F460765
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 536 | 274 | 1074 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300006358|Ga0068871_100132660|Ga0068871_1001326602 |
| Length | 365 |
| Sequence | MKNEEQRNEKGEEILNIECRMLKFENEAENLRTHSRLTTDNSQTNRMAHIEATDPNGYKPNQEIFSEILQELAAKDRDIIAVTSDSRGSGKLVPFGKKFPEQIVEVGIAEQNLVGVAAGLAAAGKKVFAVSPACFLTARALEQIKNDVAYSDNPVTVVGISAGVSYGALGSTHHSLHDFAALRCINNITVVVPADNFETAQATALAAKTNSPVYLRFGKKVMNSLKEVNDDTFAFGKGRVITEGNDAAIIACGETVYPAVQAAKLLAEQGINATVVSMHTIKPLDTDLLAKLAAKCKAIVTIEEHSVYGGLGEACASYLMQHGLHKPFRIVGIPDEYTVTGSQQDIFNHYHLTKEGIADVVKGLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 2 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 100 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 101 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 158 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 159 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 160 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 165 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 166 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 171 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 172 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 174 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 185 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 186 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 187 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 188 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 189 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 190 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 191 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 192 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 193 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 194 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 195 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 196 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 197 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 198 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 206 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 223 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 224 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 225 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 226 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 227 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 228 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 229 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 230 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 231 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 232 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 243 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 244 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 245 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 248 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 253 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 254 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 258 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 259 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 260 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 261 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 262 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 263 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 264 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 265 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 266 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 268 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 269 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 270 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 271 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 272 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 273 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 274 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.69 |
| Metatranscriptomes | 0 |
| Isolates | 1.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.17 |
| Nodule | 0.19 |
| Rhizoplane | 0.19 |
| Rhizosphere | 87.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068871_100132660 | 3300006358 | Bacteria | 2113 |
| 2 | JGI25157J39369_1004310 | 3300002741 | Bacteria | 2627 |
| 3 | rootH1_10024218 | 3300003316 | Bacteria | 6818 |
| 4 | rootH1_10024218 | 3300003323 | Bacteria | 5571 |
| 5 | rootH1_10161050 | 3300003316 | Bacteria | 1095 |
| 6 | rootH2_10075092 | 3300003320 | Bacteria | 12293 |
| 7 | rootH2_10097574 | 3300003320 | Bacteria | 2870 |
| 8 | rootL2_10258882 | 3300003322 | Bacteria | 1160 |
| 9 | rootH1_10001274 | 3300003316 | Bacteria | 18007 |
| 10 | rootH1_10001274 | 3300003323 | Bacteria | 14899 |
| 11 | rootH1_10067642 | 3300003323 | Bacteria | 6630 |
| 12 | rootH1_10186264 | 3300003323 | Bacteria | 3338 |
| 13 | Ga0065165_1000339 | 3300005262 | Bacteria | 76812 |
| 14 | Ga0065712_10001843 | 3300005290 | Bacteria | 5973 |
| 15 | Ga0065712_10010183 | 3300005290 | Bacteria | 3785 |
| 16 | Ga0070658_10008572 | 3300005327 | Bacteria | 8219 |
| 17 | Ga0070676_10029567 | 3300005328 | Unclassified | 3117 |
| 18 | Ga0070676_10116297 | 3300005328 | Bacteria | 1672 |
| 19 | Ga0070676_10240623 | 3300005328 | Bacteria | 1203 |
| 20 | Ga0070683_100077200 | 3300005329 | Bacteria | 3114 |
| 21 | Ga0070683_100208227 | 3300005329 | Bacteria | 1857 |
| 22 | Ga0070683_100258127 | 3300005329 | Bacteria | 1658 |
| 23 | Ga0070690_100102708 | 3300005330 | Bacteria | 1897 |
| 24 | Ga0070670_100029433 | 3300005331 | Unclassified | 4728 |
| 25 | Ga0070670_100042327 | 3300005331 | Bacteria | 3915 |
| 26 | Ga0070670_100132453 | 3300005331 | Bacteria | 2153 |
| 27 | Ga0070670_100219904 | 3300005331 | Unclassified | 1652 |
| 28 | Ga0070670_100250797 | 3300005331 | Bacteria | 1542 |
| 29 | Ga0068869_100074548 | 3300005334 | Bacteria | 2519 |
| 30 | Ga0068869_100120842 | 3300005334 | Bacteria | 2003 |
| 31 | Ga0070666_10033777 | 3300005335 | Bacteria | 3388 |
| 32 | Ga0070666_10292232 | 3300005335 | Unclassified | 1159 |
| 33 | Ga0068868_100062675 | 3300005338 | Bacteria | 2948 |
| 34 | Ga0068868_100099599 | 3300005338 | Bacteria | 2351 |
| 35 | Ga0068868_100110428 | 3300005338 | Unclassified | 2234 |
| 36 | Ga0070660_100004826 | 3300005339 | Bacteria | 9325 |
| 37 | Ga0070660_100022747 | 3300005339 | Bacteria | 4641 |
| 38 | Ga0070660_100326431 | 3300005339 | Bacteria | 1261 |
| 39 | Ga0070689_100007881 | 3300005340 | Bacteria | 7469 |
| 40 | Ga0070689_100011739 | 3300005340 | Bacteria | 6284 |
| 41 | Ga0070689_100013858 | 3300005340 | Bacteria | 5844 |
| 42 | Ga0070689_100106150 | 3300005340 | Bacteria | 2228 |
| 43 | Ga0070668_100057156 | 3300005347 | Unclassified | 3014 |
| 44 | Ga0070669_100011834 | 3300005353 | Bacteria | 6189 |
| 45 | Ga0070675_100029823 | 3300005354 | Bacteria | 4400 |
| 46 | Ga0070675_100098910 | 3300005354 | Bacteria | 2455 |
| 47 | Ga0070675_100511160 | 3300005354 | Bacteria | 1083 |
| 48 | Ga0070671_100061012 | 3300005355 | Bacteria | 3140 |
| 49 | Ga0070674_100014222 | 3300005356 | Bacteria | 4943 |
| 50 | Ga0070673_100103920 | 3300005364 | Bacteria | 2345 |
| 51 | Ga0070673_100172181 | 3300005364 | Unclassified | 1848 |
| 52 | Ga0070688_100112628 | 3300005365 | Unclassified | 1812 |
| 53 | Ga0070659_100000283 | 3300005366 | Bacteria | 39665 |
| 54 | Ga0070659_100000388 | 3300005366 | Bacteria | 33379 |
| 55 | Ga0070667_100034185 | 3300005367 | Bacteria | 4251 |
| 56 | Ga0070667_100036925 | 3300005367 | Bacteria | 4097 |
| 57 | Ga0070667_100056816 | 3300005367 | Bacteria | 3306 |
| 58 | Ga0070667_100154450 | 3300005367 | Unclassified | 2018 |
| 59 | Ga0070667_100222101 | 3300005367 | Bacteria | 1682 |
| 60 | Ga0070667_100317582 | 3300005367 | Bacteria | 1405 |
| 61 | Ga0070713_100111977 | 3300005436 | Bacteria | 2381 |
| 62 | Ga0070710_10094766 | 3300005437 | Bacteria | 1767 |
| 63 | Ga0070705_100120647 | 3300005440 | Bacteria | 1692 |
| 64 | Ga0070700_100010880 | 3300005441 | Bacteria | 5030 |
| 65 | Ga0070708_100456613 | 3300005445 | Bacteria | 1205 |
| 66 | Ga0070663_100028972 | 3300005455 | Bacteria | 3777 |
| 67 | Ga0070663_100044482 | 3300005455 | Unclassified | 3131 |
| 68 | Ga0070663_100079351 | 3300005455 | Bacteria | 2408 |
| 69 | Ga0070681_10012850 | 3300005458 | Bacteria | 8314 |
| 70 | Ga0068867_100205705 | 3300005459 | Bacteria | 1578 |
| 71 | Ga0070685_10001083 | 3300005466 | Bacteria | 14560 |
| 72 | Ga0070685_10004433 | 3300005466 | Bacteria | 7095 |
| 73 | Ga0070706_100038362 | 3300005467 | Bacteria | 4420 |
| 74 | Ga0070706_100099963 | 3300005467 | Bacteria | 2695 |
| 75 | Ga0070707_100151555 | 3300005468 | Bacteria | 2258 |
| 76 | Ga0070698_100001594 | 3300005471 | Bacteria | 25216 |
| 77 | Ga0070698_100002353 | 3300005471 | Bacteria | 20885 |
| 78 | Ga0070698_100019792 | 3300005471 | Bacteria | 7060 |
| 79 | Ga0070698_100035039 | 3300005471 | Bacteria | 5191 |
| 80 | Ga0070699_100028385 | 3300005518 | Bacteria | 4825 |
| 81 | Ga0070684_100103655 | 3300005535 | Bacteria | 2545 |
| 82 | Ga0070684_100249383 | 3300005535 | Bacteria | 1623 |
| 83 | Ga0070697_100042299 | 3300005536 | Bacteria | 3687 |
| 84 | Ga0068853_100000262 | 3300005539 | Bacteria | 37061 |
| 85 | Ga0068853_100003684 | 3300005539 | Bacteria | 11757 |
| 86 | Ga0068853_100051531 | 3300005539 | Bacteria | 3542 |
| 87 | Ga0068853_100058080 | 3300005539 | Bacteria | 3340 |
| 88 | Ga0068853_100068304 | 3300005539 | Bacteria | 3089 |
| 89 | Ga0068853_100070184 | 3300005539 | Bacteria | 3049 |
| 90 | Ga0070672_100335695 | 3300005543 | Bacteria | 1286 |
| 91 | Ga0070665_100000147 | 3300005548 | Bacteria | 129683 |
| 92 | Ga0070665_100002590 | 3300005548 | Bacteria | 19751 |
| 93 | Ga0070665_100037526 | 3300005548 | Bacteria | 4873 |
| 94 | Ga0070665_100385772 | 3300005548 | Bacteria | 1408 |
| 95 | Ga0068855_100017913 | 3300005563 | Bacteria | 8510 |
| 96 | Ga0070664_100016847 | 3300005564 | Bacteria | 5999 |
| 97 | Ga0070664_100025210 | 3300005564 | Bacteria | 4927 |
| 98 | Ga0070664_100237059 | 3300005564 | Bacteria | 1637 |
| 99 | Ga0068857_100062124 | 3300005577 | Bacteria | 3320 |
| 100 | Ga0068857_100101283 | 3300005577 | Unclassified | 2585 |
| 101 | Ga0068857_100163008 | 3300005577 | Bacteria | 2023 |
| 102 | Ga0068857_100177966 | 3300005577 | Bacteria | 1935 |
| 103 | Ga0068854_100000003 | 3300005578 | Bacteria | 330045 |
| 104 | Ga0068854_100046345 | 3300005578 | Bacteria | 3095 |
| 105 | Ga0068854_100071287 | 3300005578 | Unclassified | 2542 |
| 106 | Ga0068856_100000696 | 3300005614 | Bacteria | 36434 |
| 107 | Ga0068856_100002940 | 3300005614 | Bacteria | 17462 |
| 108 | Ga0068856_100024306 | 3300005614 | Bacteria | 5896 |
| 109 | Ga0068856_100044839 | 3300005614 | Bacteria | 4352 |
| 110 | Ga0068852_100075811 | 3300005616 | Bacteria | 2968 |
| 111 | Ga0068859_100003461 | 3300005617 | Bacteria | 16049 |
| 112 | Ga0068859_100006947 | 3300005617 | Bacteria | 11497 |
| 113 | Ga0068859_100026403 | 3300005617 | Bacteria | 5823 |
| 114 | Ga0068859_100033142 | 3300005617 | Bacteria | 5188 |
| 115 | Ga0068859_100158611 | 3300005617 | Unclassified | 2341 |
| 116 | Ga0068859_100160571 | 3300005617 | Bacteria | 2327 |
| 117 | Ga0068859_100174858 | 3300005617 | Bacteria | 2229 |
| 118 | Ga0068859_100321029 | 3300005617 | Unclassified | 1643 |
| 119 | Ga0068864_100037040 | 3300005618 | Bacteria | 4160 |
| 120 | Ga0068864_100135772 | 3300005618 | Unclassified | 2215 |
| 121 | Ga0068864_100292812 | 3300005618 | Bacteria | 1522 |
| 122 | Ga0068866_10065883 | 3300005718 | Bacteria | 1896 |
| 123 | Ga0068861_100036857 | 3300005719 | Bacteria | 3632 |
| 124 | Ga0068861_100053829 | 3300005719 | Bacteria | 3064 |
| 125 | Ga0068861_100087709 | 3300005719 | Bacteria | 2449 |
| 126 | Ga0068861_100391596 | 3300005719 | Bacteria | 1231 |
| 127 | Ga0068861_100444545 | 3300005719 | Unclassified | 1160 |
| 128 | Ga0068870_10043181 | 3300005840 | Unclassified | 2351 |
| 129 | Ga0068863_100000902 | 3300005841 | Bacteria | 29865 |
| 130 | Ga0068863_100188213 | 3300005841 | Bacteria | 1983 |
| 131 | Ga0068863_100508361 | 3300005841 | Unclassified | 1187 |
| 132 | Ga0068858_100022778 | 3300005842 | Bacteria | 5841 |
| 133 | Ga0068858_100087398 | 3300005842 | Bacteria | 2899 |
| 134 | Ga0068858_100252230 | 3300005842 | Bacteria | 1676 |
| 135 | Ga0068860_100000086 | 3300005843 | Bacteria | 165786 |
| 136 | Ga0068860_100003144 | 3300005843 | Bacteria | 17057 |
| 137 | Ga0068860_100251950 | 3300005843 | Unclassified | 1720 |
| 138 | Ga0068862_100043235 | 3300005844 | Bacteria | 3840 |
| 139 | Ga0068862_100176173 | 3300005844 | Bacteria | 1917 |
| 140 | Ga0081538_10002277 | 3300005981 | Bacteria | 18973 |
| 141 | Ga0081539_10010894 | 3300005985 | Bacteria | 7301 |
| 142 | Ga0070717_10007754 | 3300006028 | Bacteria | 7986 |
| 143 | Ga0075366_10002957 | 3300006195 | Bacteria | 8849 |
| 144 | Ga0097621_100021967 | 3300006237 | Unclassified | 4945 |
| 145 | Ga0097621_100048486 | 3300006237 | Unclassified | 3446 |
| 146 | Ga0068871_100274294 | 3300006358 | Unclassified | 1474 |
| 147 | Ga0068871_100530410 | 3300006358 | Unclassified | 1064 |
| 148 | Ga0075428_100099540 | 3300006844 | Bacteria | 3170 |
| 149 | Ga0075428_100113557 | 3300006844 | Bacteria | 2951 |
| 150 | Ga0075428_100139359 | 3300006844 | Bacteria | 2637 |
| 151 | Ga0075428_100236635 | 3300006844 | Unclassified | 1970 |
| 152 | Ga0075428_100566571 | 3300006844 | Unclassified | 1214 |
| 153 | Ga0075430_100009549 | 3300006846 | Bacteria | 8197 |
| 154 | Ga0075431_100205748 | 3300006847 | Bacteria | 2012 |
| 155 | Ga0075429_100122198 | 3300006880 | Bacteria | 2276 |
| 156 | Ga0068865_100032646 | 3300006881 | Bacteria | 3480 |
| 157 | Ga0097620_100003461 | 3300006931 | Bacteria | 16049 |
| 158 | Ga0097620_100006947 | 3300006931 | Bacteria | 11497 |
| 159 | Ga0097620_100026403 | 3300006931 | Bacteria | 5823 |
| 160 | Ga0097620_100033145 | 3300006931 | Bacteria | 5188 |
| 161 | Ga0097620_100158612 | 3300006931 | Unclassified | 2341 |
| 162 | Ga0097620_100160575 | 3300006931 | Bacteria | 2327 |
| 163 | Ga0097620_100174849 | 3300006931 | Bacteria | 2229 |
| 164 | Ga0097620_100321041 | 3300006931 | Unclassified | 1643 |
| 165 | Ga0099826_10114455 | 3300006948 | Bacteria | 1601 |
| 166 | Ga0105240_10000025 | 3300009093 | Bacteria | 367124 |
| 167 | Ga0105240_10001310 | 3300009093 | Bacteria | 42943 |
| 168 | Ga0105240_10036487 | 3300009093 | Bacteria | 6322 |
| 169 | Ga0105240_10082773 | 3300009093 | Bacteria | 3941 |
| 170 | Ga0105240_10205010 | 3300009093 | Bacteria | 2309 |
| 171 | Ga0105240_10351384 | 3300009093 | Bacteria | 1672 |
| 172 | Ga0111539_10006050 | 3300009094 | Bacteria | 15621 |
| 173 | Ga0111539_10023250 | 3300009094 | Bacteria | 7614 |
| 174 | Ga0105247_10034039 | 3300009101 | Unclassified | 3102 |
| 175 | Ga0105241_10020658 | 3300009174 | Bacteria | 4865 |
| 176 | Ga0105241_10050063 | 3300009174 | Bacteria | 3183 |
| 177 | Ga0105241_10053524 | 3300009174 | Unclassified | 3087 |
| 178 | Ga0105241_10094880 | 3300009174 | Bacteria | 2360 |
| 179 | Ga0105241_10119006 | 3300009174 | Unclassified | 2124 |
| 180 | Ga0105242_10032080 | 3300009176 | Unclassified | 4200 |
| 181 | Ga0105248_10052483 | 3300009177 | Bacteria | 4575 |
| 182 | Ga0105237_10000956 | 3300009545 | Bacteria | 38876 |
| 183 | Ga0105237_10004809 | 3300009545 | Bacteria | 15518 |
| 184 | Ga0105237_10006566 | 3300009545 | Bacteria | 12865 |
| 185 | Ga0105237_10033577 | 3300009545 | Bacteria | 5199 |
| 186 | Ga0105237_10045710 | 3300009545 | Bacteria | 4405 |
| 187 | Ga0105237_10105917 | 3300009545 | Bacteria | 2803 |
| 188 | Ga0105238_10015803 | 3300009551 | Bacteria | 7640 |
| 189 | Ga0105249_10017506 | 3300009553 | Bacteria | 6363 |
| 190 | Ga0105249_10083084 | 3300009553 | Bacteria | 2981 |
| 191 | Ga0105249_10139688 | 3300009553 | Unclassified | 2321 |
| 192 | Ga0105239_10002721 | 3300010375 | Bacteria | 22219 |
| 193 | Ga0105239_10003157 | 3300010375 | Bacteria | 20424 |
| 194 | Ga0105239_10006117 | 3300010375 | Bacteria | 14008 |
| 195 | Ga0105239_10052493 | 3300010375 | Bacteria | 4471 |
| 196 | Ga0105239_10061136 | 3300010375 | Bacteria | 4134 |
| 197 | Ga0105239_10826837 | 3300010375 | Bacteria | 1062 |
| 198 | Ga0157373_10000181 | 3300013100 | Bacteria | 51804 |
| 199 | Ga0157371_10002315 | 3300013102 | Bacteria | 18316 |
| 200 | Ga0157371_10018428 | 3300013102 | Bacteria | 5162 |
| 201 | Ga0157371_10121910 | 3300013102 | Bacteria | 1854 |
| 202 | Ga0157371_10145917 | 3300013102 | Bacteria | 1686 |
| 203 | Ga0157370_10001428 | 3300013104 | Bacteria | 29651 |
| 204 | Ga0157370_10053297 | 3300013104 | Bacteria | 3858 |
| 205 | Ga0157369_10001781 | 3300013105 | Bacteria | 26087 |
| 206 | Ga0157369_10193180 | 3300013105 | Bacteria | 2138 |
| 207 | Ga0157374_10001290 | 3300013296 | Bacteria | 21307 |
| 208 | Ga0157374_10047192 | 3300013296 | Bacteria | 3992 |
| 209 | Ga0157378_10168473 | 3300013297 | Bacteria | 2053 |
| 210 | Ga0157378_10171193 | 3300013297 | Unclassified | 2037 |
| 211 | Ga0157378_10310885 | 3300013297 | Bacteria | 1528 |
| 212 | Ga0163162_10020055 | 3300013306 | Bacteria | 6566 |
| 213 | Ga0163162_10065745 | 3300013306 | Bacteria | 3674 |
| 214 | Ga0163162_10267247 | 3300013306 | Bacteria | 1842 |
| 215 | Ga0163162_10341387 | 3300013306 | Bacteria | 1630 |
| 216 | Ga0163162_10517124 | 3300013306 | Bacteria | 1323 |
| 217 | Ga0157372_10000021 | 3300013307 | Bacteria | 207801 |
| 218 | Ga0157372_10007746 | 3300013307 | Bacteria | 11410 |
| 219 | Ga0157372_10009340 | 3300013307 | Bacteria | 10435 |
| 220 | Ga0157372_10079589 | 3300013307 | Bacteria | 3706 |
| 221 | Ga0157372_10141278 | 3300013307 | Bacteria | 2774 |
| 222 | Ga0157372_10470830 | 3300013307 | Bacteria | 1464 |
| 223 | Ga0157372_10584260 | 3300013307 | Bacteria | 1302 |
| 224 | Ga0157375_10017390 | 3300013308 | Bacteria | 6487 |
| 225 | Ga0157375_10114555 | 3300013308 | Bacteria | 2798 |
| 226 | Ga0157375_10122272 | 3300013308 | Bacteria | 2714 |
| 227 | Ga0157375_10281209 | 3300013308 | Bacteria | 1827 |
| 228 | Ga0157375_10300537 | 3300013308 | Bacteria | 1769 |
| 229 | Ga0163163_10000688 | 3300014325 | Bacteria | 28732 |
| 230 | Ga0163163_10002343 | 3300014325 | Bacteria | 16027 |
| 231 | Ga0163163_10067280 | 3300014325 | Bacteria | 3562 |
| 232 | Ga0163163_10090002 | 3300014325 | Bacteria | 3082 |
| 233 | Ga0157380_10000353 | 3300014326 | Bacteria | 27534 |
| 234 | Ga0157380_10033159 | 3300014326 | Bacteria | 3976 |
| 235 | Ga0157377_10002310 | 3300014745 | Bacteria | 8387 |
| 236 | Ga0157377_10133884 | 3300014745 | Unclassified | 1517 |
| 237 | Ga0157379_10029651 | 3300014968 | Bacteria | 4864 |
| 238 | Ga0157379_10083830 | 3300014968 | Unclassified | 2857 |
| 239 | Ga0157376_10065549 | 3300014969 | Bacteria | 3067 |
| 240 | Ga0213872_10011081 | 3300021361 | Unclassified | 4274 |
| 241 | Ga0213872_10011839 | 3300021361 | Bacteria | 4121 |
| 242 | Ga0213876_10000226 | 3300021384 | Bacteria | 55955 |
| 243 | Ga0213876_10001281 | 3300021384 | Bacteria | 15870 |
| 244 | Ga0213876_10034190 | 3300021384 | Bacteria | 2681 |
| 245 | Ga0213875_10048733 | 3300021388 | Bacteria | 1987 |
| 246 | Ga0213871_10006104 | 3300021441 | Bacteria | 2532 |
| 247 | Ga0213871_10006288 | 3300021441 | Unclassified | 2505 |
| 248 | Ga0209026_1000387 | 3300025250 | Bacteria | 39998 |
| 249 | Ga0209676_1000232 | 3300025292 | Bacteria | 120363 |
| 250 | Ga0207697_10022976 | 3300025315 | Bacteria | 2554 |
| 251 | Ga0207642_10107147 | 3300025899 | Bacteria | 1415 |
| 252 | Ga0207688_10023055 | 3300025901 | Bacteria | 3406 |
| 253 | Ga0207688_10132101 | 3300025901 | Bacteria | 1464 |
| 254 | Ga0207680_10246903 | 3300025903 | Unclassified | 1232 |
| 255 | Ga0207699_10154002 | 3300025906 | Bacteria | 1524 |
| 256 | Ga0207645_10001468 | 3300025907 | Bacteria | 19262 |
| 257 | Ga0207645_10029427 | 3300025907 | Bacteria | 3542 |
| 258 | Ga0207643_10022107 | 3300025908 | Bacteria | 3499 |
| 259 | Ga0207684_10172326 | 3300025910 | Bacteria | 1865 |
| 260 | Ga0207654_10019627 | 3300025911 | Bacteria | 3571 |
| 261 | Ga0207654_10051999 | 3300025911 | Bacteria | 2360 |
| 262 | Ga0207654_10058157 | 3300025911 | Bacteria | 2250 |
| 263 | Ga0207707_10092055 | 3300025912 | Bacteria | 2649 |
| 264 | Ga0207695_10000025 | 3300025913 | Bacteria | 627211 |
| 265 | Ga0207695_10006516 | 3300025913 | Bacteria | 15114 |
| 266 | Ga0207695_10008429 | 3300025913 | Bacteria | 12907 |
| 267 | Ga0207671_10001509 | 3300025914 | Bacteria | 26781 |
| 268 | Ga0207671_10007424 | 3300025914 | Bacteria | 9514 |
| 269 | Ga0207671_10023364 | 3300025914 | Bacteria | 4662 |
| 270 | Ga0207657_10003374 | 3300025919 | Bacteria | 17074 |
| 271 | Ga0207657_10058882 | 3300025919 | Bacteria | 3303 |
| 272 | Ga0207646_10053033 | 3300025922 | Bacteria | 3628 |
| 273 | Ga0207681_10079100 | 3300025923 | Unclassified | 2316 |
| 274 | Ga0207694_10023002 | 3300025924 | Bacteria | 4729 |
| 275 | Ga0207694_10078704 | 3300025924 | Bacteria | 2585 |
| 276 | Ga0207650_10033366 | 3300025925 | Bacteria | 3728 |
| 277 | Ga0207650_10194989 | 3300025925 | Bacteria | 1620 |
| 278 | Ga0207659_10049896 | 3300025926 | Bacteria | 2970 |
| 279 | Ga0207700_10228908 | 3300025928 | Bacteria | 1579 |
| 280 | Ga0207644_10134798 | 3300025931 | Unclassified | 1895 |
| 281 | Ga0207690_10000354 | 3300025932 | Bacteria | 30499 |
| 282 | Ga0207690_10002858 | 3300025932 | Bacteria | 10408 |
| 283 | Ga0207706_10035155 | 3300025933 | Bacteria | 4457 |
| 284 | Ga0207706_10096519 | 3300025933 | Bacteria | 2599 |
| 285 | Ga0207670_10010505 | 3300025936 | Bacteria | 5339 |
| 286 | Ga0207670_10037789 | 3300025936 | Unclassified | 3148 |
| 287 | Ga0207670_10062211 | 3300025936 | Bacteria | 2550 |
| 288 | Ga0207704_10102350 | 3300025938 | Unclassified | 1913 |
| 289 | Ga0207665_10076983 | 3300025939 | Bacteria | 2289 |
| 290 | Ga0207691_10045016 | 3300025940 | Bacteria | 4059 |
| 291 | Ga0207691_10074392 | 3300025940 | Bacteria | 3064 |
| 292 | Ga0207689_10015573 | 3300025942 | Bacteria | 6441 |
| 293 | Ga0207689_10026235 | 3300025942 | Bacteria | 4879 |
| 294 | Ga0207689_10175948 | 3300025942 | Unclassified | 1765 |
| 295 | Ga0207661_10239178 | 3300025944 | Bacteria | 1610 |
| 296 | Ga0207661_10382718 | 3300025944 | Bacteria | 1274 |
| 297 | Ga0207679_10010561 | 3300025945 | Bacteria | 5951 |
| 298 | Ga0207679_10102600 | 3300025945 | Unclassified | 2240 |
| 299 | Ga0207667_10063368 | 3300025949 | Bacteria | 3862 |
| 300 | Ga0207651_10059942 | 3300025960 | Unclassified | 2639 |
| 301 | Ga0207712_10048627 | 3300025961 | Bacteria | 2951 |
| 302 | Ga0207712_10083744 | 3300025961 | Unclassified | 2328 |
| 303 | Ga0207712_10203384 | 3300025961 | Bacteria | 1572 |
| 304 | Ga0207640_10000002 | 3300025981 | Bacteria | 524211 |
| 305 | Ga0207640_10071496 | 3300025981 | Unclassified | 2337 |
| 306 | Ga0207658_10056926 | 3300025986 | Bacteria | 2903 |
| 307 | Ga0207658_10088812 | 3300025986 | Bacteria | 2391 |
| 308 | Ga0207658_10257772 | 3300025986 | Bacteria | 1485 |
| 309 | Ga0207658_10271815 | 3300025986 | Unclassified | 1449 |
| 310 | Ga0207658_10273314 | 3300025986 | Unclassified | 1445 |
| 311 | Ga0207677_10138569 | 3300026023 | Unclassified | 1859 |
| 312 | Ga0207677_10349220 | 3300026023 | Bacteria | 1239 |
| 313 | Ga0207703_10047346 | 3300026035 | Unclassified | 3466 |
| 314 | Ga0207703_10221217 | 3300026035 | Unclassified | 1693 |
| 315 | Ga0207639_10000011 | 3300026041 | Bacteria | 381897 |
| 316 | Ga0207639_10008511 | 3300026041 | Bacteria | 7035 |
| 317 | Ga0207639_10011528 | 3300026041 | Bacteria | 6141 |
| 318 | Ga0207639_10053043 | 3300026041 | Bacteria | 3092 |
| 319 | Ga0207639_10075616 | 3300026041 | Bacteria | 2649 |
| 320 | Ga0207639_10273184 | 3300026041 | Bacteria | 1483 |
| 321 | Ga0207678_10006599 | 3300026067 | Bacteria | 10291 |
| 322 | Ga0207678_10045692 | 3300026067 | Bacteria | 3787 |
| 323 | Ga0207678_10064446 | 3300026067 | Bacteria | 3148 |
| 324 | Ga0207708_10052982 | 3300026075 | Bacteria | 3090 |
| 325 | Ga0207708_10090978 | 3300026075 | Unclassified | 2352 |
| 326 | Ga0207702_10003347 | 3300026078 | Bacteria | 14701 |
| 327 | Ga0207702_10024526 | 3300026078 | Bacteria | 5004 |
| 328 | Ga0207702_10038947 | 3300026078 | Bacteria | 3982 |
| 329 | Ga0207641_10000411 | 3300026088 | Bacteria | 50003 |
| 330 | Ga0207641_10071697 | 3300026088 | Bacteria | 2981 |
| 331 | Ga0207641_10213691 | 3300026088 | Bacteria | 1785 |
| 332 | Ga0207648_10027620 | 3300026089 | Bacteria | 5038 |
| 333 | Ga0207676_10001241 | 3300026095 | Bacteria | 18980 |
| 334 | Ga0207676_10066005 | 3300026095 | Unclassified | 2884 |
| 335 | Ga0207676_10139906 | 3300026095 | Bacteria | 2071 |
| 336 | Ga0207674_10014932 | 3300026116 | Bacteria | 8558 |
| 337 | Ga0207674_10099945 | 3300026116 | Unclassified | 2883 |
| 338 | Ga0207674_10218334 | 3300026116 | Bacteria | 1855 |
| 339 | Ga0207675_100000139 | 3300026118 | Bacteria | 62161 |
| 340 | Ga0207675_100009714 | 3300026118 | Bacteria | 9005 |
| 341 | Ga0207675_100090057 | 3300026118 | Bacteria | 2884 |
| 342 | Ga0207675_100621929 | 3300026118 | Bacteria | 1084 |
| 343 | Ga0207683_10003547 | 3300026121 | Bacteria | 13606 |
| 344 | Ga0207698_10060811 | 3300026142 | Bacteria | 2939 |
| 345 | Ga0209974_10011019 | 3300027876 | Bacteria | 3044 |
| 346 | Ga0268266_10000030 | 3300028379 | Bacteria | 417120 |
| 347 | Ga0268266_10003530 | 3300028379 | Bacteria | 15524 |
| 348 | Ga0268266_10021701 | 3300028379 | Bacteria | 5472 |
| 349 | Ga0268266_10046127 | 3300028379 | Bacteria | 3731 |
| 350 | Ga0268265_10025276 | 3300028380 | Bacteria | 4213 |
| 351 | Ga0268264_10000044 | 3300028381 | Bacteria | 368079 |
| 352 | Ga0268264_10005286 | 3300028381 | Bacteria | 10933 |
| 353 | Ga0268264_10073278 | 3300028381 | Unclassified | 2906 |
| 354 | Ga0268264_10084335 | 3300028381 | Bacteria | 2724 |
| 355 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 356 | Ga0265338_10000025 | 3300028800 | Bacteria | 296972 |
| 357 | Ga0265338_10000463 | 3300028800 | Bacteria | 72298 |
| 358 | Ga0265338_10000699 | 3300028800 | Bacteria | 57627 |
| 359 | Ga0265338_10071061 | 3300028800 | Bacteria | 2981 |
| 360 | Ga0265338_10240055 | 3300028800 | Bacteria | 1343 |
| 361 | Ga0265324_10000417 | 3300029957 | Bacteria | 30508 |
| 362 | Ga0316176_1139212 | 3300030732 | Bacteria | 7209 |
| 363 | Ga0316183_1148322 | 3300030742 | Bacteria | 26985 |
| 364 | Ga0316181_1068791 | 3300030744 | Bacteria | 41630 |
| 365 | Ga0265332_10023165 | 3300031238 | Bacteria | 2739 |
| 366 | Ga0265320_10000344 | 3300031240 | Bacteria | 37824 |
| 367 | Ga0265339_10023769 | 3300031249 | Unclassified | 3540 |
| 368 | Ga0265339_10077339 | 3300031249 | Bacteria | 1764 |
| 369 | Ga0265331_10122799 | 3300031250 | Bacteria | 1187 |
| 370 | Ga0265327_10000245 | 3300031251 | Bacteria | 108670 |
| 371 | Ga0265327_10055219 | 3300031251 | Bacteria | 2052 |
| 372 | Ga0307513_10074121 | 3300031456 | Bacteria | 3541 |
| 373 | Ga0307509_10078351 | 3300031507 | Bacteria | 3424 |
| 374 | Ga0307509_10266969 | 3300031507 | Bacteria | 1482 |
| 375 | Ga0307408_100000348 | 3300031548 | Bacteria | 43347 |
| 376 | Ga0307408_100000836 | 3300031548 | Bacteria | 24310 |
| 377 | Ga0307508_10000062 | 3300031616 | Bacteria | 123066 |
| 378 | Ga0265314_10064683 | 3300031711 | Bacteria | 2475 |
| 379 | Ga0316576_10011184 | 3300031727 | Bacteria | 5867 |
| 380 | Ga0316576_10041109 | 3300031727 | Bacteria | 3326 |
| 381 | Ga0316578_10148687 | 3300031728 | Unclassified | 1411 |
| 382 | Ga0307405_10051581 | 3300031731 | Bacteria | 2553 |
| 383 | Ga0307413_10110465 | 3300031824 | Bacteria | 1840 |
| 384 | Ga0307410_10032529 | 3300031852 | Bacteria | 3358 |
| 385 | Ga0307412_10052426 | 3300031911 | Bacteria | 2701 |
| 386 | Ga0307409_100273743 | 3300031995 | Bacteria | 1556 |
| 387 | Ga0307414_10020702 | 3300032004 | Bacteria | 4106 |
| 388 | Ga0307414_10578083 | 3300032004 | Bacteria | 1005 |
| 389 | Ga0307411_10044657 | 3300032005 | Bacteria | 2845 |
| 390 | Ga0373951_0030116 | 3300035091 | Bacteria | 1276 |
| 391 | Ga0373927_0185433 | 3300035695 | Unclassified | 1365 |
| 392 | Ga0316584_0005208 | 3300036712 | Bacteria | 8695 |
| 393 | Ga0316584_0059077 | 3300036712 | Bacteria | 2872 |
| 394 | Ga0316584_0126461 | 3300036712 | Unclassified | 1909 |
| 395 | Ga0373925_0378836 | 3300037068 | Bacteria | 1152 |
| 396 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 397 | Ga0395899_0001857 | 3300037312 | Bacteria | 17464 |
| 398 | Ga0436364_0145037 | 3300037853 | Bacteria | 10259 |
| 399 | Ga0436364_0699124 | 3300037853 | Bacteria | 1421 |
| 400 | Ga0436364_1502188 | 3300037853 | Bacteria | 3821 |
| 401 | Ga0400484_23600 | 3300038725 | Bacteria | 8321 |
| 402 | Ga0400490_04506 | 3300038726 | Bacteria | 6397 |
| 403 | Ga0400490_60002 | 3300038726 | Unclassified | 1117 |
| 404 | Ga0400483_037251 | 3300039062 | Bacteria | 16134 |
| 405 | Ga0400489_40834 | 3300039093 | Bacteria | 2002 |
| 406 | Ga0400489_66758 | 3300039093 | Bacteria | 6700 |
| 407 | Ga0400489_67636 | 3300039093 | Bacteria | 5912 |
| 408 | Ga0400489_85356 | 3300039093 | Bacteria | 1354 |
| 409 | Ga0400487_58339 | 3300039110 | Bacteria | 2520 |
| 410 | Ga0436365_0274929 | 3300039437 | Bacteria | 28216 |
| 411 | Ga0436365_0616146 | 3300039437 | Bacteria | 1955 |
| 412 | Ga0436365_1162856 | 3300039437 | Bacteria | 4623 |
| 413 | Ga0436365_1352796 | 3300039437 | Bacteria | 16338 |
| 414 | Ga0436360_0620625 | 3300039438 | Unclassified | 4157 |
| 415 | Ga0436360_0623808 | 3300039438 | Bacteria | 7477 |
| 416 | Ga0436360_1106233 | 3300039438 | Unclassified | 3160 |
| 417 | Ga0436360_1348840 | 3300039438 | Bacteria | 3039 |
| 418 | Ga0436360_1360656 | 3300039438 | Bacteria | 1812 |
| 419 | Ga0436361_0017841 | 3300039447 | Unclassified | 1889 |
| 420 | Ga0436361_0161735 | 3300039447 | Bacteria | 2925 |
| 421 | Ga0436361_0370652 | 3300039447 | Bacteria | 4895 |
| 422 | Ga0436361_0573813 | 3300039447 | Bacteria | 3323 |
| 423 | Ga0436361_1061615 | 3300039447 | Bacteria | 1303 |
| 424 | Ga0436361_1067145 | 3300039447 | Bacteria | 5898 |
| 425 | Ga0436361_1205683 | 3300039447 | Bacteria | 5970 |
| 426 | Ga0436363_1253815 | 3300039450 | Bacteria | 3542 |
| 427 | Ga0436362_0549261 | 3300039453 | Bacteria | 2242 |
| 428 | Ga0439448_0005722 | 3300042005 | Bacteria | 3548 |
| 429 | Ga0451577_0000208 | 3300042876 | Bacteria | 122820 |
| 430 | Ga0451577_0001527 | 3300042876 | Bacteria | 30403 |
| 431 | Ga0451577_0010154 | 3300042876 | Bacteria | 9018 |
| 432 | Ga0466969_0031001 | 3300044656 | Bacteria | 2723 |
| 433 | Ga0466972_0009748 | 3300044658 | Bacteria | 4821 |
| 434 | Ga0466966_0029199 | 3300044684 | Bacteria | 3589 |
| 435 | Ga0466961_0019541 | 3300044693 | Bacteria | 4358 |
| 436 | Ga0453684_0000668 | 3300044712 | Bacteria | 122805 |
| 437 | Ga0453684_0000808 | 3300044712 | Bacteria | 106678 |
| 438 | Ga0453684_0004233 | 3300044712 | Bacteria | 30729 |
| 439 | Ga0453684_0007860 | 3300044712 | Bacteria | 19402 |
| 440 | Ga0453684_0012861 | 3300044712 | Bacteria | 13711 |
| 441 | Ga0453684_0086084 | 3300044712 | Bacteria | 3902 |
| 442 | Ga0453684_0158614 | 3300044712 | Bacteria | 2678 |
| 443 | Ga0453684_0167780 | 3300044712 | Bacteria | 2590 |
| 444 | Ga0466957_0000346 | 3300044842 | Bacteria | 22659 |
| 445 | Ga0466957_0001044 | 3300044842 | Bacteria | 14285 |
| 446 | Ga0466960_0120337 | 3300044901 | Bacteria | 1374 |
| 447 | Ga0466959_0006622 | 3300045049 | Bacteria | 8044 |
| 448 | Ga0451576_0000104 | 3300045051 | Bacteria | 215927 |
| 449 | Ga0451576_0000291 | 3300045051 | Bacteria | 122805 |
| 450 | Ga0451576_0042125 | 3300045051 | Unclassified | 4822 |
| 451 | Ga0451576_0047627 | 3300045051 | Bacteria | 4506 |
| 452 | Ga0495641_0053022 | 3300046461 | Bacteria | 1846 |
| 453 | Ga0495662_0091206 | 3300046476 | Bacteria | 1486 |
| 454 | Ga0495628_0125002 | 3300046516 | Bacteria | 1971 |
| 455 | Ga0495630_0004272 | 3300046517 | Bacteria | 10020 |
| 456 | Ga0495652_0079007 | 3300046529 | Bacteria | 2722 |
| 457 | Ga0495586_0009907 | 3300046535 | Bacteria | 5075 |
| 458 | Ga0495586_0129660 | 3300046535 | Bacteria | 1412 |
| 459 | Ga0495667_0144917 | 3300046559 | Bacteria | 1530 |
| 460 | Ga0495634_0093187 | 3300046642 | Bacteria | 1954 |
| 461 | Ga0495613_0049103 | 3300046689 | Bacteria | 3115 |
| 462 | Ga0495613_0117446 | 3300046689 | Bacteria | 1913 |
| 463 | Ga0495649_0085949 | 3300046694 | Bacteria | 1679 |
| 464 | Ga0495581_0079942 | 3300047315 | Bacteria | 1892 |
| 465 | Ga0495674_0127048 | 3300047319 | Bacteria | 2150 |
| 466 | Ga0495672_0006723 | 3300047320 | Bacteria | 8825 |
| 467 | Ga0495672_0009778 | 3300047320 | Bacteria | 6908 |
| 468 | Ga0495676_0087859 | 3300047321 | Unclassified | 2334 |
| 469 | Ga0495684_0084947 | 3300047471 | Bacteria | 2400 |
| 470 | Ga0495686_0007964 | 3300047472 | Bacteria | 7861 |
| 471 | Ga0495686_0017898 | 3300047472 | Bacteria | 4764 |
| 472 | Ga0496102_0008209 | 3300048905 | Bacteria | 8938 |
| 473 | Ga0496117_0000024 | 3300048920 | Bacteria | 418750 |
| 474 | Ga0496118_0000014 | 3300048921 | Bacteria | 561628 |
| 475 | Ga0496119_0033696 | 3300048922 | Bacteria | 3389 |
| 476 | Ga0496120_0040847 | 3300048923 | Bacteria | 2722 |
| 477 | Ga0496121_0168859 | 3300048924 | Bacteria | 1591 |
| 478 | Ga0496125_0010134 | 3300048928 | Bacteria | 9559 |
| 479 | Ga0496126_0095439 | 3300048929 | Bacteria | 2608 |
| 480 | Ga0501298_001954 | 3300049521 | Bacteria | 3075 |
| 481 | Ga0501300_003630 | 3300049523 | Bacteria | 2297 |
| 482 | Ga0501032_0005565 | 3300049569 | Bacteria | 9344 |
| 483 | Ga0501033_0069530 | 3300049570 | Bacteria | 2587 |
| 484 | Ga0501034_0009606 | 3300049571 | Bacteria | 10120 |
| 485 | Ga0501036_0083808 | 3300049572 | Bacteria | 2695 |
| 486 | Ga0501037_0027459 | 3300049573 | Bacteria | 4205 |
| 487 | Ga0501038_0237889 | 3300049574 | Bacteria | 1447 |
| 488 | Ga0501043_0016206 | 3300049579 | Bacteria | 5846 |
| 489 | Ga0501043_0124808 | 3300049579 | Bacteria | 2018 |
| 490 | Ga0501046_0024824 | 3300049580 | Bacteria | 4912 |
| 491 | Ga0501046_0039167 | 3300049580 | Bacteria | 3798 |
| 492 | Ga0501047_0014051 | 3300049581 | Bacteria | 7608 |
| 493 | Ga0501047_0041298 | 3300049581 | Bacteria | 4457 |
| 494 | Ga0501047_0092695 | 3300049581 | Bacteria | 2899 |
| 495 | Ga0501047_0189091 | 3300049581 | Bacteria | 1923 |
| 496 | Ga0501047_0421309 | 3300049581 | Bacteria | 1166 |
| 497 | Ga0501048_0251583 | 3300049582 | Bacteria | 1254 |
| 498 | Ga0501201_001378 | 3300049651 | Unclassified | 2274 |
| 499 | Ga0501223_002591 | 3300049663 | Bacteria | 3989 |
| 500 | Ga0501233_011581 | 3300049668 | Unclassified | 1757 |
| 501 | Ga0501235_001457 | 3300049669 | Bacteria | 5054 |
| 502 | Ga0501225_0001171 | 3300049705 | Bacteria | 8185 |
| 503 | Ga0501245_001158 | 3300049708 | Unclassified | 3397 |
| 504 | Ga0501083_0004427 | 3300049744 | Bacteria | 9916 |
| 505 | Ga0501083_0006491 | 3300049744 | Bacteria | 8295 |
| 506 | Ga0501268_018902 | 3300049765 | Bacteria | 1163 |
| 507 | Ga0501035_0036169 | 3300049822 | Bacteria | 4476 |
| 508 | Ga0501035_0194599 | 3300049822 | Bacteria | 1742 |
| 509 | Ga0501044_0000164 | 3300049823 | Bacteria | 82524 |
| 510 | Ga0501044_0003052 | 3300049823 | Bacteria | 18942 |
| 511 | Ga0501044_0011990 | 3300049823 | Bacteria | 9391 |
| 512 | nmdc:mga0k408_24818_c1 | 3300050493 | Bacteria | 3391 |
| 513 | nmdc:mga0k408_9007_c1 | 3300050493 | Bacteria | 5371 |
| 514 | nmdc:mga07m45_43730_c1 | 3300050496 | Bacteria | 2014 |
| 515 | nmdc:mga09592_25444_c1 | 3300050508 | Bacteria | 4899 |
| 516 | nmdc:mga0qj67_161221_c1 | 3300050509 | Bacteria | 1821 |
| 517 | nmdc:mga08y16_22614_c1 | 3300050511 | Bacteria | 6638 |
| 518 | Ga0500578_0000541 | 3300053086 | Bacteria | 45881 |
| 519 | Ga0500644_0017854 | 3300053088 | Bacteria | 2068 |
| 520 | Ga0500583_0000010 | 3300053092 | Bacteria | 160546 |
| 521 | Ga0500583_0022010 | 3300053092 | Bacteria | 2663 |
| 522 | Ga0500562_000047 | 3300053108 | Bacteria | 62430 |
| 523 | Ga0500618_003456 | 3300053125 | Bacteria | 5399 |
| 524 | Ga0500568_0000384 | 3300053139 | Bacteria | 33842 |
| 525 | Ga0500568_0023359 | 3300053139 | Bacteria | 2630 |
| 526 | Ga0500568_0029784 | 3300053139 | Bacteria | 2262 |
| 527 | Ga0500616_0000029 | 3300053153 | Bacteria | 428959 |
| 528 | Ga0500636_0020031 | 3300053177 | Bacteria | 3957 |
| 529 | Ga0590071_000313 | 3300059421 | Bacteria | 14137 |
| 530 | Ga0501082_0084642 | 3300060353 | Bacteria | 2735 |
| 531 | Ga0530510_0181338 | 3300061734 | Bacteria | 1562 |
| 532 | 2522548736 | 2522125168 | Bacteria | 7376607 |
| 533 | 2738728948 | 2738541278 | Bacteria | 9755573 |
| 534 | 2833641133 | 2833640130 | Bacteria | 4858325 |
| 535 | 2842905669 | 2842903701 | Bacteria | 6986368 |
| 536 | 2852628665 | 2852627209 | Bacteria | 5896285 |
| 537 | 2929158216 | 2929154850 | Bacteria | 6753285 |
| 538 | 8055594924 | 8055592153 | Bacteria | 5961247 |
| 539 | Ga0068871_100132660 | |||
| 540 | JGI25157J39369_1004310 | |||
| 541 | rootH1_10024218 | |||
| 542 | rootH1_10161050 | |||
| 543 | rootH2_10075092 | |||
| 544 | rootH2_10097574 | |||
| 545 | rootL2_10258882 | |||
| 546 | rootH1_10001274 | |||
| 547 | rootH1_10067642 | |||
| 548 | rootH1_10186264 | |||
| 549 | Ga0065165_1000339 | |||
| 550 | Ga0065712_10001843 | |||
| 551 | Ga0065712_10010183 | |||
| 552 | Ga0070658_10008572 | |||
| 553 | Ga0070676_10029567 | |||
| 554 | Ga0070676_10116297 | |||
| 555 | Ga0070676_10240623 | |||
| 556 | Ga0070683_100077200 | |||
| 557 | Ga0070683_100208227 | |||
| 558 | Ga0070683_100258127 | |||
| 559 | Ga0070690_100102708 | |||
| 560 | Ga0070670_100029433 | |||
| 561 | Ga0070670_100042327 | |||
| 562 | Ga0070670_100132453 | |||
| 563 | Ga0070670_100219904 | |||
| 564 | Ga0070670_100250797 | |||
| 565 | Ga0068869_100074548 | |||
| 566 | Ga0068869_100120842 | |||
| 567 | Ga0070666_10033777 | |||
| 568 | Ga0070666_10292232 | |||
| 569 | Ga0068868_100062675 | |||
| 570 | Ga0068868_100099599 | |||
| 571 | Ga0068868_100110428 | |||
| 572 | Ga0070660_100004826 | |||
| 573 | Ga0070660_100022747 | |||
| 574 | Ga0070660_100326431 | |||
| 575 | Ga0070689_100007881 | |||
| 576 | Ga0070689_100011739 | |||
| 577 | Ga0070689_100013858 | |||
| 578 | Ga0070689_100106150 | |||
| 579 | Ga0070668_100057156 | |||
| 580 | Ga0070669_100011834 | |||
| 581 | Ga0070675_100029823 | |||
| 582 | Ga0070675_100098910 | |||
| 583 | Ga0070675_100511160 | |||
| 584 | Ga0070671_100061012 | |||
| 585 | Ga0070674_100014222 | |||
| 586 | Ga0070673_100103920 | |||
| 587 | Ga0070673_100172181 | |||
| 588 | Ga0070688_100112628 | |||
| 589 | Ga0070659_100000283 | |||
| 590 | Ga0070659_100000388 | |||
| 591 | Ga0070667_100034185 | |||
| 592 | Ga0070667_100036925 | |||
| 593 | Ga0070667_100056816 | |||
| 594 | Ga0070667_100154450 | |||
| 595 | Ga0070667_100222101 | |||
| 596 | Ga0070667_100317582 | |||
| 597 | Ga0070713_100111977 | |||
| 598 | Ga0070710_10094766 | |||
| 599 | Ga0070705_100120647 | |||
| 600 | Ga0070700_100010880 | |||
| 601 | Ga0070708_100456613 | |||
| 602 | Ga0070663_100028972 | |||
| 603 | Ga0070663_100044482 | |||
| 604 | Ga0070663_100079351 | |||
| 605 | Ga0070681_10012850 | |||
| 606 | Ga0068867_100205705 | |||
| 607 | Ga0070685_10001083 | |||
| 608 | Ga0070685_10004433 | |||
| 609 | Ga0070706_100038362 | |||
| 610 | Ga0070706_100099963 | |||
| 611 | Ga0070707_100151555 | |||
| 612 | Ga0070698_100001594 | |||
| 613 | Ga0070698_100002353 | |||
| 614 | Ga0070698_100019792 | |||
| 615 | Ga0070698_100035039 | |||
| 616 | Ga0070699_100028385 | |||
| 617 | Ga0070684_100103655 | |||
| 618 | Ga0070684_100249383 | |||
| 619 | Ga0070697_100042299 | |||
| 620 | Ga0068853_100000262 | |||
| 621 | Ga0068853_100003684 | |||
| 622 | Ga0068853_100051531 | |||
| 623 | Ga0068853_100058080 | |||
| 624 | Ga0068853_100068304 | |||
| 625 | Ga0068853_100070184 | |||
| 626 | Ga0070672_100335695 | |||
| 627 | Ga0070665_100000147 | |||
| 628 | Ga0070665_100002590 | |||
| 629 | Ga0070665_100037526 | |||
| 630 | Ga0070665_100385772 | |||
| 631 | Ga0068855_100017913 | |||
| 632 | Ga0070664_100016847 | |||
| 633 | Ga0070664_100025210 | |||
| 634 | Ga0070664_100237059 | |||
| 635 | Ga0068857_100062124 | |||
| 636 | Ga0068857_100101283 | |||
| 637 | Ga0068857_100163008 | |||
| 638 | Ga0068857_100177966 | |||
| 639 | Ga0068854_100000003 | |||
| 640 | Ga0068854_100046345 | |||
| 641 | Ga0068854_100071287 | |||
| 642 | Ga0068856_100000696 | |||
| 643 | Ga0068856_100002940 | |||
| 644 | Ga0068856_100024306 | |||
| 645 | Ga0068856_100044839 | |||
| 646 | Ga0068852_100075811 | |||
| 647 | Ga0068859_100003461 | |||
| 648 | Ga0068859_100006947 | |||
| 649 | Ga0068859_100026403 | |||
| 650 | Ga0068859_100033142 | |||
| 651 | Ga0068859_100158611 | |||
| 652 | Ga0068859_100160571 | |||
| 653 | Ga0068859_100174858 | |||
| 654 | Ga0068859_100321029 | |||
| 655 | Ga0068864_100037040 | |||
| 656 | Ga0068864_100135772 | |||
| 657 | Ga0068864_100292812 | |||
| 658 | Ga0068866_10065883 | |||
| 659 | Ga0068861_100036857 | |||
| 660 | Ga0068861_100053829 | |||
| 661 | Ga0068861_100087709 | |||
| 662 | Ga0068861_100391596 | |||
| 663 | Ga0068861_100444545 | |||
| 664 | Ga0068870_10043181 | |||
| 665 | Ga0068863_100000902 | |||
| 666 | Ga0068863_100188213 | |||
| 667 | Ga0068863_100508361 | |||
| 668 | Ga0068858_100022778 | |||
| 669 | Ga0068858_100087398 | |||
| 670 | Ga0068858_100252230 | |||
| 671 | Ga0068860_100000086 | |||
| 672 | Ga0068860_100003144 | |||
| 673 | Ga0068860_100251950 | |||
| 674 | Ga0068862_100043235 | |||
| 675 | Ga0068862_100176173 | |||
| 676 | Ga0081538_10002277 | |||
| 677 | Ga0081539_10010894 | |||
| 678 | Ga0070717_10007754 | |||
| 679 | Ga0075366_10002957 | |||
| 680 | Ga0097621_100021967 | |||
| 681 | Ga0097621_100048486 | |||
| 682 | Ga0068871_100274294 | |||
| 683 | Ga0068871_100530410 | |||
| 684 | Ga0075428_100099540 | |||
| 685 | Ga0075428_100113557 | |||
| 686 | Ga0075428_100139359 | |||
| 687 | Ga0075428_100236635 | |||
| 688 | Ga0075428_100566571 | |||
| 689 | Ga0075430_100009549 | |||
| 690 | Ga0075431_100205748 | |||
| 691 | Ga0075429_100122198 | |||
| 692 | Ga0068865_100032646 | |||
| 693 | Ga0097620_100003461 | |||
| 694 | Ga0097620_100006947 | |||
| 695 | Ga0097620_100026403 | |||
| 696 | Ga0097620_100033145 | |||
| 697 | Ga0097620_100158612 | |||
| 698 | Ga0097620_100160575 | |||
| 699 | Ga0097620_100174849 | |||
| 700 | Ga0097620_100321041 | |||
| 701 | Ga0099826_10114455 | |||
| 702 | Ga0105240_10000025 | |||
| 703 | Ga0105240_10001310 | |||
| 704 | Ga0105240_10036487 | |||
| 705 | Ga0105240_10082773 | |||
| 706 | Ga0105240_10205010 | |||
| 707 | Ga0105240_10351384 | |||
| 708 | Ga0111539_10006050 | |||
| 709 | Ga0111539_10023250 | |||
| 710 | Ga0105247_10034039 | |||
| 711 | Ga0105241_10020658 | |||
| 712 | Ga0105241_10050063 | |||
| 713 | Ga0105241_10053524 | |||
| 714 | Ga0105241_10094880 | |||
| 715 | Ga0105241_10119006 | |||
| 716 | Ga0105242_10032080 | |||
| 717 | Ga0105248_10052483 | |||
| 718 | Ga0105237_10000956 | |||
| 719 | Ga0105237_10004809 | |||
| 720 | Ga0105237_10006566 | |||
| 721 | Ga0105237_10033577 | |||
| 722 | Ga0105237_10045710 | |||
| 723 | Ga0105237_10105917 | |||
| 724 | Ga0105238_10015803 | |||
| 725 | Ga0105249_10017506 | |||
| 726 | Ga0105249_10083084 | |||
| 727 | Ga0105249_10139688 | |||
| 728 | Ga0105239_10002721 | |||
| 729 | Ga0105239_10003157 | |||
| 730 | Ga0105239_10006117 | |||
| 731 | Ga0105239_10052493 | |||
| 732 | Ga0105239_10061136 | |||
| 733 | Ga0105239_10826837 | |||
| 734 | Ga0157373_10000181 | |||
| 735 | Ga0157371_10002315 | |||
| 736 | Ga0157371_10018428 | |||
| 737 | Ga0157371_10121910 | |||
| 738 | Ga0157371_10145917 | |||
| 739 | Ga0157370_10001428 | |||
| 740 | Ga0157370_10053297 | |||
| 741 | Ga0157369_10001781 | |||
| 742 | Ga0157369_10193180 | |||
| 743 | Ga0157374_10001290 | |||
| 744 | Ga0157374_10047192 | |||
| 745 | Ga0157378_10168473 | |||
| 746 | Ga0157378_10171193 | |||
| 747 | Ga0157378_10310885 | |||
| 748 | Ga0163162_10020055 | |||
| 749 | Ga0163162_10065745 | |||
| 750 | Ga0163162_10267247 | |||
| 751 | Ga0163162_10341387 | |||
| 752 | Ga0163162_10517124 | |||
| 753 | Ga0157372_10000021 | |||
| 754 | Ga0157372_10007746 | |||
| 755 | Ga0157372_10009340 | |||
| 756 | Ga0157372_10079589 | |||
| 757 | Ga0157372_10141278 | |||
| 758 | Ga0157372_10470830 | |||
| 759 | Ga0157372_10584260 | |||
| 760 | Ga0157375_10017390 | |||
| 761 | Ga0157375_10114555 | |||
| 762 | Ga0157375_10122272 | |||
| 763 | Ga0157375_10281209 | |||
| 764 | Ga0157375_10300537 | |||
| 765 | Ga0163163_10000688 | |||
| 766 | Ga0163163_10002343 | |||
| 767 | Ga0163163_10067280 | |||
| 768 | Ga0163163_10090002 | |||
| 769 | Ga0157380_10000353 | |||
| 770 | Ga0157380_10033159 | |||
| 771 | Ga0157377_10002310 | |||
| 772 | Ga0157377_10133884 | |||
| 773 | Ga0157379_10029651 | |||
| 774 | Ga0157379_10083830 | |||
| 775 | Ga0157376_10065549 | |||
| 776 | Ga0213872_10011081 | |||
| 777 | Ga0213872_10011839 | |||
| 778 | Ga0213876_10000226 | |||
| 779 | Ga0213876_10001281 | |||
| 780 | Ga0213876_10034190 | |||
| 781 | Ga0213875_10048733 | |||
| 782 | Ga0213871_10006104 | |||
| 783 | Ga0213871_10006288 | |||
| 784 | Ga0209026_1000387 | |||
| 785 | Ga0209676_1000232 | |||
| 786 | Ga0207697_10022976 | |||
| 787 | Ga0207642_10107147 | |||
| 788 | Ga0207688_10023055 | |||
| 789 | Ga0207688_10132101 | |||
| 790 | Ga0207680_10246903 | |||
| 791 | Ga0207699_10154002 | |||
| 792 | Ga0207645_10001468 | |||
| 793 | Ga0207645_10029427 | |||
| 794 | Ga0207643_10022107 | |||
| 795 | Ga0207684_10172326 | |||
| 796 | Ga0207654_10019627 | |||
| 797 | Ga0207654_10051999 | |||
| 798 | Ga0207654_10058157 | |||
| 799 | Ga0207707_10092055 | |||
| 800 | Ga0207695_10000025 | |||
| 801 | Ga0207695_10006516 | |||
| 802 | Ga0207695_10008429 | |||
| 803 | Ga0207671_10001509 | |||
| 804 | Ga0207671_10007424 | |||
| 805 | Ga0207671_10023364 | |||
| 806 | Ga0207657_10003374 | |||
| 807 | Ga0207657_10058882 | |||
| 808 | Ga0207646_10053033 | |||
| 809 | Ga0207681_10079100 | |||
| 810 | Ga0207694_10023002 | |||
| 811 | Ga0207694_10078704 | |||
| 812 | Ga0207650_10033366 | |||
| 813 | Ga0207650_10194989 | |||
| 814 | Ga0207659_10049896 | |||
| 815 | Ga0207700_10228908 | |||
| 816 | Ga0207644_10134798 | |||
| 817 | Ga0207690_10000354 | |||
| 818 | Ga0207690_10002858 | |||
| 819 | Ga0207706_10035155 | |||
| 820 | Ga0207706_10096519 | |||
| 821 | Ga0207670_10010505 | |||
| 822 | Ga0207670_10037789 | |||
| 823 | Ga0207670_10062211 | |||
| 824 | Ga0207704_10102350 | |||
| 825 | Ga0207665_10076983 | |||
| 826 | Ga0207691_10045016 | |||
| 827 | Ga0207691_10074392 | |||
| 828 | Ga0207689_10015573 | |||
| 829 | Ga0207689_10026235 | |||
| 830 | Ga0207689_10175948 | |||
| 831 | Ga0207661_10239178 | |||
| 832 | Ga0207661_10382718 | |||
| 833 | Ga0207679_10010561 | |||
| 834 | Ga0207679_10102600 | |||
| 835 | Ga0207667_10063368 | |||
| 836 | Ga0207651_10059942 | |||
| 837 | Ga0207712_10048627 | |||
| 838 | Ga0207712_10083744 | |||
| 839 | Ga0207712_10203384 | |||
| 840 | Ga0207640_10000002 | |||
| 841 | Ga0207640_10071496 | |||
| 842 | Ga0207658_10056926 | |||
| 843 | Ga0207658_10088812 | |||
| 844 | Ga0207658_10257772 | |||
| 845 | Ga0207658_10271815 | |||
| 846 | Ga0207658_10273314 | |||
| 847 | Ga0207677_10138569 | |||
| 848 | Ga0207677_10349220 | |||
| 849 | Ga0207703_10047346 | |||
| 850 | Ga0207703_10221217 | |||
| 851 | Ga0207639_10000011 | |||
| 852 | Ga0207639_10008511 | |||
| 853 | Ga0207639_10011528 | |||
| 854 | Ga0207639_10053043 | |||
| 855 | Ga0207639_10075616 | |||
| 856 | Ga0207639_10273184 | |||
| 857 | Ga0207678_10006599 | |||
| 858 | Ga0207678_10045692 | |||
| 859 | Ga0207678_10064446 | |||
| 860 | Ga0207708_10052982 | |||
| 861 | Ga0207708_10090978 | |||
| 862 | Ga0207702_10003347 | |||
| 863 | Ga0207702_10024526 | |||
| 864 | Ga0207702_10038947 | |||
| 865 | Ga0207641_10000411 | |||
| 866 | Ga0207641_10071697 | |||
| 867 | Ga0207641_10213691 | |||
| 868 | Ga0207648_10027620 | |||
| 869 | Ga0207676_10001241 | |||
| 870 | Ga0207676_10066005 | |||
| 871 | Ga0207676_10139906 | |||
| 872 | Ga0207674_10014932 | |||
| 873 | Ga0207674_10099945 | |||
| 874 | Ga0207674_10218334 | |||
| 875 | Ga0207675_100000139 | |||
| 876 | Ga0207675_100009714 | |||
| 877 | Ga0207675_100090057 | |||
| 878 | Ga0207675_100621929 | |||
| 879 | Ga0207683_10003547 | |||
| 880 | Ga0207698_10060811 | |||
| 881 | Ga0209974_10011019 | |||
| 882 | Ga0268266_10000030 | |||
| 883 | Ga0268266_10003530 | |||
| 884 | Ga0268266_10021701 | |||
| 885 | Ga0268266_10046127 | |||
| 886 | Ga0268265_10025276 | |||
| 887 | Ga0268264_10000044 | |||
| 888 | Ga0268264_10005286 | |||
| 889 | Ga0268264_10073278 | |||
| 890 | Ga0268264_10084335 | |||
| 891 | Ga0307515_10000002 | |||
| 892 | Ga0265338_10000025 | |||
| 893 | Ga0265338_10000463 | |||
| 894 | Ga0265338_10000699 | |||
| 895 | Ga0265338_10071061 | |||
| 896 | Ga0265338_10240055 | |||
| 897 | Ga0265324_10000417 | |||
| 898 | Ga0316176_1139212 | |||
| 899 | Ga0316183_1148322 | |||
| 900 | Ga0316181_1068791 | |||
| 901 | Ga0265332_10023165 | |||
| 902 | Ga0265320_10000344 | |||
| 903 | Ga0265339_10023769 | |||
| 904 | Ga0265339_10077339 | |||
| 905 | Ga0265331_10122799 | |||
| 906 | Ga0265327_10000245 | |||
| 907 | Ga0265327_10055219 | |||
| 908 | Ga0307513_10074121 | |||
| 909 | Ga0307509_10078351 | |||
| 910 | Ga0307509_10266969 | |||
| 911 | Ga0307408_100000348 | |||
| 912 | Ga0307408_100000836 | |||
| 913 | Ga0307508_10000062 | |||
| 914 | Ga0265314_10064683 | |||
| 915 | Ga0316576_10011184 | |||
| 916 | Ga0316576_10041109 | |||
| 917 | Ga0316578_10148687 | |||
| 918 | Ga0307405_10051581 | |||
| 919 | Ga0307413_10110465 | |||
| 920 | Ga0307410_10032529 | |||
| 921 | Ga0307412_10052426 | |||
| 922 | Ga0307409_100273743 | |||
| 923 | Ga0307414_10020702 | |||
| 924 | Ga0307414_10578083 | |||
| 925 | Ga0307411_10044657 | |||
| 926 | Ga0373951_0030116 | |||
| 927 | Ga0373927_0185433 | |||
| 928 | Ga0316584_0005208 | |||
| 929 | Ga0316584_0059077 | |||
| 930 | Ga0316584_0126461 | |||
| 931 | Ga0373925_0378836 | |||
| 932 | Ga0395899_0000001 | |||
| 933 | Ga0395899_0001857 | |||
| 934 | Ga0436364_0145037 | |||
| 935 | Ga0436364_0699124 | |||
| 936 | Ga0436364_1502188 | |||
| 937 | Ga0400484_23600 | |||
| 938 | Ga0400490_04506 | |||
| 939 | Ga0400490_60002 | |||
| 940 | Ga0400483_037251 | |||
| 941 | Ga0400489_40834 | |||
| 942 | Ga0400489_66758 | |||
| 943 | Ga0400489_67636 | |||
| 944 | Ga0400489_85356 | |||
| 945 | Ga0400487_58339 | |||
| 946 | Ga0436365_0274929 | |||
| 947 | Ga0436365_0616146 | |||
| 948 | Ga0436365_1162856 | |||
| 949 | Ga0436365_1352796 | |||
| 950 | Ga0436360_0620625 | |||
| 951 | Ga0436360_0623808 | |||
| 952 | Ga0436360_1106233 | |||
| 953 | Ga0436360_1348840 | |||
| 954 | Ga0436360_1360656 | |||
| 955 | Ga0436361_0017841 | |||
| 956 | Ga0436361_0161735 | |||
| 957 | Ga0436361_0370652 | |||
| 958 | Ga0436361_0573813 | |||
| 959 | Ga0436361_1061615 | |||
| 960 | Ga0436361_1067145 | |||
| 961 | Ga0436361_1205683 | |||
| 962 | Ga0436363_1253815 | |||
| 963 | Ga0436362_0549261 | |||
| 964 | Ga0439448_0005722 | |||
| 965 | Ga0451577_0000208 | |||
| 966 | Ga0451577_0001527 | |||
| 967 | Ga0451577_0010154 | |||
| 968 | Ga0466969_0031001 | |||
| 969 | Ga0466972_0009748 | |||
| 970 | Ga0466966_0029199 | |||
| 971 | Ga0466961_0019541 | |||
| 972 | Ga0453684_0000668 | |||
| 973 | Ga0453684_0000808 | |||
| 974 | Ga0453684_0004233 | |||
| 975 | Ga0453684_0007860 | |||
| 976 | Ga0453684_0012861 | |||
| 977 | Ga0453684_0086084 | |||
| 978 | Ga0453684_0158614 | |||
| 979 | Ga0453684_0167780 | |||
| 980 | Ga0466957_0000346 | |||
| 981 | Ga0466957_0001044 | |||
| 982 | Ga0466960_0120337 | |||
| 983 | Ga0466959_0006622 | |||
| 984 | Ga0451576_0000104 | |||
| 985 | Ga0451576_0000291 | |||
| 986 | Ga0451576_0042125 | |||
| 987 | Ga0451576_0047627 | |||
| 988 | Ga0495641_0053022 | |||
| 989 | Ga0495662_0091206 | |||
| 990 | Ga0495628_0125002 | |||
| 991 | Ga0495630_0004272 | |||
| 992 | Ga0495652_0079007 | |||
| 993 | Ga0495586_0009907 | |||
| 994 | Ga0495586_0129660 | |||
| 995 | Ga0495667_0144917 | |||
| 996 | Ga0495634_0093187 | |||
| 997 | Ga0495613_0049103 | |||
| 998 | Ga0495613_0117446 | |||
| 999 | Ga0495649_0085949 | |||
| 1000 | Ga0495581_0079942 | |||
| 1001 | Ga0495674_0127048 | |||
| 1002 | Ga0495672_0006723 | |||
| 1003 | Ga0495672_0009778 | |||
| 1004 | Ga0495676_0087859 | |||
| 1005 | Ga0495684_0084947 | |||
| 1006 | Ga0495686_0007964 | |||
| 1007 | Ga0495686_0017898 | |||
| 1008 | Ga0496102_0008209 | |||
| 1009 | Ga0496117_0000024 | |||
| 1010 | Ga0496118_0000014 | |||
| 1011 | Ga0496119_0033696 | |||
| 1012 | Ga0496120_0040847 | |||
| 1013 | Ga0496121_0168859 | |||
| 1014 | Ga0496125_0010134 | |||
| 1015 | Ga0496126_0095439 | |||
| 1016 | Ga0501298_001954 | |||
| 1017 | Ga0501300_003630 | |||
| 1018 | Ga0501032_0005565 | |||
| 1019 | Ga0501033_0069530 | |||
| 1020 | Ga0501034_0009606 | |||
| 1021 | Ga0501036_0083808 | |||
| 1022 | Ga0501037_0027459 | |||
| 1023 | Ga0501038_0237889 | |||
| 1024 | Ga0501043_0016206 | |||
| 1025 | Ga0501043_0124808 | |||
| 1026 | Ga0501046_0024824 | |||
| 1027 | Ga0501046_0039167 | |||
| 1028 | Ga0501047_0014051 | |||
| 1029 | Ga0501047_0041298 | |||
| 1030 | Ga0501047_0092695 | |||
| 1031 | Ga0501047_0189091 | |||
| 1032 | Ga0501047_0421309 | |||
| 1033 | Ga0501048_0251583 | |||
| 1034 | Ga0501201_001378 | |||
| 1035 | Ga0501223_002591 | |||
| 1036 | Ga0501233_011581 | |||
| 1037 | Ga0501235_001457 | |||
| 1038 | Ga0501225_0001171 | |||
| 1039 | Ga0501245_001158 | |||
| 1040 | Ga0501083_0004427 | |||
| 1041 | Ga0501083_0006491 | |||
| 1042 | Ga0501268_018902 | |||
| 1043 | Ga0501035_0036169 | |||
| 1044 | Ga0501035_0194599 | |||
| 1045 | Ga0501044_0000164 | |||
| 1046 | Ga0501044_0003052 | |||
| 1047 | Ga0501044_0011990 | |||
| 1048 | nmdc:mga0k408_24818_c1 | |||
| 1049 | nmdc:mga0k408_9007_c1 | |||
| 1050 | nmdc:mga07m45_43730_c1 | |||
| 1051 | nmdc:mga09592_25444_c1 | |||
| 1052 | nmdc:mga0qj67_161221_c1 | |||
| 1053 | nmdc:mga08y16_22614_c1 | |||
| 1054 | Ga0500578_0000541 | |||
| 1055 | Ga0500644_0017854 | |||
| 1056 | Ga0500583_0000010 | |||
| 1057 | Ga0500583_0022010 | |||
| 1058 | Ga0500562_000047 | |||
| 1059 | Ga0500618_003456 | |||
| 1060 | Ga0500568_0000384 | |||
| 1061 | Ga0500568_0023359 | |||
| 1062 | Ga0500568_0029784 | |||
| 1063 | Ga0500616_0000029 | |||
| 1064 | Ga0500636_0020031 | |||
| 1065 | Ga0590071_000313 | |||
| 1066 | Ga0501082_0084642 | |||
| 1067 | Ga0530510_0181338 | |||
| 1068 | 2522548736 | |||
| 1069 | 2738728948 | |||
| 1070 | 2833641133 | |||
| 1071 | 2842905669 | |||
| 1072 | 2852628665 | |||
| 1073 | 2929158216 | |||
| 1074 | 8055594924 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6yak-assembly1.cif.gz_DDD | split gene transketolase, active alpha2beta2 heterotetramer | 0.9657 | 12 | 320 |
| 6yak-assembly1.cif.gz_DDD | split gene transketolase, active alpha2beta2 heterotetramer | 0.9505 | 12 | 320 |
| 8a29-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9473 | 12 | 317 |
| 8a4d-assembly3.cif.gz_C-2 | 1-deoxy-d-xylulose 5-phosphate synthase from pseudomonas aeruginosa with a thiamine analog inhibitor | 0.9467 | 12 | 320 |
| 8a45-assembly1.cif.gz_D | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9466 | 12 | 317 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O50408_212_377_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9708 | 16 | 174 | 3.40.50.970 |
| af_Q58092_3_181_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9651 | 12 | 182 | 3.40.50.970 |
| af_I1M1A4_399_568_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9535 | 13 | 178 | 3.40.50.970 |
| af_Q58092_187_315_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9432 | 190 | 321 | 3.40.50.920 |
| 2o1xD03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9422 | 190 | 318 | 3.40.50.920 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3LYR3-F1-model_v4 | Transketolase | 0.988 | 79 | 319 |
GO:0003824
|
| AF-A9CIH0-F1-model_v4 | Transketolase | 0.9808 | 14 | 320 |
GO:0003824
|
| AF-A0A838U199-F1-model_v4 | Transketolase family protein | 0.9802 | 16 | 163 |
GO:0006082
GO:0044272 |
| AF-A0A1F3LYR3-F1-model_v4 | Transketolase | 0.9799 | 79 | 319 |
GO:0003824
|
| AF-A0A7C3B6D2-F1-model_v4 | Transketolase family protein | 0.9798 | 13 | 320 |
GO:0003824
|