_1302 83
518 3300036401 Ga0373937_1376068 Ga0373937_1376068_313_585 83
519 3300037068 Ga0373925_0038153 Ga0373925_0038153_2476_2748 83
520 3300042001 Ga0439441_033647 Ga0439441_033647_553_825 83
521 3300044673 Ga0453683_0300205 Ga0453683_0300205_370_624 83
522 3300045051 Ga0451576_0000013 Ga0451576_0000013_570357_570611 83
523 3300045051 Ga0451576_0279946 Ga0451576_0279946_559_831 83
524 3300046491 Ga0495584_0211268 Ga0495584_0211268_341_592 83
525 3300046528 Ga0495642_0352477 Ga0495642_0352477_94_345 83
526 3300046537 Ga0495598_0041052 Ga0495598_0041052_545_796 83
527 3300046539 Ga0495621_0089448 Ga0495621_0089448_685_936 83
528 3300046684 Ga0495669_0128804 Ga0495669_0128804_297_548 83
529 3300048909 Ga0496106_0132300 Ga0496106_0132300_95_346 83
530 3300048911 Ga0496108_0540379 Ga0496108_0540379_373_624 83
531 3300048912 Ga0496109_0568382 Ga0496109_0568382_20_307 83
532 3300048913 Ga0496110_0410563 Ga0496110_0410563_413_664 83
533 3300048916 Ga0496113_1468188 Ga0496113_1468188_136_387 83
534 3300050511 nmdc:mga08y16_1619262_c1 nmdc:mga08y16_1619262_c1_283_534 83
535 3300050512 nmdc:mga0n895_1370186_c1 nmdc:mga0n895_1370186_c1_17_304 83
536 3300053085 Ga0495619_0616234 Ga0495619_0616234_37_288 83

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

14

86

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8948 2 75
3tr3-assembly2.cif.gz_A structure of a bola protein homologue from coxiella burnetii 0.8926 1 76
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8845 3 72
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8806 1 79
3tr3-assembly2.cif.gz_A structure of a bola protein homologue from coxiella burnetii 0.8616 1 76
ID Description Score Start End Superfamily
af_P53082_9_118_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9265 2 77 3.10.20.90
af_O14280_1_84_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9185 1 80 3.30.300.90
af_Q67VQ4_70_166_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9046 4 79 3.10.20.90
af_Q9H3K6_1_86_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8997 2 80 3.10.20.90
af_B6SIB6_2_91_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.896 1 73 3.30.300.90
ID Description Score Start End GO Terms
AF-A0A536WBI8-F1-model_v4 BolA family transcriptional regulator 1 1 78
AF-A0A431JYZ0-F1-model_v4 BolA family transcriptional regulator 0.9934 2 75
AF-A0A238DVQ8-F1-model_v4 deleted 0.9901 1 74
AF-A0A2W5DBY8-F1-model_v4 BolA family transcriptional regulator 0.9837 2 79
AF-A0A2N8KXA5-F1-model_v4 BolA family transcriptional regulator 0.9809 2 82

Feature Viewer

pLDDT pTM Quality
93.82 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map