F460765

General Info

Members Datasets Scaffolds Average Seq Length
536 274 1074 325

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100132660|Ga0068871_1001326602
Length 365
Sequence MKNEEQRNEKGEEILNIECRMLKFENEAENLRTHSRLTTDNSQTNRMAHIEATDPNGYKPNQEIFSEILQELAAKDRDIIAVTSDSRGSGKLVPFGKKFPEQIVEVGIAEQNLVGVAAGLAAAGKKVFAVSPACFLTARALEQIKNDVAYSDNPVTVVGISAGVSYGALGSTHHSLHDFAALRCINNITVVVPADNFETAQATALAAKTNSPVYLRFGKKVMNSLKEVNDDTFAFGKGRVITEGNDAAIIACGETVYPAVQAAKLLAEQGINATVVSMHTIKPLDTDLLAKLAAKCKAIVTIEEHSVYGGLGEACASYLMQHGLHKPFRIVGIPDEYTVTGSQQDIFNHYHLTKEGIADVVKGLL

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
158 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
159 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
186 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
187 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
188 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
189 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
231 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
243 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
244 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
245 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
246 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
247 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
258 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
259 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
260 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
261 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
262 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
265 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
268 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
269 2738541278 Niastella sp. CF465 Isolate Unclassified
270 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
271 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
272 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
273 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
274 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.17
Nodule 0.19
Rhizoplane 0.19
Rhizosphere 87.87
Stem 0
Stem Tuber 0
Unclassified 12.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100132660 3300006358 Bacteria 2113
2 JGI25157J39369_1004310 3300002741 Bacteria 2627
3 rootH1_10024218 3300003316 Bacteria 6818
4 rootH1_10024218 3300003323 Bacteria 5571
5 rootH1_10161050 3300003316 Bacteria 1095
6 rootH2_10075092 3300003320 Bacteria 12293
7 rootH2_10097574 3300003320 Bacteria 2870
8 rootL2_10258882 3300003322 Bacteria 1160
9 rootH1_10001274 3300003316 Bacteria 18007
10 rootH1_10001274 3300003323 Bacteria 14899
11 rootH1_10067642 3300003323 Bacteria 6630
12 rootH1_10186264 3300003323 Bacteria 3338
13 Ga0065165_1000339 3300005262 Bacteria 76812
14 Ga0065712_10001843 3300005290 Bacteria 5973
15 Ga0065712_10010183 3300005290 Bacteria 3785
16 Ga0070658_10008572 3300005327 Bacteria 8219
17 Ga0070676_10029567 3300005328 Unclassified 3117
18 Ga0070676_10116297 3300005328 Bacteria 1672
19 Ga0070676_10240623 3300005328 Bacteria 1203
20 Ga0070683_100077200 3300005329 Bacteria 3114
21 Ga0070683_100208227 3300005329 Bacteria 1857
22 Ga0070683_100258127 3300005329 Bacteria 1658
23 Ga0070690_100102708 3300005330 Bacteria 1897
24 Ga0070670_100029433 3300005331 Unclassified 4728
25 Ga0070670_100042327 3300005331 Bacteria 3915
26 Ga0070670_100132453 3300005331 Bacteria 2153
27 Ga0070670_100219904 3300005331 Unclassified 1652
28 Ga0070670_100250797 3300005331 Bacteria 1542
29 Ga0068869_100074548 3300005334 Bacteria 2519
30 Ga0068869_100120842 3300005334 Bacteria 2003
31 Ga0070666_10033777 3300005335 Bacteria 3388
32 Ga0070666_10292232 3300005335 Unclassified 1159
33 Ga0068868_100062675 3300005338 Bacteria 2948
34 Ga0068868_100099599 3300005338 Bacteria 2351
35 Ga0068868_100110428 3300005338 Unclassified 2234
36 Ga0070660_100004826 3300005339 Bacteria 9325
37 Ga0070660_100022747 3300005339 Bacteria 4641
38 Ga0070660_100326431 3300005339 Bacteria 1261
39 Ga0070689_100007881 3300005340 Bacteria 7469
40 Ga0070689_100011739 3300005340 Bacteria 6284
41 Ga0070689_100013858 3300005340 Bacteria 5844
42 Ga0070689_100106150 3300005340 Bacteria 2228
43 Ga0070668_100057156 3300005347 Unclassified 3014
44 Ga0070669_100011834 3300005353 Bacteria 6189
45 Ga0070675_100029823 3300005354 Bacteria 4400
46 Ga0070675_100098910 3300005354 Bacteria 2455
47 Ga0070675_100511160 3300005354 Bacteria 1083
48 Ga0070671_100061012 3300005355 Bacteria 3140
49 Ga0070674_100014222 3300005356 Bacteria 4943
50 Ga0070673_100103920 3300005364 Bacteria 2345
51 Ga0070673_100172181 3300005364 Unclassified 1848
52 Ga0070688_100112628 3300005365 Unclassified 1812
53 Ga0070659_100000283 3300005366 Bacteria 39665
54 Ga0070659_100000388 3300005366 Bacteria 33379
55 Ga0070667_100034185 3300005367 Bacteria 4251
56 Ga0070667_100036925 3300005367 Bacteria 4097
57 Ga0070667_100056816 3300005367 Bacteria 3306
58 Ga0070667_100154450 3300005367 Unclassified 2018
59 Ga0070667_100222101 3300005367 Bacteria 1682
60 Ga0070667_100317582 3300005367 Bacteria 1405
61 Ga0070713_100111977 3300005436 Bacteria 2381
62 Ga0070710_10094766 3300005437 Bacteria 1767
63 Ga0070705_100120647 3300005440 Bacteria 1692
64 Ga0070700_100010880 3300005441 Bacteria 5030
65 Ga0070708_100456613 3300005445 Bacteria 1205
66 Ga0070663_100028972 3300005455 Bacteria 3777
67 Ga0070663_100044482 3300005455 Unclassified 3131
68 Ga0070663_100079351 3300005455 Bacteria 2408
69 Ga0070681_10012850 3300005458 Bacteria 8314
70 Ga0068867_100205705 3300005459 Bacteria 1578
71 Ga0070685_10001083 3300005466 Bacteria 14560
72 Ga0070685_10004433 3300005466 Bacteria 7095
73 Ga0070706_100038362 3300005467 Bacteria 4420
74 Ga0070706_100099963 3300005467 Bacteria 2695
75 Ga0070707_100151555 3300005468 Bacteria 2258
76 Ga0070698_100001594 3300005471 Bacteria 25216
77 Ga0070698_100002353 3300005471 Bacteria 20885
78 Ga0070698_100019792 3300005471 Bacteria 7060
79 Ga0070698_100035039 3300005471 Bacteria 5191
80 Ga0070699_100028385 3300005518 Bacteria 4825
81 Ga0070684_100103655 3300005535 Bacteria 2545
82 Ga0070684_100249383 3300005535 Bacteria 1623
83 Ga0070697_100042299 3300005536 Bacteria 3687
84 Ga0068853_100000262 3300005539 Bacteria 37061
85 Ga0068853_100003684 3300005539 Bacteria 11757
86 Ga0068853_100051531 3300005539 Bacteria 3542
87 Ga0068853_100058080 3300005539 Bacteria 3340
88 Ga0068853_100068304 3300005539 Bacteria 3089
89 Ga0068853_100070184 3300005539 Bacteria 3049
90 Ga0070672_100335695 3300005543 Bacteria 1286
91 Ga0070665_100000147 3300005548 Bacteria 129683
92 Ga0070665_100002590 3300005548 Bacteria 19751
93 Ga0070665_100037526 3300005548 Bacteria 4873
94 Ga0070665_100385772 3300005548 Bacteria 1408
95 Ga0068855_100017913 3300005563 Bacteria 8510
96 Ga0070664_100016847 3300005564 Bacteria 5999
97 Ga0070664_100025210 3300005564 Bacteria 4927
98 Ga0070664_100237059 3300005564 Bacteria 1637
99 Ga0068857_100062124 3300005577 Bacteria 3320
100 Ga0068857_100101283 3300005577 Unclassified 2585
101 Ga0068857_100163008 3300005577 Bacteria 2023
102 Ga0068857_100177966 3300005577 Bacteria 1935
103 Ga0068854_100000003 3300005578 Bacteria 330045
104 Ga0068854_100046345 3300005578 Bacteria 3095
105 Ga0068854_100071287 3300005578 Unclassified 2542
106 Ga0068856_100000696 3300005614 Bacteria 36434
107 Ga0068856_100002940 3300005614 Bacteria 17462
108 Ga0068856_100024306 3300005614 Bacteria 5896
109 Ga0068856_100044839 3300005614 Bacteria 4352
110 Ga0068852_100075811 3300005616 Bacteria 2968
111 Ga0068859_100003461 3300005617 Bacteria 16049
112 Ga0068859_100006947 3300005617 Bacteria 11497
113 Ga0068859_100026403 3300005617 Bacteria 5823
114 Ga0068859_100033142 3300005617 Bacteria 5188
115 Ga0068859_100158611 3300005617 Unclassified 2341
116 Ga0068859_100160571 3300005617 Bacteria 2327
117 Ga0068859_100174858 3300005617 Bacteria 2229
118 Ga0068859_100321029 3300005617 Unclassified 1643
119 Ga0068864_100037040 3300005618 Bacteria 4160
120 Ga0068864_100135772 3300005618 Unclassified 2215
121 Ga0068864_100292812 3300005618 Bacteria 1522
122 Ga0068866_10065883 3300005718 Bacteria 1896
123 Ga0068861_100036857 3300005719 Bacteria 3632
124 Ga0068861_100053829 3300005719 Bacteria 3064
125 Ga0068861_100087709 3300005719 Bacteria 2449
126 Ga0068861_100391596 3300005719 Bacteria 1231
127 Ga0068861_100444545 3300005719 Unclassified 1160
128 Ga0068870_10043181 3300005840 Unclassified 2351
129 Ga0068863_100000902 3300005841 Bacteria 29865
130 Ga0068863_100188213 3300005841 Bacteria 1983
131 Ga0068863_100508361 3300005841 Unclassified 1187
132 Ga0068858_100022778 3300005842 Bacteria 5841
133 Ga0068858_100087398 3300005842 Bacteria 2899
134 Ga0068858_100252230 3300005842 Bacteria 1676
135 Ga0068860_100000086 3300005843 Bacteria 165786
136 Ga0068860_100003144 3300005843 Bacteria 17057
137 Ga0068860_100251950 3300005843 Unclassified 1720
138 Ga0068862_100043235 3300005844 Bacteria 3840
139 Ga0068862_100176173 3300005844 Bacteria 1917
140 Ga0081538_10002277 3300005981 Bacteria 18973
141 Ga0081539_10010894 3300005985 Bacteria 7301
142 Ga0070717_10007754 3300006028 Bacteria 7986
143 Ga0075366_10002957 3300006195 Bacteria 8849
144 Ga0097621_100021967 3300006237 Unclassified 4945
145 Ga0097621_100048486 3300006237 Unclassified 3446
146 Ga0068871_100274294 3300006358 Unclassified 1474
147 Ga0068871_100530410 3300006358 Unclassified 1064
148 Ga0075428_100099540 3300006844 Bacteria 3170
149 Ga0075428_100113557 3300006844 Bacteria 2951
150 Ga0075428_100139359 3300006844 Bacteria 2637
151 Ga0075428_100236635 3300006844 Unclassified 1970
152 Ga0075428_100566571 3300006844 Unclassified 1214
153 Ga0075430_100009549 3300006846 Bacteria 8197
154 Ga0075431_100205748 3300006847 Bacteria 2012
155 Ga0075429_100122198 3300006880 Bacteria 2276
156 Ga0068865_100032646 3300006881 Bacteria 3480
157 Ga0097620_100003461 3300006931 Bacteria 16049
158 Ga0097620_100006947 3300006931 Bacteria 11497
159 Ga0097620_100026403 3300006931 Bacteria 5823
160 Ga0097620_100033145 3300006931 Bacteria 5188
161 Ga0097620_100158612 3300006931 Unclassified 2341
162 Ga0097620_100160575 3300006931 Bacteria 2327
163 Ga0097620_100174849 3300006931 Bacteria 2229
164 Ga0097620_100321041 3300006931 Unclassified 1643
165 Ga0099826_10114455 3300006948 Bacteria 1601
166 Ga0105240_10000025 3300009093 Bacteria 367124
167 Ga0105240_10001310 3300009093 Bacteria 42943
168 Ga0105240_10036487 3300009093 Bacteria 6322
169 Ga0105240_10082773 3300009093 Bacteria 3941
170 Ga0105240_10205010 3300009093 Bacteria 2309
171 Ga0105240_10351384 3300009093 Bacteria 1672
172 Ga0111539_10006050 3300009094 Bacteria 15621
173 Ga0111539_10023250 3300009094 Bacteria 7614
174 Ga0105247_10034039 3300009101 Unclassified 3102
175 Ga0105241_10020658 3300009174 Bacteria 4865
176 Ga0105241_10050063 3300009174 Bacteria 3183
177 Ga0105241_10053524 3300009174 Unclassified 3087
178 Ga0105241_10094880 3300009174 Bacteria 2360
179 Ga0105241_10119006 3300009174 Unclassified 2124
180 Ga0105242_10032080 3300009176 Unclassified 4200
181 Ga0105248_10052483 3300009177 Bacteria 4575
182 Ga0105237_10000956 3300009545 Bacteria 38876
183 Ga0105237_10004809 3300009545 Bacteria 15518
184 Ga0105237_10006566 3300009545 Bacteria 12865
185 Ga0105237_10033577 3300009545 Bacteria 5199
186 Ga0105237_10045710 3300009545 Bacteria 4405
187 Ga0105237_10105917 3300009545 Bacteria 2803
188 Ga0105238_10015803 3300009551 Bacteria 7640
189 Ga0105249_10017506 3300009553 Bacteria 6363
190 Ga0105249_10083084 3300009553 Bacteria 2981
191 Ga0105249_10139688 3300009553 Unclassified 2321
192 Ga0105239_10002721 3300010375 Bacteria 22219
193 Ga0105239_10003157 3300010375 Bacteria 20424
194 Ga0105239_10006117 3300010375 Bacteria 14008
195 Ga0105239_10052493 3300010375 Bacteria 4471
196 Ga0105239_10061136 3300010375 Bacteria 4134
197 Ga0105239_10826837 3300010375 Bacteria 1062
198 Ga0157373_10000181 3300013100 Bacteria 51804
199 Ga0157371_10002315 3300013102 Bacteria 18316
200 Ga0157371_10018428 3300013102 Bacteria 5162
201 Ga0157371_10121910 3300013102 Bacteria 1854
202 Ga0157371_10145917 3300013102 Bacteria 1686
203 Ga0157370_10001428 3300013104 Bacteria 29651
204 Ga0157370_10053297 3300013104 Bacteria 3858
205 Ga0157369_10001781 3300013105 Bacteria 26087
206 Ga0157369_10193180 3300013105 Bacteria 2138
207 Ga0157374_10001290 3300013296 Bacteria 21307
208 Ga0157374_10047192 3300013296 Bacteria 3992
209 Ga0157378_10168473 3300013297 Bacteria 2053
210 Ga0157378_10171193 3300013297 Unclassified 2037
211 Ga0157378_10310885 3300013297 Bacteria 1528
212 Ga0163162_10020055 3300013306 Bacteria 6566
213 Ga0163162_10065745 3300013306 Bacteria 3674
214 Ga0163162_10267247 3300013306 Bacteria 1842
215 Ga0163162_10341387 3300013306 Bacteria 1630
216 Ga0163162_10517124 3300013306 Bacteria 1323
217 Ga0157372_10000021 3300013307 Bacteria 207801
218 Ga0157372_10007746 3300013307 Bacteria 11410
219 Ga0157372_10009340 3300013307 Bacteria 10435
220 Ga0157372_10079589 3300013307 Bacteria 3706
221 Ga0157372_10141278 3300013307 Bacteria 2774
222 Ga0157372_10470830 3300013307 Bacteria 1464
223 Ga0157372_10584260 3300013307 Bacteria 1302
224 Ga0157375_10017390 3300013308 Bacteria 6487
225 Ga0157375_10114555 3300013308 Bacteria 2798
226 Ga0157375_10122272 3300013308 Bacteria 2714
227 Ga0157375_10281209 3300013308 Bacteria 1827
228 Ga0157375_10300537 3300013308 Bacteria 1769
229 Ga0163163_10000688 3300014325 Bacteria 28732
230 Ga0163163_10002343 3300014325 Bacteria 16027
231 Ga0163163_10067280 3300014325 Bacteria 3562
232 Ga0163163_10090002 3300014325 Bacteria 3082
233 Ga0157380_10000353 3300014326 Bacteria 27534
234 Ga0157380_10033159 3300014326 Bacteria 3976
235 Ga0157377_10002310 3300014745 Bacteria 8387
236 Ga0157377_10133884 3300014745 Unclassified 1517
237 Ga0157379_10029651 3300014968 Bacteria 4864
238 Ga0157379_10083830 3300014968 Unclassified 2857
239 Ga0157376_10065549 3300014969 Bacteria 3067
240 Ga0213872_10011081 3300021361 Unclassified 4274
241 Ga0213872_10011839 3300021361 Bacteria 4121
242 Ga0213876_10000226 3300021384 Bacteria 55955
243 Ga0213876_10001281 3300021384 Bacteria 15870
244 Ga0213876_10034190 3300021384 Bacteria 2681
245 Ga0213875_10048733 3300021388 Bacteria 1987
246 Ga0213871_10006104 3300021441 Bacteria 2532
247 Ga0213871_10006288 3300021441 Unclassified 2505
248 Ga0209026_1000387 3300025250 Bacteria 39998
249 Ga0209676_1000232 3300025292 Bacteria 120363
250 Ga0207697_10022976 3300025315 Bacteria 2554
251 Ga0207642_10107147 3300025899 Bacteria 1415
252 Ga0207688_10023055 3300025901 Bacteria 3406
253 Ga0207688_10132101 3300025901 Bacteria 1464
254 Ga0207680_10246903 3300025903 Unclassified 1232
255 Ga0207699_10154002 3300025906 Bacteria 1524
256 Ga0207645_10001468 3300025907 Bacteria 19262
257 Ga0207645_10029427 3300025907 Bacteria 3542
258 Ga0207643_10022107 3300025908 Bacteria 3499
259 Ga0207684_10172326 3300025910 Bacteria 1865
260 Ga0207654_10019627 3300025911 Bacteria 3571
261 Ga0207654_10051999 3300025911 Bacteria 2360
262 Ga0207654_10058157 3300025911 Bacteria 2250
263 Ga0207707_10092055 3300025912 Bacteria 2649
264 Ga0207695_10000025 3300025913 Bacteria 627211
265 Ga0207695_10006516 3300025913 Bacteria 15114
266 Ga0207695_10008429 3300025913 Bacteria 12907
267 Ga0207671_10001509 3300025914 Bacteria 26781
268 Ga0207671_10007424 3300025914 Bacteria 9514
269 Ga0207671_10023364 3300025914 Bacteria 4662
270 Ga0207657_10003374 3300025919 Bacteria 17074
271 Ga0207657_10058882 3300025919 Bacteria 3303
272 Ga0207646_10053033 3300025922 Bacteria 3628
273 Ga0207681_10079100 3300025923 Unclassified 2316
274 Ga0207694_10023002 3300025924 Bacteria 4729
275 Ga0207694_10078704 3300025924 Bacteria 2585
276 Ga0207650_10033366 3300025925 Bacteria 3728
277 Ga0207650_10194989 3300025925 Bacteria 1620
278 Ga0207659_10049896 3300025926 Bacteria 2970
279 Ga0207700_10228908 3300025928 Bacteria 1579
280 Ga0207644_10134798 3300025931 Unclassified 1895
281 Ga0207690_10000354 3300025932 Bacteria 30499
282 Ga0207690_10002858 3300025932 Bacteria 10408
283 Ga0207706_10035155 3300025933 Bacteria 4457
284 Ga0207706_10096519 3300025933 Bacteria 2599
285 Ga0207670_10010505 3300025936 Bacteria 5339
286 Ga0207670_10037789 3300025936 Unclassified 3148
287 Ga0207670_10062211 3300025936 Bacteria 2550
288 Ga0207704_10102350 3300025938 Unclassified 1913
289 Ga0207665_10076983 3300025939 Bacteria 2289
290 Ga0207691_10045016 3300025940 Bacteria 4059
291 Ga0207691_10074392 3300025940 Bacteria 3064
292 Ga0207689_10015573 3300025942 Bacteria 6441
293 Ga0207689_10026235 3300025942 Bacteria 4879
294 Ga0207689_10175948 3300025942 Unclassified 1765
295 Ga0207661_10239178 3300025944 Bacteria 1610
296 Ga0207661_10382718 3300025944 Bacteria 1274
297 Ga0207679_10010561 3300025945 Bacteria 5951
298 Ga0207679_10102600 3300025945 Unclassified 2240
299 Ga0207667_10063368 3300025949 Bacteria 3862
300 Ga0207651_10059942 3300025960 Unclassified 2639
301 Ga0207712_10048627 3300025961 Bacteria 2951
302 Ga0207712_10083744 3300025961 Unclassified 2328
303 Ga0207712_10203384 3300025961 Bacteria 1572
304 Ga0207640_10000002 3300025981 Bacteria 524211
305 Ga0207640_10071496 3300025981 Unclassified 2337
306 Ga0207658_10056926 3300025986 Bacteria 2903
307 Ga0207658_10088812 3300025986 Bacteria 2391
308 Ga0207658_10257772 3300025986 Bacteria 1485
309 Ga0207658_10271815 3300025986 Unclassified 1449
310 Ga0207658_10273314 3300025986 Unclassified 1445
311 Ga0207677_10138569 3300026023 Unclassified 1859
312 Ga0207677_10349220 3300026023 Bacteria 1239
313 Ga0207703_10047346 3300026035 Unclassified 3466
314 Ga0207703_10221217 3300026035 Unclassified 1693
315 Ga0207639_10000011 3300026041 Bacteria 381897
316 Ga0207639_10008511 3300026041 Bacteria 7035
317 Ga0207639_10011528 3300026041 Bacteria 6141
318 Ga0207639_10053043 3300026041 Bacteria 3092
319 Ga0207639_10075616 3300026041 Bacteria 2649
320 Ga0207639_10273184 3300026041 Bacteria 1483
321 Ga0207678_10006599 3300026067 Bacteria 10291
322 Ga0207678_10045692 3300026067 Bacteria 3787
323 Ga0207678_10064446 3300026067 Bacteria 3148
324 Ga0207708_10052982 3300026075 Bacteria 3090
325 Ga0207708_10090978 3300026075 Unclassified 2352
326 Ga0207702_10003347 3300026078 Bacteria 14701
327 Ga0207702_10024526 3300026078 Bacteria 5004
328 Ga0207702_10038947 3300026078 Bacteria 3982
329 Ga0207641_10000411 3300026088 Bacteria 50003
330 Ga0207641_10071697 3300026088 Bacteria 2981
331 Ga0207641_10213691 3300026088 Bacteria 1785
332 Ga0207648_10027620 3300026089 Bacteria 5038
333 Ga0207676_10001241 3300026095 Bacteria 18980
334 Ga0207676_10066005 3300026095 Unclassified 2884
335 Ga0207676_10139906 3300026095 Bacteria 2071
336 Ga0207674_10014932 3300026116 Bacteria 8558
337 Ga0207674_10099945 3300026116 Unclassified 2883
338 Ga0207674_10218334 3300026116 Bacteria 1855
339 Ga0207675_100000139 3300026118 Bacteria 62161
340 Ga0207675_100009714 3300026118 Bacteria 9005
341 Ga0207675_100090057 3300026118 Bacteria 2884
342 Ga0207675_100621929 3300026118 Bacteria 1084
343 Ga0207683_10003547 3300026121 Bacteria 13606
344 Ga0207698_10060811 3300026142 Bacteria 2939
345 Ga0209974_10011019 3300027876 Bacteria 3044
346 Ga0268266_10000030 3300028379 Bacteria 417120
347 Ga0268266_10003530 3300028379 Bacteria 15524
348 Ga0268266_10021701 3300028379 Bacteria 5472
349 Ga0268266_10046127 3300028379 Bacteria 3731
350 Ga0268265_10025276 3300028380 Bacteria 4213
351 Ga0268264_10000044 3300028381 Bacteria 368079
352 Ga0268264_10005286 3300028381 Bacteria 10933
353 Ga0268264_10073278 3300028381 Unclassified 2906
354 Ga0268264_10084335 3300028381 Bacteria 2724
355 Ga0307515_10000002 3300028794 Bacteria 1231751
356 Ga0265338_10000025 3300028800 Bacteria 296972
357 Ga0265338_10000463 3300028800 Bacteria 72298
358 Ga0265338_10000699 3300028800 Bacteria 57627
359 Ga0265338_10071061 3300028800 Bacteria 2981
360 Ga0265338_10240055 3300028800 Bacteria 1343
361 Ga0265324_10000417 3300029957 Bacteria 30508
362 Ga0316176_1139212 3300030732 Bacteria 7209
363 Ga0316183_1148322 3300030742 Bacteria 26985
364 Ga0316181_1068791 3300030744 Bacteria 41630
365 Ga0265332_10023165 3300031238 Bacteria 2739
366 Ga0265320_10000344 3300031240 Bacteria 37824
367 Ga0265339_10023769 3300031249 Unclassified 3540
368 Ga0265339_10077339 3300031249 Bacteria 1764
369 Ga0265331_10122799 3300031250 Bacteria 1187
370 Ga0265327_10000245 3300031251 Bacteria 108670
371 Ga0265327_10055219 3300031251 Bacteria 2052
372 Ga0307513_10074121 3300031456 Bacteria 3541
373 Ga0307509_10078351 3300031507 Bacteria 3424
374 Ga0307509_10266969 3300031507 Bacteria 1482
375 Ga0307408_100000348 3300031548 Bacteria 43347
376 Ga0307408_100000836 3300031548 Bacteria 24310
377 Ga0307508_10000062 3300031616 Bacteria 123066
378 Ga0265314_10064683 3300031711 Bacteria 2475
379 Ga0316576_10011184 3300031727 Bacteria 5867
380 Ga0316576_10041109 3300031727 Bacteria 3326
381 Ga0316578_10148687 3300031728 Unclassified 1411
382 Ga0307405_10051581 3300031731 Bacteria 2553
383 Ga0307413_10110465 3300031824 Bacteria 1840
384 Ga0307410_10032529 3300031852 Bacteria 3358
385 Ga0307412_10052426 3300031911 Bacteria 2701
386 Ga0307409_100273743 3300031995 Bacteria 1556
387 Ga0307414_10020702 3300032004 Bacteria 4106
388 Ga0307414_10578083 3300032004 Bacteria 1005
389 Ga0307411_10044657 3300032005 Bacteria 2845
390 Ga0373951_0030116 3300035091 Bacteria 1276
391 Ga0373927_0185433 3300035695 Unclassified 1365
392 Ga0316584_0005208 3300036712 Bacteria 8695
393 Ga0316584_0059077 3300036712 Bacteria 2872
394 Ga0316584_0126461 3300036712 Unclassified 1909
395 Ga0373925_0378836 3300037068 Bacteria 1152
396 Ga0395899_0000001 3300037312 Bacteria 1750322
397 Ga0395899_0001857 3300037312 Bacteria 17464
398 Ga0436364_0145037 3300037853 Bacteria 10259
399 Ga0436364_0699124 3300037853 Bacteria 1421
400 Ga0436364_1502188 3300037853 Bacteria 3821
401 Ga0400484_23600 3300038725 Bacteria 8321
402 Ga0400490_04506 3300038726 Bacteria 6397
403 Ga0400490_60002 3300038726 Unclassified 1117
404 Ga0400483_037251 3300039062 Bacteria 16134
405 Ga0400489_40834 3300039093 Bacteria 2002
406 Ga0400489_66758 3300039093 Bacteria 6700
407 Ga0400489_67636 3300039093 Bacteria 5912
408 Ga0400489_85356 3300039093 Bacteria 1354
409 Ga0400487_58339 3300039110 Bacteria 2520
410 Ga0436365_0274929 3300039437 Bacteria 28216
411 Ga0436365_0616146 3300039437 Bacteria 1955
412 Ga0436365_1162856 3300039437 Bacteria 4623
413 Ga0436365_1352796 3300039437 Bacteria 16338
414 Ga0436360_0620625 3300039438 Unclassified 4157
415 Ga0436360_0623808 3300039438 Bacteria 7477
416 Ga0436360_1106233 3300039438 Unclassified 3160
417 Ga0436360_1348840 3300039438 Bacteria 3039
418 Ga0436360_1360656 3300039438 Bacteria 1812
419 Ga0436361_0017841 3300039447 Unclassified 1889
420 Ga0436361_0161735 3300039447 Bacteria 2925
421 Ga0436361_0370652 3300039447 Bacteria 4895
422 Ga0436361_0573813 3300039447 Bacteria 3323
423 Ga0436361_1061615 3300039447 Bacteria 1303
424 Ga0436361_1067145 3300039447 Bacteria 5898
425 Ga0436361_1205683 3300039447 Bacteria 5970
426 Ga0436363_1253815 3300039450 Bacteria 3542
427 Ga0436362_0549261 3300039453 Bacteria 2242
428 Ga0439448_0005722 3300042005 Bacteria 3548
429 Ga0451577_0000208 3300042876 Bacteria 122820
430 Ga0451577_0001527 3300042876 Bacteria 30403
431 Ga0451577_0010154 3300042876 Bacteria 9018
432 Ga0466969_0031001 3300044656 Bacteria 2723
433 Ga0466972_0009748 3300044658 Bacteria 4821
434 Ga0466966_0029199 3300044684 Bacteria 3589
435 Ga0466961_0019541 3300044693 Bacteria 4358
436 Ga0453684_0000668 3300044712 Bacteria 122805
437 Ga0453684_0000808 3300044712 Bacteria 106678
438 Ga0453684_0004233 3300044712 Bacteria 30729
439 Ga0453684_0007860 3300044712 Bacteria 19402
440 Ga0453684_0012861 3300044712 Bacteria 13711
441 Ga0453684_0086084 3300044712 Bacteria 3902
442 Ga0453684_0158614 3300044712 Bacteria 2678
443 Ga0453684_0167780 3300044712 Bacteria 2590
444 Ga0466957_0000346 3300044842 Bacteria 22659
445 Ga0466957_0001044 3300044842 Bacteria 14285
446 Ga0466960_0120337 3300044901 Bacteria 1374
447 Ga0466959_0006622 3300045049 Bacteria 8044
448 Ga0451576_0000104 3300045051 Bacteria 215927
449 Ga0451576_0000291 3300045051 Bacteria 122805
450 Ga0451576_0042125 3300045051 Unclassified 4822
451 Ga0451576_0047627 3300045051 Bacteria 4506
452 Ga0495641_0053022 3300046461 Bacteria 1846
453 Ga0495662_0091206 3300046476 Bacteria 1486
454 Ga0495628_0125002 3300046516 Bacteria 1971
455 Ga0495630_0004272 3300046517 Bacteria 10020
456 Ga0495652_0079007 3300046529 Bacteria 2722
457 Ga0495586_0009907 3300046535 Bacteria 5075
458 Ga0495586_0129660 3300046535 Bacteria 1412
459 Ga0495667_0144917 3300046559 Bacteria 1530
460 Ga0495634_0093187 3300046642 Bacteria 1954
461 Ga0495613_0049103 3300046689 Bacteria 3115
462 Ga0495613_0117446 3300046689 Bacteria 1913
463 Ga0495649_0085949 3300046694 Bacteria 1679
464 Ga0495581_0079942 3300047315 Bacteria 1892
465 Ga0495674_0127048 3300047319 Bacteria 2150
466 Ga0495672_0006723 3300047320 Bacteria 8825
467 Ga0495672_0009778 3300047320 Bacteria 6908
468 Ga0495676_0087859 3300047321 Unclassified 2334
469 Ga0495684_0084947 3300047471 Bacteria 2400
470 Ga0495686_0007964 3300047472 Bacteria 7861
471 Ga0495686_0017898 3300047472 Bacteria 4764
472 Ga0496102_0008209 3300048905 Bacteria 8938
473 Ga0496117_0000024 3300048920 Bacteria 418750
474 Ga0496118_0000014 3300048921 Bacteria 561628
475 Ga0496119_0033696 3300048922 Bacteria 3389
476 Ga0496120_0040847 3300048923 Bacteria 2722
477 Ga0496121_0168859 3300048924 Bacteria 1591
478 Ga0496125_0010134 3300048928 Bacteria 9559
479 Ga0496126_0095439 3300048929 Bacteria 2608
480 Ga0501298_001954 3300049521 Bacteria 3075
481 Ga0501300_003630 3300049523 Bacteria 2297
482 Ga0501032_0005565 3300049569 Bacteria 9344
483 Ga0501033_0069530 3300049570 Bacteria 2587
484 Ga0501034_0009606 3300049571 Bacteria 10120
485 Ga0501036_0083808 3300049572 Bacteria 2695
486 Ga0501037_0027459 3300049573 Bacteria 4205
487 Ga0501038_0237889 3300049574 Bacteria 1447
488 Ga0501043_0016206 3300049579 Bacteria 5846
489 Ga0501043_0124808 3300049579 Bacteria 2018
490 Ga0501046_0024824 3300049580 Bacteria 4912
491 Ga0501046_0039167 3300049580 Bacteria 3798
492 Ga0501047_0014051 3300049581 Bacteria 7608
493 Ga0501047_0041298 3300049581 Bacteria 4457
494 Ga0501047_0092695 3300049581 Bacteria 2899
495 Ga0501047_0189091 3300049581 Bacteria 1923
496 Ga0501047_0421309 3300049581 Bacteria 1166
497 Ga0501048_0251583 3300049582 Bacteria 1254
498 Ga0501201_001378 3300049651 Unclassified 2274
499 Ga0501223_002591 3300049663 Bacteria 3989
500 Ga0501233_011581 3300049668 Unclassified 1757
501 Ga0501235_001457 3300049669 Bacteria 5054
502 Ga0501225_0001171 3300049705 Bacteria 8185
503 Ga0501245_001158 3300049708 Unclassified 3397
504 Ga0501083_0004427 3300049744 Bacteria 9916
505 Ga0501083_0006491 3300049744 Bacteria 8295
506 Ga0501268_018902 3300049765 Bacteria 1163
507 Ga0501035_0036169 3300049822 Bacteria 4476
508 Ga0501035_0194599 3300049822 Bacteria 1742
509 Ga0501044_0000164 3300049823 Bacteria 82524
510 Ga0501044_0003052 3300049823 Bacteria 18942
511 Ga0501044_0011990 3300049823 Bacteria 9391
512 nmdc:mga0k408_24818_c1 3300050493 Bacteria 3391
513 nmdc:mga0k408_9007_c1 3300050493 Bacteria 5371
514 nmdc:mga07m45_43730_c1 3300050496 Bacteria 2014
515 nmdc:mga09592_25444_c1 3300050508 Bacteria 4899
516 nmdc:mga0qj67_161221_c1 3300050509 Bacteria 1821
517 nmdc:mga08y16_22614_c1 3300050511 Bacteria 6638
518 Ga0500578_0000541 3300053086 Bacteria 45881
519 Ga0500644_0017854 3300053088 Bacteria 2068
520 Ga0500583_0000010 3300053092 Bacteria 160546
521 Ga0500583_0022010 3300053092 Bacteria 2663
522 Ga0500562_000047 3300053108 Bacteria 62430
523 Ga0500618_003456 3300053125 Bacteria 5399
524 Ga0500568_0000384 3300053139 Bacteria 33842
525 Ga0500568_0023359 3300053139 Bacteria 2630
526 Ga0500568_0029784 3300053139 Bacteria 2262
527 Ga0500616_0000029 3300053153 Bacteria 428959
528 Ga0500636_0020031 3300053177 Bacteria 3957
529 Ga0590071_000313 3300059421 Bacteria 14137
530 Ga0501082_0084642 3300060353 Bacteria 2735
531 Ga0530510_0181338 3300061734 Bacteria 1562
532 2522548736 2522125168 Bacteria 7376607
533 2738728948 2738541278 Bacteria 9755573
534 2833641133 2833640130 Bacteria 4858325
535 2842905669 2842903701 Bacteria 6986368
536 2852628665 2852627209 Bacteria 5896285
537 2929158216 2929154850 Bacteria 6753285
538 8055594924 8055592153 Bacteria 5961247
539 Ga0068871_100132660
540 JGI25157J39369_1004310
541 rootH1_10024218
542 rootH1_10161050
543 rootH2_10075092
544 rootH2_10097574
545 rootL2_10258882
546 rootH1_10001274
547 rootH1_10067642
548 rootH1_10186264
549 Ga0065165_1000339
550 Ga0065712_10001843
551 Ga0065712_10010183
552 Ga0070658_10008572
553 Ga0070676_10029567
554 Ga0070676_10116297
555 Ga0070676_10240623
556 Ga0070683_100077200
557 Ga0070683_100208227
558 Ga0070683_100258127
559 Ga0070690_100102708
560 Ga0070670_100029433
561 Ga0070670_100042327
562 Ga0070670_100132453
563 Ga0070670_100219904
564 Ga0070670_100250797
565 Ga0068869_100074548
566 Ga0068869_100120842
567 Ga0070666_10033777
568 Ga0070666_10292232
569 Ga0068868_100062675
570 Ga0068868_100099599
571 Ga0068868_100110428
572 Ga0070660_100004826
573 Ga0070660_100022747
574 Ga0070660_100326431
575 Ga0070689_100007881
576 Ga0070689_100011739
577 Ga0070689_100013858
578 Ga0070689_100106150
579 Ga0070668_100057156
580 Ga0070669_100011834
581 Ga0070675_100029823
582 Ga0070675_100098910
583 Ga0070675_100511160
584 Ga0070671_100061012
585 Ga0070674_100014222
586 Ga0070673_100103920
587 Ga0070673_100172181
588 Ga0070688_100112628
589 Ga0070659_100000283
590 Ga0070659_100000388
591 Ga0070667_100034185
592 Ga0070667_100036925
593 Ga0070667_100056816
594 Ga0070667_100154450
595 Ga0070667_100222101
596 Ga0070667_100317582
597 Ga0070713_100111977
598 Ga0070710_10094766
599 Ga0070705_100120647
600 Ga0070700_100010880
601 Ga0070708_100456613
602 Ga0070663_100028972
603 Ga0070663_100044482
604 Ga0070663_100079351
605 Ga0070681_10012850
606 Ga0068867_100205705
607 Ga0070685_10001083
608 Ga0070685_10004433
609 Ga0070706_100038362
610 Ga0070706_100099963
611 Ga0070707_100151555
612 Ga0070698_100001594
613 Ga0070698_100002353
614 Ga0070698_100019792
615 Ga0070698_100035039
616 Ga0070699_100028385
617 Ga0070684_100103655
618 Ga0070684_100249383
619 Ga0070697_100042299
620 Ga0068853_100000262
621 Ga0068853_100003684
622 Ga0068853_100051531
623 Ga0068853_100058080
624 Ga0068853_100068304
625 Ga0068853_100070184
626 Ga0070672_100335695
627 Ga0070665_100000147
628 Ga0070665_100002590
629 Ga0070665_100037526
630 Ga0070665_100385772
631 Ga0068855_100017913
632 Ga0070664_100016847
633 Ga0070664_100025210
634 Ga0070664_100237059
635 Ga0068857_100062124
636 Ga0068857_100101283
637 Ga0068857_100163008
638 Ga0068857_100177966
639 Ga0068854_100000003
640 Ga0068854_100046345
641 Ga0068854_100071287
642 Ga0068856_100000696
643 Ga0068856_100002940
644 Ga0068856_100024306
645 Ga0068856_100044839
646 Ga0068852_100075811
647 Ga0068859_100003461
648 Ga0068859_100006947
649 Ga0068859_100026403
650 Ga0068859_100033142
651 Ga0068859_100158611
652 Ga0068859_100160571
653 Ga0068859_100174858
654 Ga0068859_100321029
655 Ga0068864_100037040
656 Ga0068864_100135772
657 Ga0068864_100292812
658 Ga0068866_10065883
659 Ga0068861_100036857
660 Ga0068861_100053829
661 Ga0068861_100087709
662 Ga0068861_100391596
663 Ga0068861_100444545
664 Ga0068870_10043181
665 Ga0068863_100000902
666 Ga0068863_100188213
667 Ga0068863_100508361
668 Ga0068858_100022778
669 Ga0068858_100087398
670 Ga0068858_100252230
671 Ga0068860_100000086
672 Ga0068860_100003144
673 Ga0068860_100251950
674 Ga0068862_100043235
675 Ga0068862_100176173
676 Ga0081538_10002277
677 Ga0081539_10010894
678 Ga0070717_10007754
679 Ga0075366_10002957
680 Ga0097621_100021967
681 Ga0097621_100048486
682 Ga0068871_100274294
683 Ga0068871_100530410
684 Ga0075428_100099540
685 Ga0075428_100113557
686 Ga0075428_100139359
687 Ga0075428_100236635
688 Ga0075428_100566571
689 Ga0075430_100009549
690 Ga0075431_100205748
691 Ga0075429_100122198
692 Ga0068865_100032646
693 Ga0097620_100003461
694 Ga0097620_100006947
695 Ga0097620_100026403
696 Ga0097620_100033145
697 Ga0097620_100158612
698 Ga0097620_100160575
699 Ga0097620_100174849
700 Ga0097620_100321041
701 Ga0099826_10114455
702 Ga0105240_10000025
703 Ga0105240_10001310
704 Ga0105240_10036487
705 Ga0105240_10082773
706 Ga0105240_10205010
707 Ga0105240_10351384
708 Ga0111539_10006050
709 Ga0111539_10023250
710 Ga0105247_10034039
711 Ga0105241_10020658
712 Ga0105241_10050063
713 Ga0105241_10053524
714 Ga0105241_10094880
715 Ga0105241_10119006
716 Ga0105242_10032080
717 Ga0105248_10052483
718 Ga0105237_10000956
719 Ga0105237_10004809
720 Ga0105237_10006566
721 Ga0105237_10033577
722 Ga0105237_10045710
723 Ga0105237_10105917
724 Ga0105238_10015803
725 Ga0105249_10017506
726 Ga0105249_10083084
727 Ga0105249_10139688
728 Ga0105239_10002721
729 Ga0105239_10003157
730 Ga0105239_10006117
731 Ga0105239_10052493
732 Ga0105239_10061136
733 Ga0105239_10826837
734 Ga0157373_10000181
735 Ga0157371_10002315
736 Ga0157371_10018428
737 Ga0157371_10121910
738 Ga0157371_10145917
739 Ga0157370_10001428
740 Ga0157370_10053297
741 Ga0157369_10001781
742 Ga0157369_10193180
743 Ga0157374_10001290
744 Ga0157374_10047192
745 Ga0157378_10168473
746 Ga0157378_10171193
747 Ga0157378_10310885
748 Ga0163162_10020055
749 Ga0163162_10065745
750 Ga0163162_10267247
751 Ga0163162_10341387
752 Ga0163162_10517124
753 Ga0157372_10000021
754 Ga0157372_10007746
755 Ga0157372_10009340
756 Ga0157372_10079589
757 Ga0157372_10141278
758 Ga0157372_10470830
759 Ga0157372_10584260
760 Ga0157375_10017390
761 Ga0157375_10114555
762 Ga0157375_10122272
763 Ga0157375_10281209
764 Ga0157375_10300537
765 Ga0163163_10000688
766 Ga0163163_10002343
767 Ga0163163_10067280
768 Ga0163163_10090002
769 Ga0157380_10000353
770 Ga0157380_10033159
771 Ga0157377_10002310
772 Ga0157377_10133884
773 Ga0157379_10029651
774 Ga0157379_10083830
775 Ga0157376_10065549
776 Ga0213872_10011081
777 Ga0213872_10011839
778 Ga0213876_10000226
779 Ga0213876_10001281
780 Ga0213876_10034190
781 Ga0213875_10048733
782 Ga0213871_10006104
783 Ga0213871_10006288
784 Ga0209026_1000387
785 Ga0209676_1000232
786 Ga0207697_10022976
787 Ga0207642_10107147
788 Ga0207688_10023055
789 Ga0207688_10132101
790 Ga0207680_10246903
791 Ga0207699_10154002
792 Ga0207645_10001468
793 Ga0207645_10029427
794 Ga0207643_10022107
795 Ga0207684_10172326
796 Ga0207654_10019627
797 Ga0207654_10051999
798 Ga0207654_10058157
799 Ga0207707_10092055
800 Ga0207695_10000025
801 Ga0207695_10006516
802 Ga0207695_10008429
803 Ga0207671_10001509
804 Ga0207671_10007424
805 Ga0207671_10023364
806 Ga0207657_10003374
807 Ga0207657_10058882
808 Ga0207646_10053033
809 Ga0207681_10079100
810 Ga0207694_10023002
811 Ga0207694_10078704
812 Ga0207650_10033366
813 Ga0207650_10194989
814 Ga0207659_10049896
815 Ga0207700_10228908
816 Ga0207644_10134798
817 Ga0207690_10000354
818 Ga0207690_10002858
819 Ga0207706_10035155
820 Ga0207706_10096519
821 Ga0207670_10010505
822 Ga0207670_10037789
823 Ga0207670_10062211
824 Ga0207704_10102350
825 Ga0207665_10076983
826 Ga0207691_10045016
827 Ga0207691_10074392
828 Ga0207689_10015573
829 Ga0207689_10026235
830 Ga0207689_10175948
831 Ga0207661_10239178
832 Ga0207661_10382718
833 Ga0207679_10010561
834 Ga0207679_10102600
835 Ga0207667_10063368
836 Ga0207651_10059942
837 Ga0207712_10048627
838 Ga0207712_10083744
839 Ga0207712_10203384
840 Ga0207640_10000002
841 Ga0207640_10071496
842 Ga0207658_10056926
843 Ga0207658_10088812
844 Ga0207658_10257772
845 Ga0207658_10271815
846 Ga0207658_10273314
847 Ga0207677_10138569
848 Ga0207677_10349220
849 Ga0207703_10047346
850 Ga0207703_10221217
851 Ga0207639_10000011
852 Ga0207639_10008511
853 Ga0207639_10011528
854 Ga0207639_10053043
855 Ga0207639_10075616
856 Ga0207639_10273184
857 Ga0207678_10006599
858 Ga0207678_10045692
859 Ga0207678_10064446
860 Ga0207708_10052982
861 Ga0207708_10090978
862 Ga0207702_10003347
863 Ga0207702_10024526
864 Ga0207702_10038947
865 Ga0207641_10000411
866 Ga0207641_10071697
867 Ga0207641_10213691
868 Ga0207648_10027620
869 Ga0207676_10001241
870 Ga0207676_10066005
871 Ga0207676_10139906
872 Ga0207674_10014932
873 Ga0207674_10099945
874 Ga0207674_10218334
875 Ga0207675_100000139
876 Ga0207675_100009714
877 Ga0207675_100090057
878 Ga0207675_100621929
879 Ga0207683_10003547
880 Ga0207698_10060811
881 Ga0209974_10011019
882 Ga0268266_10000030
883 Ga0268266_10003530
884 Ga0268266_10021701
885 Ga0268266_10046127
886 Ga0268265_10025276
887 Ga0268264_10000044
888 Ga0268264_10005286
889 Ga0268264_10073278
890 Ga0268264_10084335
891 Ga0307515_10000002
892 Ga0265338_10000025
893 Ga0265338_10000463
894 Ga0265338_10000699
895 Ga0265338_10071061
896 Ga0265338_10240055
897 Ga0265324_10000417
898 Ga0316176_1139212
899 Ga0316183_1148322
900 Ga0316181_1068791
901 Ga0265332_10023165
902 Ga0265320_10000344
903 Ga0265339_10023769
904 Ga0265339_10077339
905 Ga0265331_10122799
906 Ga0265327_10000245
907 Ga0265327_10055219
908 Ga0307513_10074121
909 Ga0307509_10078351
910 Ga0307509_10266969
911 Ga0307408_100000348
912 Ga0307408_100000836
913 Ga0307508_10000062
914 Ga0265314_10064683
915 Ga0316576_10011184
916 Ga0316576_10041109
917 Ga0316578_10148687
918 Ga0307405_10051581
919 Ga0307413_10110465
920 Ga0307410_10032529
921 Ga0307412_10052426
922 Ga0307409_100273743
923 Ga0307414_10020702
924 Ga0307414_10578083
925 Ga0307411_10044657
926 Ga0373951_0030116
927 Ga0373927_0185433
928 Ga0316584_0005208
929 Ga0316584_0059077
930 Ga0316584_0126461
931 Ga0373925_0378836
932 Ga0395899_0000001
933 Ga0395899_0001857
934 Ga0436364_0145037
935 Ga0436364_0699124
936 Ga0436364_1502188
937 Ga0400484_23600
938 Ga0400490_04506
939 Ga0400490_60002
940 Ga0400483_037251
941 Ga0400489_40834
942 Ga0400489_66758
943 Ga0400489_67636
944 Ga0400489_85356
945 Ga0400487_58339
946 Ga0436365_0274929
947 Ga0436365_0616146
948 Ga0436365_1162856
949 Ga0436365_1352796
950 Ga0436360_0620625
951 Ga0436360_0623808
952 Ga0436360_1106233
953 Ga0436360_1348840
954 Ga0436360_1360656
955 Ga0436361_0017841
956 Ga0436361_0161735
957 Ga0436361_0370652
958 Ga0436361_0573813
959 Ga0436361_1061615
960 Ga0436361_1067145
961 Ga0436361_1205683
962 Ga0436363_1253815
963 Ga0436362_0549261
964 Ga0439448_0005722
965 Ga0451577_0000208
966 Ga0451577_0001527
967 Ga0451577_0010154
968 Ga0466969_0031001
969 Ga0466972_0009748
970 Ga0466966_0029199
971 Ga0466961_0019541
972 Ga0453684_0000668
973 Ga0453684_0000808
974 Ga0453684_0004233
975 Ga0453684_0007860
976 Ga0453684_0012861
977 Ga0453684_0086084
978 Ga0453684_0158614
979 Ga0453684_0167780
980 Ga0466957_0000346
981 Ga0466957_0001044
982 Ga0466960_0120337
983 Ga0466959_0006622
984 Ga0451576_0000104
985 Ga0451576_0000291
986 Ga0451576_0042125
987 Ga0451576_0047627
988 Ga0495641_0053022
989 Ga0495662_0091206
990 Ga0495628_0125002
991 Ga0495630_0004272
992 Ga0495652_0079007
993 Ga0495586_0009907
994 Ga0495586_0129660
995 Ga0495667_0144917
996 Ga0495634_0093187
997 Ga0495613_0049103
998 Ga0495613_0117446
999 Ga0495649_0085949
1000 Ga0495581_0079942
1001 Ga0495674_0127048
1002 Ga0495672_0006723
1003 Ga0495672_0009778
1004 Ga0495676_0087859
1005 Ga0495684_0084947
1006 Ga0495686_0007964
1007 Ga0495686_0017898
1008 Ga0496102_0008209
1009 Ga0496117_0000024
1010 Ga0496118_0000014
1011 Ga0496119_0033696
1012 Ga0496120_0040847
1013 Ga0496121_0168859
1014 Ga0496125_0010134
1015 Ga0496126_0095439
1016 Ga0501298_001954
1017 Ga0501300_003630
1018 Ga0501032_0005565
1019 Ga0501033_0069530
1020 Ga0501034_0009606
1021 Ga0501036_0083808
1022 Ga0501037_0027459
1023 Ga0501038_0237889
1024 Ga0501043_0016206
1025 Ga0501043_0124808
1026 Ga0501046_0024824
1027 Ga0501046_0039167
1028 Ga0501047_0014051
1029 Ga0501047_0041298
1030 Ga0501047_0092695
1031 Ga0501047_0189091
1032 Ga0501047_0421309
1033 Ga0501048_0251583
1034 Ga0501201_001378
1035 Ga0501223_002591
1036 Ga0501233_011581
1037 Ga0501235_001457
1038 Ga0501225_0001171
1039 Ga0501245_001158
1040 Ga0501083_0004427
1041 Ga0501083_0006491
1042 Ga0501268_018902
1043 Ga0501035_0036169
1044 Ga0501035_0194599
1045 Ga0501044_0000164
1046 Ga0501044_0003052
1047 Ga0501044_0011990
1048 nmdc:mga0k408_24818_c1
1049 nmdc:mga0k408_9007_c1
1050 nmdc:mga07m45_43730_c1
1051 nmdc:mga09592_25444_c1
1052 nmdc:mga0qj67_161221_c1
1053 nmdc:mga08y16_22614_c1
1054 Ga0500578_0000541
1055 Ga0500644_0017854
1056 Ga0500583_0000010
1057 Ga0500583_0022010
1058 Ga0500562_000047
1059 Ga0500618_003456
1060 Ga0500568_0000384
1061 Ga0500568_0023359
1062 Ga0500568_0029784
1063 Ga0500616_0000029
1064 Ga0500636_0020031
1065 Ga0590071_000313
1066 Ga0501082_0084642
1067 Ga0530510_0181338
1068 2522548736
1069 2738728948
1070 2833641133
1071 2842905669
1072 2852628665
1073 2929158216
1074 8055594924

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02780

Transketolase_C

Transketolase, C-terminal domain

236

357

0.99

PF02779

Transket_pyr

Transketolase, pyrimidine binding domain

59

224

0.97

PF22613

Transketolase_C_1

Transketolase-like TK C-terminal domain

237

353

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yak-assembly1.cif.gz_DDD split gene transketolase, active alpha2beta2 heterotetramer 0.9657 12 320
6yak-assembly1.cif.gz_DDD split gene transketolase, active alpha2beta2 heterotetramer 0.9505 12 320
8a29-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9473 12 317
8a4d-assembly3.cif.gz_C-2 1-deoxy-d-xylulose 5-phosphate synthase from pseudomonas aeruginosa with a thiamine analog inhibitor 0.9467 12 320
8a45-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9466 12 317
ID Description Score Start End Superfamily
af_O50408_212_377_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9708 16 174 3.40.50.970
af_Q58092_3_181_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9651 12 182 3.40.50.970
af_I1M1A4_399_568_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9535 13 178 3.40.50.970
af_Q58092_187_315_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9432 190 321 3.40.50.920
2o1xD03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9422 190 318 3.40.50.920
ID Description Score Start End GO Terms
AF-A0A1F3LYR3-F1-model_v4 Transketolase 0.988 79 319 GO:0003824
AF-A9CIH0-F1-model_v4 Transketolase 0.9808 14 320 GO:0003824
AF-A0A838U199-F1-model_v4 Transketolase family protein 0.9802 16 163 GO:0006082
GO:0044272
AF-A0A1F3LYR3-F1-model_v4 Transketolase 0.9799 79 319 GO:0003824
AF-A0A7C3B6D2-F1-model_v4 Transketolase family protein 0.9798 13 320 GO:0003824

Map