F460772
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 536 | 282 | 534 | 353 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10060682|Ga0111539_100606822 |
| Length | 395 |
| Sequence | LTFTYVTGKPTGHDSQKENHMSAVRVLVGTKKGAFICSADAKRQKWEVSGPLFGGWEVYHMKGSPSDPNRIYASQSSGWFGQIIQRSDDGGKSWNTPGTPSEPTTGASTEGMPKGESNKFVYDTSPKTGKPLTTHQWYDGTQHPWEFKRVWHLEPSLSDANTVYAGVEDAAFFKTTDGGKNWQEMAGLRAAHGDKWSPGAGGLGLHTILIDPTNPNRMYIAISAAGAFRTDDGGKTWKPINKGLKSEYIPDPDAPVGHCVHRIALHKSKPGTLYMQKHWDVMRTDDAGENWREVSGNLPSDFGFPIDVHAHEPETIYVVPITSDSLHYPPEGKLRVYRSKTGGGEWEPLTRGLPQKDCYVNVLRDAMAVDQLPDCGVYFGTTGGAVLSVEVQTLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 2 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 90 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 91 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 135 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 136 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 141 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 142 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 143 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 144 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 145 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 147 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 151 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 157 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 158 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 159 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 162 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 163 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 164 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 165 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 168 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 169 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 170 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 171 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 172 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 173 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 174 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 175 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 176 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 177 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 178 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 179 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 180 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 236 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 244 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 245 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 279 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 280 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 281 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.83 |
| Metatranscriptomes | 2.8 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.56 |
| Nodule | 0 |
| Rhizoplane | 3.92 |
| Rhizosphere | 92.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000658 | 3300000546 | Bacteria | 5820 |
| 2 | JGI25406J46586_10000459 | 3300003203 | Bacteria | 19008 |
| 3 | JGI25406J46586_10007505 | 3300003203 | Bacteria | 4972 |
| 4 | Ga0058863_10054814 | 3300004799 | Bacteria | 3565 |
| 5 | Ga0058863_11370755 | 3300004799 | Bacteria | 1569 |
| 6 | Ga0058863_11897541 | 3300004799 | Bacteria | 2599 |
| 7 | Ga0065712_10003594 | 3300005290 | Bacteria | 5224 |
| 8 | Ga0065712_10009242 | 3300005290 | Bacteria | 3598 |
| 9 | Ga0065715_10023999 | 3300005293 | Bacteria | 1534 |
| 10 | Ga0070658_10000510 | 3300005327 | Bacteria | 33665 |
| 11 | Ga0070683_100002619 | 3300005329 | Bacteria | 14392 |
| 12 | Ga0070683_100003346 | 3300005329 | Bacteria | 12977 |
| 13 | Ga0070683_100020451 | 3300005329 | Bacteria | 5891 |
| 14 | Ga0070683_100047912 | 3300005329 | Bacteria | 3950 |
| 15 | Ga0070683_100071483 | 3300005329 | Bacteria | 3238 |
| 16 | Ga0070683_100253386 | 3300005329 | Bacteria | 1674 |
| 17 | Ga0070670_100003002 | 3300005331 | Bacteria | 13969 |
| 18 | Ga0068869_100045274 | 3300005334 | Bacteria | 3167 |
| 19 | Ga0070666_10040313 | 3300005335 | Bacteria | 3116 |
| 20 | Ga0070680_100002142 | 3300005336 | Bacteria | 14595 |
| 21 | Ga0070680_100012985 | 3300005336 | Bacteria | 6480 |
| 22 | Ga0070680_100120058 | 3300005336 | Bacteria | 2194 |
| 23 | Ga0068868_100007159 | 3300005338 | Bacteria | 7928 |
| 24 | Ga0070660_100176016 | 3300005339 | Bacteria | 1730 |
| 25 | Ga0070661_100138589 | 3300005344 | Bacteria | 1832 |
| 26 | Ga0070661_100184413 | 3300005344 | Bacteria | 1589 |
| 27 | Ga0070692_10003160 | 3300005345 | Bacteria | 6614 |
| 28 | Ga0070669_100028562 | 3300005353 | Bacteria | 4017 |
| 29 | Ga0070669_100156518 | 3300005353 | Bacteria | 1768 |
| 30 | Ga0070669_100243346 | 3300005353 | Bacteria | 1430 |
| 31 | Ga0070675_100065250 | 3300005354 | Bacteria | 3010 |
| 32 | Ga0070671_100000636 | 3300005355 | Bacteria | 25081 |
| 33 | Ga0070674_100056331 | 3300005356 | Bacteria | 2726 |
| 34 | Ga0070659_100000459 | 3300005366 | Bacteria | 30099 |
| 35 | Ga0070703_10010129 | 3300005406 | Bacteria | 2659 |
| 36 | Ga0070709_10004736 | 3300005434 | Bacteria | 7347 |
| 37 | Ga0070709_10169299 | 3300005434 | Bacteria | 1525 |
| 38 | Ga0070709_10208824 | 3300005434 | Bacteria | 1387 |
| 39 | Ga0070714_100000518 | 3300005435 | Bacteria | 27963 |
| 40 | Ga0070714_100002057 | 3300005435 | Bacteria | 14737 |
| 41 | Ga0070714_100006827 | 3300005435 | Bacteria | 8847 |
| 42 | Ga0070713_100008151 | 3300005436 | Bacteria | 7418 |
| 43 | Ga0070713_100097811 | 3300005436 | Bacteria | 2537 |
| 44 | Ga0070713_100145571 | 3300005436 | Bacteria | 2103 |
| 45 | Ga0070711_100153055 | 3300005439 | Bacteria | 1741 |
| 46 | Ga0070694_100004994 | 3300005444 | Bacteria | 7999 |
| 47 | Ga0070694_100163079 | 3300005444 | Bacteria | 1637 |
| 48 | Ga0070708_100010165 | 3300005445 | Bacteria | 7617 |
| 49 | Ga0070708_100012271 | 3300005445 | Bacteria | 6985 |
| 50 | Ga0070663_100001910 | 3300005455 | Bacteria | 11634 |
| 51 | Ga0070678_100017468 | 3300005456 | Bacteria | 4621 |
| 52 | Ga0070678_100101563 | 3300005456 | Bacteria | 2230 |
| 53 | Ga0070681_10000546 | 3300005458 | Bacteria | 31019 |
| 54 | Ga0070681_10002810 | 3300005458 | Bacteria | 16070 |
| 55 | Ga0070681_10045579 | 3300005458 | Bacteria | 4387 |
| 56 | Ga0070681_10056462 | 3300005458 | Bacteria | 3907 |
| 57 | Ga0070681_10102309 | 3300005458 | Bacteria | 2810 |
| 58 | Ga0070681_10147147 | 3300005458 | Bacteria | 2284 |
| 59 | Ga0070706_100000403 | 3300005467 | Bacteria | 52164 |
| 60 | Ga0070706_100000475 | 3300005467 | Bacteria | 47520 |
| 61 | Ga0070706_100019605 | 3300005467 | Bacteria | 6239 |
| 62 | Ga0070707_100003950 | 3300005468 | Bacteria | 13959 |
| 63 | Ga0070707_100006419 | 3300005468 | Bacteria | 10932 |
| 64 | Ga0070707_100042080 | 3300005468 | Bacteria | 4373 |
| 65 | Ga0070707_100213726 | 3300005468 | Bacteria | 1879 |
| 66 | Ga0070698_100003778 | 3300005471 | Bacteria | 16634 |
| 67 | Ga0070698_100006375 | 3300005471 | Bacteria | 12809 |
| 68 | Ga0070698_100009744 | 3300005471 | Bacteria | 10268 |
| 69 | Ga0070698_100061184 | 3300005471 | Bacteria | 3799 |
| 70 | Ga0070699_100031616 | 3300005518 | Bacteria | 4570 |
| 71 | Ga0070699_100041319 | 3300005518 | Bacteria | 3992 |
| 72 | Ga0070699_100132426 | 3300005518 | Bacteria | 2198 |
| 73 | Ga0070679_100000514 | 3300005530 | Bacteria | 32919 |
| 74 | Ga0070679_100000557 | 3300005530 | Bacteria | 31630 |
| 75 | Ga0070679_100131498 | 3300005530 | Bacteria | 2484 |
| 76 | Ga0070684_100000424 | 3300005535 | Bacteria | 29037 |
| 77 | Ga0070684_100002528 | 3300005535 | Bacteria | 13494 |
| 78 | Ga0070697_100006899 | 3300005536 | Bacteria | 8826 |
| 79 | Ga0070697_100010685 | 3300005536 | Bacteria | 7165 |
| 80 | Ga0070697_100045968 | 3300005536 | Bacteria | 3539 |
| 81 | Ga0068853_100000204 | 3300005539 | Bacteria | 41777 |
| 82 | Ga0068853_100003979 | 3300005539 | Bacteria | 11358 |
| 83 | Ga0068853_100004688 | 3300005539 | Bacteria | 10604 |
| 84 | Ga0070695_100037493 | 3300005545 | Bacteria | 3056 |
| 85 | Ga0070695_100251515 | 3300005545 | Bacteria | 1286 |
| 86 | Ga0070665_100345479 | 3300005548 | Bacteria | 1493 |
| 87 | Ga0068855_100024898 | 3300005563 | Bacteria | 7161 |
| 88 | Ga0068855_100047335 | 3300005563 | Bacteria | 5080 |
| 89 | Ga0068857_100001981 | 3300005577 | Bacteria | 16573 |
| 90 | Ga0068857_100112753 | 3300005577 | Bacteria | 2445 |
| 91 | Ga0068857_100161268 | 3300005577 | Bacteria | 2035 |
| 92 | Ga0068854_100000081 | 3300005578 | Bacteria | 68807 |
| 93 | Ga0068856_100107772 | 3300005614 | Bacteria | 2782 |
| 94 | Ga0068852_100023381 | 3300005616 | Bacteria | 4974 |
| 95 | Ga0068852_100051861 | 3300005616 | Bacteria | 3524 |
| 96 | Ga0068859_100073611 | 3300005617 | Bacteria | 3455 |
| 97 | Ga0068859_100146451 | 3300005617 | Bacteria | 2437 |
| 98 | Ga0068859_100564957 | 3300005617 | Bacteria | 1232 |
| 99 | Ga0068861_100059001 | 3300005719 | Bacteria | 2936 |
| 100 | Ga0068851_10003914 | 3300005834 | Bacteria | 6667 |
| 101 | Ga0068858_100005594 | 3300005842 | Bacteria | 12291 |
| 102 | Ga0068862_100013791 | 3300005844 | Bacteria | 6698 |
| 103 | Ga0081455_10169376 | 3300005937 | Bacteria | 1665 |
| 104 | Ga0081539_10000605 | 3300005985 | Bacteria | 72953 |
| 105 | Ga0081539_10014701 | 3300005985 | Bacteria | 5757 |
| 106 | Ga0070717_10000194 | 3300006028 | Bacteria | 43030 |
| 107 | Ga0070717_10010237 | 3300006028 | Bacteria | 7066 |
| 108 | Ga0070717_10082230 | 3300006028 | Bacteria | 2706 |
| 109 | Ga0070715_10007474 | 3300006163 | Bacteria | 3764 |
| 110 | Ga0070715_10049125 | 3300006163 | Bacteria | 1807 |
| 111 | Ga0075366_10123088 | 3300006195 | Unclassified | 1564 |
| 112 | Ga0068871_100034486 | 3300006358 | Bacteria | 4016 |
| 113 | Ga0068871_100195163 | 3300006358 | Bacteria | 1745 |
| 114 | Ga0075428_100004203 | 3300006844 | Bacteria | 15860 |
| 115 | Ga0075428_100013256 | 3300006844 | Bacteria | 9171 |
| 116 | Ga0075428_100032244 | 3300006844 | Bacteria | 5787 |
| 117 | Ga0075430_100014515 | 3300006846 | Bacteria | 6710 |
| 118 | Ga0075431_100005811 | 3300006847 | Bacteria | 12208 |
| 119 | Ga0075431_100027132 | 3300006847 | Bacteria | 5874 |
| 120 | Ga0075431_100095378 | 3300006847 | Bacteria | 3071 |
| 121 | Ga0075433_10072176 | 3300006852 | Bacteria | 3035 |
| 122 | Ga0075433_10081503 | 3300006852 | Bacteria | 2853 |
| 123 | Ga0075434_100092930 | 3300006871 | Bacteria | 3019 |
| 124 | Ga0075429_100002325 | 3300006880 | Bacteria | 15963 |
| 125 | Ga0097620_100073606 | 3300006931 | Bacteria | 3455 |
| 126 | Ga0097620_100146445 | 3300006931 | Bacteria | 2437 |
| 127 | Ga0097620_100564976 | 3300006931 | Bacteria | 1232 |
| 128 | Ga0075435_100065793 | 3300007076 | Bacteria | 2947 |
| 129 | Ga0105240_10006804 | 3300009093 | Bacteria | 16718 |
| 130 | Ga0105240_10008376 | 3300009093 | Bacteria | 14797 |
| 131 | Ga0105240_10012369 | 3300009093 | Bacteria | 11785 |
| 132 | Ga0111539_10060682 | 3300009094 | Bacteria | 4481 |
| 133 | Ga0111539_10290463 | 3300009094 | Bacteria | 1903 |
| 134 | Ga0114129_10037159 | 3300009147 | Bacteria | 6876 |
| 135 | Ga0114129_10043369 | 3300009147 | Bacteria | 6328 |
| 136 | Ga0114129_10308145 | 3300009147 | Bacteria | 2109 |
| 137 | Ga0105241_10002200 | 3300009174 | Bacteria | 14670 |
| 138 | Ga0105248_10003617 | 3300009177 | Bacteria | 17149 |
| 139 | Ga0105248_10310836 | 3300009177 | Bacteria | 1775 |
| 140 | Ga0105237_10004257 | 3300009545 | Bacteria | 16655 |
| 141 | Ga0105237_10004306 | 3300009545 | Bacteria | 16505 |
| 142 | Ga0105237_10036271 | 3300009545 | Bacteria | 4988 |
| 143 | Ga0105238_10003016 | 3300009551 | Bacteria | 16812 |
| 144 | Ga0105238_10070087 | 3300009551 | Bacteria | 3506 |
| 145 | Ga0105239_10001126 | 3300010375 | Bacteria | 36867 |
| 146 | Ga0105246_10221151 | 3300011119 | Bacteria | 1484 |
| 147 | Ga0157370_10008156 | 3300013104 | Bacteria | 11327 |
| 148 | Ga0157370_10018606 | 3300013104 | Bacteria | 6984 |
| 149 | Ga0157369_10002662 | 3300013105 | Bacteria | 21319 |
| 150 | Ga0157369_10049641 | 3300013105 | Bacteria | 4548 |
| 151 | Ga0157369_10088717 | 3300013105 | Bacteria | 3302 |
| 152 | Ga0157374_10257303 | 3300013296 | Bacteria | 1719 |
| 153 | Ga0157372_10000871 | 3300013307 | Bacteria | 32767 |
| 154 | Ga0157372_10020715 | 3300013307 | Bacteria | 7097 |
| 155 | Ga0157372_10063957 | 3300013307 | Bacteria | 4127 |
| 156 | Ga0157372_10166847 | 3300013307 | Bacteria | 2546 |
| 157 | Ga0157380_10000337 | 3300014326 | Bacteria | 27979 |
| 158 | Ga0157376_10258515 | 3300014969 | Bacteria | 1630 |
| 159 | Ga0163161_10104621 | 3300017792 | Bacteria | 2110 |
| 160 | Ga0163161_10107883 | 3300017792 | Bacteria | 2079 |
| 161 | Ga0197907_10291974 | 3300020069 | Bacteria | 3416 |
| 162 | Ga0197907_10511865 | 3300020069 | Bacteria | 1725 |
| 163 | Ga0206356_10262640 | 3300020070 | Bacteria | 2063 |
| 164 | Ga0206352_10240072 | 3300020078 | Bacteria | 3873 |
| 165 | Ga0206352_11239808 | 3300020078 | Bacteria | 1453 |
| 166 | Ga0206350_10169733 | 3300020080 | Bacteria | 3125 |
| 167 | Ga0206354_10022903 | 3300020081 | Bacteria | 1596 |
| 168 | Ga0206353_11681877 | 3300020082 | Bacteria | 2940 |
| 169 | Ga0213876_10000119 | 3300021384 | Bacteria | 85523 |
| 170 | Ga0213875_10057493 | 3300021388 | Bacteria | 1822 |
| 171 | Ga0224712_10000486 | 3300022467 | Bacteria | 7964 |
| 172 | Ga0224712_10025647 | 3300022467 | Bacteria | 2074 |
| 173 | Ga0224712_10039947 | 3300022467 | Bacteria | 1762 |
| 174 | Ga0224712_10059171 | 3300022467 | Bacteria | 1520 |
| 175 | Ga0207699_10009049 | 3300025906 | Bacteria | 4942 |
| 176 | Ga0207699_10015355 | 3300025906 | Bacteria | 3975 |
| 177 | Ga0207643_10012368 | 3300025908 | Bacteria | 4613 |
| 178 | Ga0207705_10008937 | 3300025909 | Bacteria | 7296 |
| 179 | Ga0207684_10000031 | 3300025910 | Bacteria | 296401 |
| 180 | Ga0207684_10000281 | 3300025910 | Bacteria | 74030 |
| 181 | Ga0207684_10003088 | 3300025910 | Bacteria | 16449 |
| 182 | Ga0207684_10436516 | 3300025910 | Bacteria | 1125 |
| 183 | Ga0207654_10007780 | 3300025911 | Bacteria | 5409 |
| 184 | Ga0207707_10000774 | 3300025912 | Bacteria | 31479 |
| 185 | Ga0207707_10003775 | 3300025912 | Bacteria | 13426 |
| 186 | Ga0207695_10001737 | 3300025913 | Bacteria | 34673 |
| 187 | Ga0207695_10148659 | 3300025913 | Bacteria | 2284 |
| 188 | Ga0207695_10255433 | 3300025913 | Bacteria | 1651 |
| 189 | Ga0207671_10009523 | 3300025914 | Bacteria | 8112 |
| 190 | Ga0207693_10103392 | 3300025915 | Bacteria | 2234 |
| 191 | Ga0207663_10043154 | 3300025916 | Bacteria | 2759 |
| 192 | Ga0207660_10001846 | 3300025917 | Bacteria | 14129 |
| 193 | Ga0207660_10134637 | 3300025917 | Bacteria | 1884 |
| 194 | Ga0207657_10005473 | 3300025919 | Bacteria | 13256 |
| 195 | Ga0207657_10077123 | 3300025919 | Bacteria | 2810 |
| 196 | Ga0207649_10109125 | 3300025920 | Bacteria | 1846 |
| 197 | Ga0207652_10000566 | 3300025921 | Bacteria | 37275 |
| 198 | Ga0207652_10220754 | 3300025921 | Bacteria | 1708 |
| 199 | Ga0207646_10000043 | 3300025922 | Bacteria | 184713 |
| 200 | Ga0207646_10000096 | 3300025922 | Bacteria | 117197 |
| 201 | Ga0207646_10000145 | 3300025922 | Bacteria | 96479 |
| 202 | Ga0207646_10000954 | 3300025922 | Bacteria | 37245 |
| 203 | Ga0207646_10005468 | 3300025922 | Bacteria | 13354 |
| 204 | Ga0207646_10007955 | 3300025922 | Bacteria | 10697 |
| 205 | Ga0207646_10169065 | 3300025922 | Bacteria | 1974 |
| 206 | Ga0207681_10240955 | 3300025923 | Bacteria | 1408 |
| 207 | Ga0207694_10002225 | 3300025924 | Bacteria | 15919 |
| 208 | Ga0207659_10048848 | 3300025926 | Bacteria | 2999 |
| 209 | Ga0207659_10166158 | 3300025926 | Bacteria | 1737 |
| 210 | Ga0207700_10003895 | 3300025928 | Bacteria | 8712 |
| 211 | Ga0207700_10009798 | 3300025928 | Bacteria | 6008 |
| 212 | Ga0207700_10023650 | 3300025928 | Bacteria | 4242 |
| 213 | Ga0207700_10025491 | 3300025928 | Bacteria | 4107 |
| 214 | Ga0207700_10089634 | 3300025928 | Bacteria | 2425 |
| 215 | Ga0207664_10002658 | 3300025929 | Bacteria | 11851 |
| 216 | Ga0207664_10002687 | 3300025929 | Bacteria | 11799 |
| 217 | Ga0207664_10003470 | 3300025929 | Bacteria | 10518 |
| 218 | Ga0207664_10123351 | 3300025929 | Bacteria | 2171 |
| 219 | Ga0207644_10003541 | 3300025931 | Bacteria | 10108 |
| 220 | Ga0207644_10194540 | 3300025931 | Bacteria | 1596 |
| 221 | Ga0207690_10000312 | 3300025932 | Bacteria | 32887 |
| 222 | Ga0207669_10080589 | 3300025937 | Bacteria | 2082 |
| 223 | Ga0207704_10092975 | 3300025938 | Bacteria | 1986 |
| 224 | Ga0207665_10125188 | 3300025939 | Bacteria | 1819 |
| 225 | Ga0207691_10001347 | 3300025940 | Bacteria | 24493 |
| 226 | Ga0207711_10320864 | 3300025941 | Bacteria | 1431 |
| 227 | Ga0207689_10056751 | 3300025942 | Bacteria | 3222 |
| 228 | Ga0207661_10013348 | 3300025944 | Bacteria | 6000 |
| 229 | Ga0207661_10077520 | 3300025944 | Bacteria | 2733 |
| 230 | Ga0207661_10214746 | 3300025944 | Bacteria | 1697 |
| 231 | Ga0207667_10000797 | 3300025949 | Bacteria | 40904 |
| 232 | Ga0207667_10060293 | 3300025949 | Bacteria | 3971 |
| 233 | Ga0207640_10000019 | 3300025981 | Bacteria | 185255 |
| 234 | Ga0207640_10123544 | 3300025981 | Bacteria | 1859 |
| 235 | Ga0207703_10003930 | 3300026035 | Bacteria | 12330 |
| 236 | Ga0207639_10000120 | 3300026041 | Bacteria | 59978 |
| 237 | Ga0207639_10007749 | 3300026041 | Bacteria | 7336 |
| 238 | Ga0207639_10024662 | 3300026041 | Bacteria | 4356 |
| 239 | Ga0207678_10004212 | 3300026067 | Bacteria | 12909 |
| 240 | Ga0207648_10392760 | 3300026089 | Bacteria | 1256 |
| 241 | Ga0207674_10000995 | 3300026116 | Bacteria | 36986 |
| 242 | Ga0207674_10118480 | 3300026116 | Bacteria | 2617 |
| 243 | Ga0207675_100022020 | 3300026118 | Bacteria | 5932 |
| 244 | Ga0207675_100071116 | 3300026118 | Bacteria | 3252 |
| 245 | Ga0207675_100082853 | 3300026118 | Bacteria | 3008 |
| 246 | Ga0207683_10008581 | 3300026121 | Bacteria | 8747 |
| 247 | Ga0207683_10215252 | 3300026121 | Bacteria | 1750 |
| 248 | Ga0207698_10009002 | 3300026142 | Bacteria | 6339 |
| 249 | Ga0207698_10064505 | 3300026142 | Bacteria | 2871 |
| 250 | Ga0207428_10000144 | 3300027907 | Bacteria | 96684 |
| 251 | Ga0207428_10144972 | 3300027907 | Bacteria | 1810 |
| 252 | Ga0268265_10155054 | 3300028380 | Bacteria | 1937 |
| 253 | Ga0265338_10122182 | 3300028800 | Bacteria | 2073 |
| 254 | Ga0265338_10129377 | 3300028800 | Bacteria | 1997 |
| 255 | Ga0265338_10136743 | 3300028800 | Bacteria | 1925 |
| 256 | Ga0265325_10067336 | 3300031241 | Bacteria | 1804 |
| 257 | Ga0265340_10051722 | 3300031247 | Bacteria | 1988 |
| 258 | Ga0265327_10005424 | 3300031251 | Bacteria | 10635 |
| 259 | Ga0265342_10040407 | 3300031712 | Bacteria | 2829 |
| 260 | Ga0265342_10157057 | 3300031712 | Bacteria | 1259 |
| 261 | Ga0307416_100094864 | 3300032002 | Bacteria | 2574 |
| 262 | Ga0307414_10113899 | 3300032004 | Bacteria | 2065 |
| 263 | Ga0307415_100051906 | 3300032126 | Bacteria | 2786 |
| 264 | Ga0307510_10069741 | 3300033180 | Bacteria | 3518 |
| 265 | Ga0373926_0002829 | 3300035083 | Bacteria | 5550 |
| 266 | Ga0373926_0004836 | 3300035083 | Bacteria | 4428 |
| 267 | Ga0373934_0000873 | 3300035086 | Bacteria | 10874 |
| 268 | Ga0373934_0040810 | 3300035086 | Bacteria | 1831 |
| 269 | Ga0373944_0000495 | 3300035089 | Bacteria | 9161 |
| 270 | Ga0373923_0052193 | 3300035111 | Bacteria | 1717 |
| 271 | Ga0373923_0062679 | 3300035111 | Bacteria | 1582 |
| 272 | Ga0373936_0000130 | 3300035113 | Bacteria | 26133 |
| 273 | Ga0373936_0009723 | 3300035113 | Bacteria | 3627 |
| 274 | Ga0373945_0000149 | 3300035116 | Bacteria | 17816 |
| 275 | Ga0373945_0074926 | 3300035116 | Bacteria | 1287 |
| 276 | Ga0373953_0027173 | 3300035117 | Bacteria | 2197 |
| 277 | Ga0373956_0002520 | 3300035119 | Bacteria | 7452 |
| 278 | Ga0373956_0029434 | 3300035119 | Bacteria | 2395 |
| 279 | Ga0373956_0035423 | 3300035119 | Bacteria | 2201 |
| 280 | Ga0373957_0016094 | 3300035120 | Bacteria | 2584 |
| 281 | Ga0373943_0000215 | 3300035170 | Bacteria | 23592 |
| 282 | Ga0373943_0005403 | 3300035170 | Bacteria | 5749 |
| 283 | Ga0373943_0022310 | 3300035170 | Bacteria | 2932 |
| 284 | Ga0373946_0000093 | 3300035171 | Bacteria | 24751 |
| 285 | Ga0373955_0023064 | 3300035172 | Bacteria | 3166 |
| 286 | Ga0373955_0133535 | 3300035172 | Bacteria | 1450 |
| 287 | Ga0373924_0005835 | 3300035410 | Bacteria | 4383 |
| 288 | Ga0373935_0000437 | 3300035692 | Bacteria | 21735 |
| 289 | Ga0373935_0001066 | 3300035692 | Bacteria | 14950 |
| 290 | Ga0373935_0009441 | 3300035692 | Bacteria | 5836 |
| 291 | Ga0373927_0001407 | 3300035695 | Bacteria | 18138 |
| 292 | Ga0373933_0012242 | 3300035724 | Bacteria | 4738 |
| 293 | Ga0373933_0023812 | 3300035724 | Bacteria | 3501 |
| 294 | Ga0373933_0032261 | 3300035724 | Bacteria | 3043 |
| 295 | Ga0373933_0038769 | 3300035724 | Bacteria | 2801 |
| 296 | Ga0373947_0000281 | 3300035725 | Bacteria | 28827 |
| 297 | Ga0373937_0000631 | 3300036401 | Bacteria | 30842 |
| 298 | Ga0373937_0015324 | 3300036401 | Bacteria | 6779 |
| 299 | Ga0373937_0018872 | 3300036401 | Bacteria | 6164 |
| 300 | Ga0373937_0062469 | 3300036401 | Bacteria | 3424 |
| 301 | Ga0373937_0081661 | 3300036401 | Bacteria | 2991 |
| 302 | Ga0373925_0000938 | 3300037068 | Bacteria | 26552 |
| 303 | Ga0373925_0002793 | 3300037068 | Bacteria | 13796 |
| 304 | Ga0373925_0003908 | 3300037068 | Bacteria | 11384 |
| 305 | Ga0373925_0010852 | 3300037068 | Bacteria | 6607 |
| 306 | Ga0395899_0000734 | 3300037312 | Bacteria | 32689 |
| 307 | Ga0395899_0003022 | 3300037312 | Bacteria | 13432 |
| 308 | Ga0395899_0092459 | 3300037312 | Bacteria | 2191 |
| 309 | Ga0395900_0004531 | 3300037418 | Bacteria | 14705 |
| 310 | Ga0395900_0036668 | 3300037418 | Bacteria | 5055 |
| 311 | Ga0395900_0042794 | 3300037418 | Bacteria | 4666 |
| 312 | Ga0395900_0170740 | 3300037418 | Bacteria | 2214 |
| 313 | Ga0395898_0005154 | 3300037466 | Bacteria | 14140 |
| 314 | Ga0395898_0032668 | 3300037466 | Bacteria | 5195 |
| 315 | Ga0395905_0022257 | 3300037471 | Bacteria | 5998 |
| 316 | Ga0436364_0319228 | 3300037853 | Bacteria | 2916 |
| 317 | Ga0436364_0653358 | 3300037853 | Bacteria | 4814 |
| 318 | Ga0436364_1022225 | 3300037853 | Bacteria | 5377 |
| 319 | Ga0436364_1214168 | 3300037853 | Bacteria | 4658 |
| 320 | Ga0395901_0000376 | 3300038443 | Bacteria | 53640 |
| 321 | Ga0395901_0005500 | 3300038443 | Bacteria | 12835 |
| 322 | Ga0436365_0592662 | 3300039437 | Bacteria | 3849 |
| 323 | Ga0436365_0682928 | 3300039437 | Bacteria | 6236 |
| 324 | Ga0436365_1483147 | 3300039437 | Bacteria | 1746 |
| 325 | Ga0436361_0464657 | 3300039447 | Bacteria | 5608 |
| 326 | Ga0436361_1032002 | 3300039447 | Bacteria | 1518 |
| 327 | Ga0436361_1111202 | 3300039447 | Bacteria | 1710 |
| 328 | Ga0436363_0157307 | 3300039450 | Bacteria | 3552 |
| 329 | Ga0436363_0209627 | 3300039450 | Unclassified | 2119 |
| 330 | Ga0436362_0104738 | 3300039453 | Bacteria | 2138 |
| 331 | Ga0453683_0002195 | 3300044673 | Bacteria | 15518 |
| 332 | Ga0466966_0003787 | 3300044684 | Bacteria | 9978 |
| 333 | Ga0466963_0271619 | 3300044694 | Bacteria | 1191 |
| 334 | Ga0453684_0001473 | 3300044712 | Bacteria | 66422 |
| 335 | Ga0453684_0284408 | 3300044712 | Bacteria | 1885 |
| 336 | Ga0466970_0030341 | 3300044765 | Bacteria | 2851 |
| 337 | Ga0466959_0109125 | 3300045049 | Bacteria | 1976 |
| 338 | Ga0451576_0012980 | 3300045051 | Bacteria | 9336 |
| 339 | Ga0451576_0125243 | 3300045051 | Bacteria | 2677 |
| 340 | Ga0466958_0213996 | 3300045836 | Bacteria | 1229 |
| 341 | Ga0466967_0224492 | 3300045976 | Bacteria | 1786 |
| 342 | Ga0466967_0522613 | 3300045976 | Bacteria | 1166 |
| 343 | Ga0495603_0000150 | 3300046455 | Bacteria | 34573 |
| 344 | Ga0495629_0200629 | 3300046459 | Bacteria | 1379 |
| 345 | Ga0495641_0034092 | 3300046461 | Bacteria | 2409 |
| 346 | Ga0495641_0045600 | 3300046461 | Bacteria | 2018 |
| 347 | Ga0495651_0005897 | 3300046462 | Bacteria | 9345 |
| 348 | Ga0495651_0010002 | 3300046462 | Bacteria | 7291 |
| 349 | Ga0495651_0157367 | 3300046462 | Bacteria | 1631 |
| 350 | Ga0495651_0160903 | 3300046462 | Bacteria | 1608 |
| 351 | Ga0495653_0000632 | 3300046463 | Bacteria | 26856 |
| 352 | Ga0495653_0018969 | 3300046463 | Bacteria | 5582 |
| 353 | Ga0495653_0114125 | 3300046463 | Bacteria | 1936 |
| 354 | Ga0495580_0052503 | 3300046472 | Bacteria | 2879 |
| 355 | Ga0495580_0155157 | 3300046472 | Bacteria | 1585 |
| 356 | Ga0495582_0016388 | 3300046473 | Bacteria | 4060 |
| 357 | Ga0495639_0002384 | 3300046475 | Bacteria | 8213 |
| 358 | Ga0495639_0016341 | 3300046475 | Bacteria | 3222 |
| 359 | Ga0495664_0000201 | 3300046477 | Bacteria | 28936 |
| 360 | Ga0495664_0024014 | 3300046477 | Bacteria | 3541 |
| 361 | Ga0495664_0025253 | 3300046477 | Bacteria | 3458 |
| 362 | Ga0495585_0009697 | 3300046492 | Bacteria | 5765 |
| 363 | Ga0495594_0000071 | 3300046499 | Bacteria | 43649 |
| 364 | Ga0495594_0001326 | 3300046499 | Bacteria | 12874 |
| 365 | Ga0495594_0008374 | 3300046499 | Bacteria | 5327 |
| 366 | Ga0495596_0007619 | 3300046500 | Bacteria | 4874 |
| 367 | Ga0495583_0048092 | 3300046506 | Bacteria | 1959 |
| 368 | Ga0495583_0063970 | 3300046506 | Bacteria | 1633 |
| 369 | Ga0495608_0021357 | 3300046511 | Bacteria | 4443 |
| 370 | Ga0495608_0090523 | 3300046511 | Bacteria | 1979 |
| 371 | Ga0495618_0015458 | 3300046514 | Bacteria | 4660 |
| 372 | Ga0495628_0024439 | 3300046516 | Bacteria | 4946 |
| 373 | Ga0495630_0011532 | 3300046517 | Bacteria | 6400 |
| 374 | Ga0495630_0012714 | 3300046517 | Bacteria | 6117 |
| 375 | Ga0495630_0024804 | 3300046517 | Bacteria | 4433 |
| 376 | Ga0495630_0119925 | 3300046517 | Bacteria | 1995 |
| 377 | Ga0495631_0084778 | 3300046518 | Bacteria | 1365 |
| 378 | Ga0495644_0000059 | 3300046523 | Bacteria | 53320 |
| 379 | Ga0495666_0007409 | 3300046526 | Bacteria | 5501 |
| 380 | Ga0495652_0150611 | 3300046529 | Bacteria | 1818 |
| 381 | Ga0495665_0000700 | 3300046531 | Bacteria | 17258 |
| 382 | Ga0495665_0002287 | 3300046531 | Bacteria | 10350 |
| 383 | Ga0495640_0009380 | 3300046533 | Bacteria | 7620 |
| 384 | Ga0495640_0014685 | 3300046533 | Bacteria | 5915 |
| 385 | Ga0495587_0000289 | 3300046536 | Bacteria | 35652 |
| 386 | Ga0495587_0065305 | 3300046536 | Bacteria | 2125 |
| 387 | Ga0495587_0138060 | 3300046536 | Bacteria | 1392 |
| 388 | Ga0495609_0036538 | 3300046538 | Bacteria | 2217 |
| 389 | Ga0495645_0098903 | 3300046543 | Bacteria | 2076 |
| 390 | Ga0495622_0061852 | 3300046557 | Bacteria | 1733 |
| 391 | Ga0495667_0003309 | 3300046559 | Bacteria | 10795 |
| 392 | Ga0495667_0011555 | 3300046559 | Bacteria | 5977 |
| 393 | Ga0495667_0088085 | 3300046559 | Bacteria | 2012 |
| 394 | Ga0495611_0011935 | 3300046648 | Bacteria | 3690 |
| 395 | Ga0495625_0006612 | 3300046660 | Bacteria | 10291 |
| 396 | Ga0495625_0023217 | 3300046660 | Bacteria | 4740 |
| 397 | Ga0495635_0000377 | 3300046663 | Bacteria | 28228 |
| 398 | Ga0495635_0006693 | 3300046663 | Bacteria | 8052 |
| 399 | Ga0495635_0011741 | 3300046663 | Bacteria | 6142 |
| 400 | Ga0495635_0191159 | 3300046663 | Bacteria | 1390 |
| 401 | Ga0495588_0001897 | 3300046674 | Bacteria | 8923 |
| 402 | Ga0495657_0102053 | 3300046675 | Bacteria | 1826 |
| 403 | Ga0495599_0011886 | 3300046678 | Bacteria | 5356 |
| 404 | Ga0495599_0062564 | 3300046678 | Bacteria | 2325 |
| 405 | Ga0495623_0052130 | 3300046679 | Bacteria | 2586 |
| 406 | Ga0495623_0062298 | 3300046679 | Bacteria | 2338 |
| 407 | Ga0495623_0111532 | 3300046679 | Bacteria | 1657 |
| 408 | Ga0495646_0014543 | 3300046680 | Bacteria | 5001 |
| 409 | Ga0495646_0098447 | 3300046680 | Bacteria | 1680 |
| 410 | Ga0495658_0001571 | 3300046683 | Bacteria | 11915 |
| 411 | Ga0495658_0047774 | 3300046683 | Bacteria | 2411 |
| 412 | Ga0495669_0012957 | 3300046684 | Bacteria | 3551 |
| 413 | Ga0495613_0002408 | 3300046689 | Bacteria | 14147 |
| 414 | Ga0495613_0003274 | 3300046689 | Bacteria | 12112 |
| 415 | Ga0495613_0029923 | 3300046689 | Bacteria | 4046 |
| 416 | Ga0495613_0040700 | 3300046689 | Bacteria | 3442 |
| 417 | Ga0495613_0175172 | 3300046689 | Bacteria | 1521 |
| 418 | Ga0495624_0086628 | 3300046690 | Bacteria | 1934 |
| 419 | Ga0495589_0077885 | 3300046794 | Bacteria | 1615 |
| 420 | Ga0495600_0002144 | 3300046809 | Bacteria | 11183 |
| 421 | Ga0495600_0074171 | 3300046809 | Bacteria | 2221 |
| 422 | Ga0495581_0009887 | 3300047315 | Bacteria | 5518 |
| 423 | Ga0495604_0009078 | 3300047317 | Bacteria | 7866 |
| 424 | Ga0495604_0020529 | 3300047317 | Bacteria | 5276 |
| 425 | Ga0495674_0001255 | 3300047319 | Bacteria | 24635 |
| 426 | Ga0495674_0012606 | 3300047319 | Bacteria | 7965 |
| 427 | Ga0495674_0062901 | 3300047319 | Bacteria | 3230 |
| 428 | Ga0495674_0094297 | 3300047319 | Bacteria | 2553 |
| 429 | Ga0495676_0001118 | 3300047321 | Bacteria | 22768 |
| 430 | Ga0495676_0008030 | 3300047321 | Bacteria | 9675 |
| 431 | Ga0495680_0006058 | 3300047322 | Bacteria | 11305 |
| 432 | Ga0495680_0033646 | 3300047322 | Bacteria | 4147 |
| 433 | Ga0495680_0039529 | 3300047322 | Bacteria | 3762 |
| 434 | Ga0495680_0046181 | 3300047322 | Bacteria | 3435 |
| 435 | Ga0495680_0067967 | 3300047322 | Bacteria | 2723 |
| 436 | Ga0495683_0085285 | 3300047323 | Bacteria | 1536 |
| 437 | Ga0495675_0072513 | 3300047444 | Bacteria | 2172 |
| 438 | Ga0495675_0073571 | 3300047444 | Bacteria | 2155 |
| 439 | Ga0495677_0046642 | 3300047445 | Bacteria | 1590 |
| 440 | Ga0495684_0008447 | 3300047471 | Bacteria | 7975 |
| 441 | Ga0495684_0027510 | 3300047471 | Bacteria | 4366 |
| 442 | Ga0495684_0110168 | 3300047471 | Bacteria | 2078 |
| 443 | Ga0495684_0126427 | 3300047471 | Bacteria | 1923 |
| 444 | Ga0495684_0132989 | 3300047471 | Bacteria | 1867 |
| 445 | Ga0495686_0000035 | 3300047472 | Bacteria | 314930 |
| 446 | Ga0495602_0008192 | 3300048088 | Bacteria | 10919 |
| 447 | Ga0495602_0032220 | 3300048088 | Bacteria | 4939 |
| 448 | Ga0495602_0111235 | 3300048088 | Bacteria | 2224 |
| 449 | Ga0495602_0185991 | 3300048088 | Bacteria | 1597 |
| 450 | Ga0495614_0000914 | 3300048089 | Bacteria | 12582 |
| 451 | Ga0496104_0000137 | 3300048907 | Bacteria | 67856 |
| 452 | Ga0496104_0016151 | 3300048907 | Bacteria | 6775 |
| 453 | Ga0496104_0023708 | 3300048907 | Bacteria | 5643 |
| 454 | Ga0496105_0001487 | 3300048908 | Bacteria | 16545 |
| 455 | Ga0496108_0036508 | 3300048911 | Bacteria | 4089 |
| 456 | Ga0496109_0003051 | 3300048912 | Bacteria | 13958 |
| 457 | Ga0496109_0019349 | 3300048912 | Bacteria | 6002 |
| 458 | Ga0496110_0036628 | 3300048913 | Bacteria | 4261 |
| 459 | Ga0496110_0037020 | 3300048913 | Bacteria | 4239 |
| 460 | Ga0496110_0124198 | 3300048913 | Bacteria | 2328 |
| 461 | Ga0496110_0450383 | 3300048913 | Bacteria | 1173 |
| 462 | Ga0496111_0239216 | 3300048914 | Bacteria | 1348 |
| 463 | Ga0496112_0007149 | 3300048915 | Bacteria | 9882 |
| 464 | Ga0496112_0009522 | 3300048915 | Bacteria | 8761 |
| 465 | Ga0496112_0206794 | 3300048915 | Bacteria | 1921 |
| 466 | Ga0496113_0011681 | 3300048916 | Bacteria | 5874 |
| 467 | Ga0496113_0075926 | 3300048916 | Bacteria | 2566 |
| 468 | Ga0496114_0058637 | 3300048917 | Bacteria | 3215 |
| 469 | Ga0496114_0195605 | 3300048917 | Bacteria | 1770 |
| 470 | Ga0496115_0067633 | 3300048918 | Bacteria | 2890 |
| 471 | Ga0496115_0259464 | 3300048918 | Bacteria | 1429 |
| 472 | Ga0496126_0000020 | 3300048929 | Bacteria | 490805 |
| 473 | Ga0501031_0008717 | 3300049568 | Bacteria | 6595 |
| 474 | Ga0501032_0000463 | 3300049569 | Bacteria | 32728 |
| 475 | Ga0501033_0019994 | 3300049570 | Bacteria | 5060 |
| 476 | Ga0501034_0005208 | 3300049571 | Bacteria | 14269 |
| 477 | Ga0501034_0006548 | 3300049571 | Bacteria | 12510 |
| 478 | Ga0501034_0008653 | 3300049571 | Bacteria | 10736 |
| 479 | Ga0501036_0003645 | 3300049572 | Bacteria | 12314 |
| 480 | Ga0501036_0004808 | 3300049572 | Bacteria | 10918 |
| 481 | Ga0501037_0000073 | 3300049573 | Bacteria | 93756 |
| 482 | Ga0501037_0016891 | 3300049573 | Bacteria | 5370 |
| 483 | Ga0501037_0060753 | 3300049573 | Bacteria | 2757 |
| 484 | Ga0501038_0008187 | 3300049574 | Bacteria | 9616 |
| 485 | Ga0501039_0044212 | 3300049575 | Bacteria | 3440 |
| 486 | Ga0501042_0012676 | 3300049578 | Bacteria | 5720 |
| 487 | Ga0501042_0078418 | 3300049578 | Bacteria | 2366 |
| 488 | Ga0501042_0139472 | 3300049578 | Bacteria | 1748 |
| 489 | Ga0501043_0002327 | 3300049579 | Bacteria | 16093 |
| 490 | Ga0501043_0072027 | 3300049579 | Bacteria | 2714 |
| 491 | Ga0501046_0000091 | 3300049580 | Bacteria | 98095 |
| 492 | Ga0501047_0000929 | 3300049581 | Bacteria | 29943 |
| 493 | Ga0501047_0001874 | 3300049581 | Bacteria | 20248 |
| 494 | Ga0501047_0002031 | 3300049581 | Bacteria | 19353 |
| 495 | Ga0501048_0008299 | 3300049582 | Bacteria | 7857 |
| 496 | Ga0501067_0019729 | 3300049583 | Bacteria | 3731 |
| 497 | Ga0501068_0046929 | 3300049584 | Bacteria | 2605 |
| 498 | Ga0501069_0029958 | 3300049585 | Bacteria | 2987 |
| 499 | Ga0501070_0079441 | 3300049586 | Bacteria | 2715 |
| 500 | Ga0501073_0007003 | 3300049589 | Bacteria | 8401 |
| 501 | Ga0501073_0077052 | 3300049589 | Bacteria | 2320 |
| 502 | Ga0501074_0006347 | 3300049590 | Bacteria | 8539 |
| 503 | Ga0501076_0272211 | 3300049592 | Bacteria | 1387 |
| 504 | Ga0501083_0003972 | 3300049744 | Bacteria | 10385 |
| 505 | Ga0501035_0001860 | 3300049822 | Bacteria | 21260 |
| 506 | Ga0501035_0006266 | 3300049822 | Bacteria | 11186 |
| 507 | Ga0501044_0000769 | 3300049823 | Bacteria | 38869 |
| 508 | Ga0501044_0000946 | 3300049823 | Bacteria | 34826 |
| 509 | Ga0501044_0066566 | 3300049823 | Bacteria | 3672 |
| 510 | nmdc:mga05p37_20365_c1 | 3300050507 | Bacteria | 8026 |
| 511 | nmdc:mga05p37_26722_c1 | 3300050507 | Bacteria | 7019 |
| 512 | nmdc:mga09592_104155_c1 | 3300050508 | Bacteria | 2431 |
| 513 | nmdc:mga09592_15431_c1 | 3300050508 | Bacteria | 6241 |
| 514 | nmdc:mga09592_18860_c1 | 3300050508 | Bacteria | 5659 |
| 515 | nmdc:mga0qj67_37712_c1 | 3300050509 | Bacteria | 3789 |
| 516 | nmdc:mga06r32_10909_c1 | 3300050510 | Bacteria | 8182 |
| 517 | nmdc:mga06r32_6184_c1 | 3300050510 | Bacteria | 10747 |
| 518 | nmdc:mga08y16_128717_c1 | 3300050511 | Bacteria | 1575 |
| 519 | nmdc:mga08y16_421677_c1 | 3300050511 | Bacteria | 1364 |
| 520 | nmdc:mga08y16_89775_c1 | 3300050511 | Bacteria | 3202 |
| 521 | nmdc:mga0n895_179969_c1 | 3300050512 | Bacteria | 2146 |
| 522 | nmdc:mga0n895_327323_c1 | 3300050512 | Bacteria | 1553 |
| 523 | nmdc:mga0n895_86181_c1 | 3300050512 | Bacteria | 3137 |
| 524 | nmdc:mga08x19_96718_c1 | 3300050514 | Bacteria | 1955 |
| 525 | nmdc:mga0a205_16929_c1 | 3300050515 | Bacteria | 6826 |
| 526 | nmdc:mga0a205_222245_c1 | 3300050515 | Bacteria | 1774 |
| 527 | nmdc:mga0a205_6577_c1 | 3300050515 | Bacteria | 10516 |
| 528 | Ga0495601_0000713 | 3300053077 | Bacteria | 17851 |
| 529 | Ga0495619_0093101 | 3300053085 | Bacteria | 2043 |
| 530 | Ga0500595_033209 | 3300053119 | Bacteria | 1714 |
| 531 | Ga0500559_0003914 | 3300053136 | Bacteria | 7190 |
| 532 | Ga0590071_001719 | 3300059421 | Bacteria | 5670 |
| 533 | Ga0501082_0000448 | 3300060353 | Bacteria | 36479 |
| 534 | Ga0530510_0044435 | 3300061734 | Bacteria | 3210 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005290 | Ga0065712_10009242 | Ga0065712_100092422 | 310 |
| 2 | 3300036401 | Ga0373937_0000631 | Ga0373937_0000631_19_1014 | 311 |
| 3 | 3300046516 | Ga0495628_0024439 | Ga0495628_0024439_19_1014 | 311 |
| 4 | 3300046517 | Ga0495630_0011532 | Ga0495630_0011532_3996_4991 | 311 |
| 5 | 3300049586 | Ga0501070_0079441 | Ga0501070_0079441_65_1060 | 311 |
| 6 | 3300025910 | Ga0207684_10436516 | Ga0207684_104365161 | 318 |
| 7 | 3300044673 | Ga0453683_0002195 | Ga0453683_0002195_8848_9915 | 321 |
| 8 | 3300005937 | Ga0081455_10169376 | Ga0081455_101693762 | 322 |
| 9 | 3300045051 | Ga0451576_0125243 | Ga0451576_0125243_23_1087 | 322 |
| 10 | 3300039447 | Ga0436361_0464657 | Ga0436361_0464657_4401_5435 | 324 |
| 11 | 3300037853 | Ga0436364_0653358 | Ga0436364_0653358_3612_4679 | 335 |
| 12 | 3300039450 | Ga0436363_0209627 | Ga0436363_0209627_460_1530 | 336 |
| 13 | 3300053136 | Ga0500559_0003914 | Ga0500559_0003914_2223_3338 | 336 |
| 14 | 3300005435 | Ga0070714_100000518 | Ga0070714_10000051819 | 339 |
| 15 | 3300025929 | Ga0207664_10002687 | Ga0207664_1000268715 | 339 |
| 16 | 3300037418 | Ga0395900_0042794 | Ga0395900_0042794_416_1531 | 340 |
| 17 | 3300039453 | Ga0436362_0104738 | Ga0436362_0104738_752_1867 | 340 |
| 18 | 3300014969 | Ga0157376_10258515 | Ga0157376_102585151 | 341 |
| 19 | 3300036401 | Ga0373937_0062469 | Ga0373937_0062469_769_1860 | 342 |
| 20 | 3300032126 | Ga0307415_100051906 | Ga0307415_1000519062 | 343 |
| 21 | 3300035086 | Ga0373934_0040810 | Ga0373934_0040810_564_1658 | 343 |
| 22 | 3300035113 | Ga0373936_0009723 | Ga0373936_0009723_433_1527 | 343 |
| 23 | 3300035117 | Ga0373953_0027173 | Ga0373953_0027173_147_1241 | 343 |
| 24 | 3300035120 | Ga0373957_0016094 | Ga0373957_0016094_1259_2353 | 343 |
| 25 | 3300035172 | Ga0373955_0023064 | Ga0373955_0023064_1876_2970 | 343 |
| 26 | 3300035172 | Ga0373955_0133535 | Ga0373955_0133535_196_1290 | 343 |
| 27 | 3300046463 | Ga0495653_0018969 | Ga0495653_0018969_4436_5530 | 343 |
| 28 | 3300046559 | Ga0495667_0088085 | Ga0495667_0088085_560_1654 | 343 |
| 29 | 3300046675 | Ga0495657_0102053 | Ga0495657_0102053_265_1359 | 343 |
| 30 | 3300046678 | Ga0495599_0011886 | Ga0495599_0011886_2699_3793 | 343 |
| 31 | 3300046809 | Ga0495600_0074171 | Ga0495600_0074171_529_1623 | 343 |
| 32 | 3300047319 | Ga0495674_0094297 | Ga0495674_0094297_1187_2281 | 343 |
| 33 | 3300048088 | Ga0495602_0185991 | Ga0495602_0185991_424_1518 | 343 |
| 34 | 3300005434 | Ga0070709_10004736 | Ga0070709_100047366 | 345 |
| 35 | 3300005434 | Ga0070709_10169299 | Ga0070709_101692992 | 345 |
| 36 | 3300005471 | Ga0070698_100009744 | Ga0070698_1000097448 | 345 |
| 37 | 3300005536 | Ga0070697_100045968 | Ga0070697_1000459683 | 345 |
| 38 | 3300005548 | Ga0070665_100345479 | Ga0070665_1003454792 | 345 |
| 39 | 3300005614 | Ga0068856_100107772 | Ga0068856_1001077723 | 345 |
| 40 | 3300006163 | Ga0070715_10007474 | Ga0070715_100074744 | 345 |
| 41 | 3300022467 | Ga0224712_10025647 | Ga0224712_100256471 | 345 |
| 42 | 3300025906 | Ga0207699_10009049 | Ga0207699_100090496 | 345 |
| 43 | 3300025906 | Ga0207699_10015355 | Ga0207699_100153554 | 345 |
| 44 | 3300025928 | Ga0207700_10023650 | Ga0207700_100236502 | 345 |
| 45 | 3300025929 | Ga0207664_10003470 | Ga0207664_100034705 | 345 |
| 46 | 3300046679 | Ga0495623_0111532 | Ga0495623_0111532_547_1644 | 345 |
| 47 | 3300048907 | Ga0496104_0023708 | Ga0496104_0023708_3739_4854 | 345 |
| 48 | 3300048908 | Ga0496105_0001487 | Ga0496105_0001487_5696_6811 | 345 |
| 49 | 3300048912 | Ga0496109_0019349 | Ga0496109_0019349_3582_4697 | 345 |
| 50 | 3300048915 | Ga0496112_0009522 | Ga0496112_0009522_3602_4717 | 345 |
| 51 | 3300048916 | Ga0496113_0011681 | Ga0496113_0011681_3920_5035 | 345 |
| 52 | 3300048918 | Ga0496115_0067633 | Ga0496115_0067633_1664_2779 | 345 |
| 53 | 3300049578 | Ga0501042_0078418 | Ga0501042_0078418_1174_2289 | 345 |
| 54 | 3300005353 | Ga0070669_100028562 | Ga0070669_1000285621 | 346 |
| 55 | 3300005354 | Ga0070675_100065250 | Ga0070675_1000652501 | 346 |
| 56 | 3300005356 | Ga0070674_100056331 | Ga0070674_1000563313 | 346 |
| 57 | 3300009147 | Ga0114129_10308145 | Ga0114129_103081452 | 346 |
| 58 | 3300011119 | Ga0105246_10221151 | Ga0105246_102211511 | 346 |
| 59 | 3300013296 | Ga0157374_10257303 | Ga0157374_102573031 | 346 |
| 60 | 3300025926 | Ga0207659_10048848 | Ga0207659_100488481 | 346 |
| 61 | 3300046794 | Ga0495589_0077885 | Ga0495589_0077885_19_1134 | 346 |
| 62 | 3300050508 | nmdc:mga09592_18860_c1 | nmdc:mga09592_18860_c1_2871_3971 | 346 |
| 63 | 3300050510 | nmdc:mga06r32_6184_c1 | nmdc:mga06r32_6184_c1_1651_2751 | 346 |
| 64 | 3300060353 | Ga0501082_0000448 | Ga0501082_0000448_31152_32252 | 346 |
| 65 | iso_pu_bacteria | 2832004796 | 2832008372 | 347 |
| 66 | iso_pu_bacteria | 2863067949 | 2863070446 | 347 |
| 67 | 3300037312 | Ga0395899_0092459 | Ga0395899_0092459_284_1390 | 348 |
| 68 | 3300037466 | Ga0395898_0005154 | Ga0395898_0005154_10966_12072 | 348 |
| 69 | 3300037471 | Ga0395905_0022257 | Ga0395905_0022257_586_1692 | 348 |
| 70 | 3300049744 | Ga0501083_0003972 | Ga0501083_0003972_5972_7117 | 348 |
| 71 | 3300006163 | Ga0070715_10049125 | Ga0070715_100491252 | 349 |
| 72 | 3300044765 | Ga0466970_0030341 | Ga0466970_0030341_595_1707 | 349 |
| 73 | 3300048088 | Ga0495602_0111235 | Ga0495602_0111235_200_1312 | 349 |
| 74 | 3300005329 | Ga0070683_100071483 | Ga0070683_1000714834 | 350 |
| 75 | 3300005353 | Ga0070669_100243346 | Ga0070669_1002433462 | 350 |
| 76 | 3300005434 | Ga0070709_10208824 | Ga0070709_102088241 | 350 |
| 77 | 3300005445 | Ga0070708_100010165 | Ga0070708_1000101656 | 350 |
| 78 | 3300005467 | Ga0070706_100000403 | Ga0070706_10000040345 | 350 |
| 79 | 3300005467 | Ga0070706_100019605 | Ga0070706_1000196055 | 350 |
| 80 | 3300005468 | Ga0070707_100003950 | Ga0070707_1000039506 | 350 |
| 81 | 3300005468 | Ga0070707_100006419 | Ga0070707_1000064196 | 350 |
| 82 | 3300005471 | Ga0070698_100006375 | Ga0070698_1000063752 | 350 |
| 83 | 3300005518 | Ga0070699_100041319 | Ga0070699_1000413192 | 350 |
| 84 | 3300005536 | Ga0070697_100006899 | Ga0070697_1000068995 | 350 |
| 85 | 3300006195 | Ga0075366_10123088 | Ga0075366_101230883 | 350 |
| 86 | 3300006358 | Ga0068871_100034486 | Ga0068871_1000344865 | 350 |
| 87 | 3300007076 | Ga0075435_100065793 | Ga0075435_1000657932 | 350 |
| 88 | 3300009545 | Ga0105237_10036271 | Ga0105237_100362714 | 350 |
| 89 | 3300020069 | Ga0197907_10511865 | Ga0197907_105118653 | 350 |
| 90 | 3300020070 | Ga0206356_10262640 | Ga0206356_102626403 | 350 |
| 91 | 3300020078 | Ga0206352_11239808 | Ga0206352_112398082 | 350 |
| 92 | 3300020082 | Ga0206353_11681877 | Ga0206353_116818773 | 350 |
| 93 | 3300022467 | Ga0224712_10059171 | Ga0224712_100591712 | 350 |
| 94 | 3300025909 | Ga0207705_10008937 | Ga0207705_100089375 | 350 |
| 95 | 3300025910 | Ga0207684_10000031 | Ga0207684_1000003192 | 350 |
| 96 | 3300025915 | Ga0207693_10103392 | Ga0207693_101033922 | 350 |
| 97 | 3300025916 | Ga0207663_10043154 | Ga0207663_100431541 | 350 |
| 98 | 3300025922 | Ga0207646_10000145 | Ga0207646_10000145101 | 350 |
| 99 | 3300025922 | Ga0207646_10007955 | Ga0207646_100079555 | 350 |
| 100 | 3300025923 | Ga0207681_10240955 | Ga0207681_102409551 | 350 |
| 101 | 3300025928 | Ga0207700_10009798 | Ga0207700_100097985 | 350 |
| 102 | 3300028380 | Ga0268265_10155054 | Ga0268265_101550542 | 350 |
| 103 | 3300035083 | Ga0373926_0002829 | Ga0373926_0002829_572_1687 | 350 |
| 104 | 3300035089 | Ga0373944_0000495 | Ga0373944_0000495_220_1335 | 350 |
| 105 | 3300035111 | Ga0373923_0052193 | Ga0373923_0052193_427_1542 | 350 |
| 106 | 3300035113 | Ga0373936_0000130 | Ga0373936_0000130_13218_14333 | 350 |
| 107 | 3300035116 | Ga0373945_0000149 | Ga0373945_0000149_14503_15618 | 350 |
| 108 | 3300035170 | Ga0373943_0000215 | Ga0373943_0000215_2107_3222 | 350 |
| 109 | 3300035170 | Ga0373943_0022310 | Ga0373943_0022310_1406_2521 | 350 |
| 110 | 3300035171 | Ga0373946_0000093 | Ga0373946_0000093_11801_12916 | 350 |
| 111 | 3300035410 | Ga0373924_0005835 | Ga0373924_0005835_126_1241 | 350 |
| 112 | 3300035692 | Ga0373935_0009441 | Ga0373935_0009441_2324_3439 | 350 |
| 113 | 3300035724 | Ga0373933_0023812 | Ga0373933_0023812_919_2034 | 350 |
| 114 | 3300035725 | Ga0373947_0000281 | Ga0373947_0000281_16641_17756 | 350 |
| 115 | 3300037068 | Ga0373925_0000938 | Ga0373925_0000938_10969_12084 | 350 |
| 116 | 3300037068 | Ga0373925_0002793 | Ga0373925_0002793_738_1853 | 350 |
| 117 | 3300044712 | Ga0453684_0001473 | Ga0453684_0001473_56476_57621 | 350 |
| 118 | 3300044712 | Ga0453684_0284408 | Ga0453684_0284408_36_1151 | 350 |
| 119 | 3300045051 | Ga0451576_0012980 | Ga0451576_0012980_5205_6434 | 350 |
| 120 | 3300045836 | Ga0466958_0213996 | Ga0466958_0213996_100_1212 | 350 |
| 121 | 3300045976 | Ga0466967_0224492 | Ga0466967_0224492_243_1358 | 350 |
| 122 | 3300046455 | Ga0495603_0000150 | Ga0495603_0000150_20205_21320 | 350 |
| 123 | 3300046459 | Ga0495629_0200629 | Ga0495629_0200629_68_1183 | 350 |
| 124 | 3300046461 | Ga0495641_0034092 | Ga0495641_0034092_248_1363 | 350 |
| 125 | 3300046461 | Ga0495641_0045600 | Ga0495641_0045600_841_1953 | 350 |
| 126 | 3300046462 | Ga0495651_0010002 | Ga0495651_0010002_581_1696 | 350 |
| 127 | 3300046462 | Ga0495651_0157367 | Ga0495651_0157367_329_1444 | 350 |
| 128 | 3300046462 | Ga0495651_0160903 | Ga0495651_0160903_451_1566 | 350 |
| 129 | 3300046463 | Ga0495653_0000632 | Ga0495653_0000632_20671_21786 | 350 |
| 130 | 3300046463 | Ga0495653_0114125 | Ga0495653_0114125_445_1560 | 350 |
| 131 | 3300046472 | Ga0495580_0052503 | Ga0495580_0052503_33_1145 | 350 |
| 132 | 3300046475 | Ga0495639_0016341 | Ga0495639_0016341_70_1185 | 350 |
| 133 | 3300046477 | Ga0495664_0000201 | Ga0495664_0000201_10440_11555 | 350 |
| 134 | 3300046477 | Ga0495664_0024014 | Ga0495664_0024014_1352_2464 | 350 |
| 135 | 3300046477 | Ga0495664_0025253 | Ga0495664_0025253_112_1227 | 350 |
| 136 | 3300046492 | Ga0495585_0009697 | Ga0495585_0009697_750_1865 | 350 |
| 137 | 3300046499 | Ga0495594_0000071 | Ga0495594_0000071_14171_15286 | 350 |
| 138 | 3300046499 | Ga0495594_0001326 | Ga0495594_0001326_6580_7695 | 350 |
| 139 | 3300046499 | Ga0495594_0008374 | Ga0495594_0008374_1566_2678 | 350 |
| 140 | 3300046500 | Ga0495596_0007619 | Ga0495596_0007619_2583_3698 | 350 |
| 141 | 3300046506 | Ga0495583_0048092 | Ga0495583_0048092_289_1404 | 350 |
| 142 | 3300046511 | Ga0495608_0021357 | Ga0495608_0021357_285_1400 | 350 |
| 143 | 3300046514 | Ga0495618_0015458 | Ga0495618_0015458_1758_2870 | 350 |
| 144 | 3300046517 | Ga0495630_0024804 | Ga0495630_0024804_1647_2759 | 350 |
| 145 | 3300046518 | Ga0495631_0084778 | Ga0495631_0084778_212_1327 | 350 |
| 146 | 3300046523 | Ga0495644_0000059 | Ga0495644_0000059_47563_48678 | 350 |
| 147 | 3300046526 | Ga0495666_0007409 | Ga0495666_0007409_3745_4860 | 350 |
| 148 | 3300046531 | Ga0495665_0002287 | Ga0495665_0002287_2759_3874 | 350 |
| 149 | 3300046533 | Ga0495640_0009380 | Ga0495640_0009380_5925_7040 | 350 |
| 150 | 3300046533 | Ga0495640_0014685 | Ga0495640_0014685_3132_4247 | 350 |
| 151 | 3300046543 | Ga0495645_0098903 | Ga0495645_0098903_308_1423 | 350 |
| 152 | 3300046557 | Ga0495622_0061852 | Ga0495622_0061852_121_1236 | 350 |
| 153 | 3300046559 | Ga0495667_0003309 | Ga0495667_0003309_184_1299 | 350 |
| 154 | 3300046648 | Ga0495611_0011935 | Ga0495611_0011935_1017_2132 | 350 |
| 155 | 3300046660 | Ga0495625_0006612 | Ga0495625_0006612_4610_5725 | 350 |
| 156 | 3300046660 | Ga0495625_0023217 | Ga0495625_0023217_1657_2772 | 350 |
| 157 | 3300046663 | Ga0495635_0000377 | Ga0495635_0000377_3864_4979 | 350 |
| 158 | 3300046663 | Ga0495635_0006693 | Ga0495635_0006693_3620_4735 | 350 |
| 159 | 3300046663 | Ga0495635_0011741 | Ga0495635_0011741_3368_4483 | 350 |
| 160 | 3300046678 | Ga0495599_0062564 | Ga0495599_0062564_725_1840 | 350 |
| 161 | 3300046679 | Ga0495623_0062298 | Ga0495623_0062298_1064_2179 | 350 |
| 162 | 3300046680 | Ga0495646_0014543 | Ga0495646_0014543_131_1246 | 350 |
| 163 | 3300046683 | Ga0495658_0047774 | Ga0495658_0047774_662_1774 | 350 |
| 164 | 3300046684 | Ga0495669_0012957 | Ga0495669_0012957_1896_3011 | 350 |
| 165 | 3300046689 | Ga0495613_0029923 | Ga0495613_0029923_1280_2395 | 350 |
| 166 | 3300046689 | Ga0495613_0040700 | Ga0495613_0040700_1283_2398 | 350 |
| 167 | 3300046690 | Ga0495624_0086628 | Ga0495624_0086628_516_1631 | 350 |
| 168 | 3300046809 | Ga0495600_0002144 | Ga0495600_0002144_2311_3426 | 350 |
| 169 | 3300047317 | Ga0495604_0009078 | Ga0495604_0009078_554_1669 | 350 |
| 170 | 3300047319 | Ga0495674_0001255 | Ga0495674_0001255_6777_7892 | 350 |
| 171 | 3300047319 | Ga0495674_0012606 | Ga0495674_0012606_2926_4041 | 350 |
| 172 | 3300047319 | Ga0495674_0062901 | Ga0495674_0062901_1702_2814 | 350 |
| 173 | 3300047321 | Ga0495676_0001118 | Ga0495676_0001118_20911_22026 | 350 |
| 174 | 3300047321 | Ga0495676_0008030 | Ga0495676_0008030_7979_9094 | 350 |
| 175 | 3300047322 | Ga0495680_0006058 | Ga0495680_0006058_7509_8624 | 350 |
| 176 | 3300047322 | Ga0495680_0039529 | Ga0495680_0039529_18_1133 | 350 |
| 177 | 3300047322 | Ga0495680_0046181 | Ga0495680_0046181_1885_3000 | 350 |
| 178 | 3300047322 | Ga0495680_0067967 | Ga0495680_0067967_35_1147 | 350 |
| 179 | 3300047323 | Ga0495683_0085285 | Ga0495683_0085285_392_1507 | 350 |
| 180 | 3300047444 | Ga0495675_0072513 | Ga0495675_0072513_668_1783 | 350 |
| 181 | 3300047445 | Ga0495677_0046642 | Ga0495677_0046642_222_1337 | 350 |
| 182 | 3300047471 | Ga0495684_0110168 | Ga0495684_0110168_603_1718 | 350 |
| 183 | 3300047471 | Ga0495684_0132989 | Ga0495684_0132989_444_1556 | 350 |
| 184 | 3300047472 | Ga0495686_0000035 | Ga0495686_0000035_67596_68711 | 350 |
| 185 | 3300048907 | Ga0496104_0000137 | Ga0496104_0000137_19524_20639 | 350 |
| 186 | 3300048917 | Ga0496114_0058637 | Ga0496114_0058637_1255_2370 | 350 |
| 187 | 3300049573 | Ga0501037_0060753 | Ga0501037_0060753_904_2016 | 350 |
| 188 | 3300049581 | Ga0501047_0002031 | Ga0501047_0002031_9431_10543 | 350 |
| 189 | 3300049822 | Ga0501035_0001860 | Ga0501035_0001860_9150_10262 | 350 |
| 190 | 3300049823 | Ga0501044_0000769 | Ga0501044_0000769_13683_14795 | 350 |
| 191 | 3300050508 | nmdc:mga09592_15431_c1 | nmdc:mga09592_15431_c1_1164_2279 | 350 |
| 192 | 3300050512 | nmdc:mga0n895_327323_c1 | nmdc:mga0n895_327323_c1_34_1146 | 350 |
| 193 | 3300004799 | Ga0058863_10054814 | Ga0058863_100548141 | 351 |
| 194 | 3300004799 | Ga0058863_11370755 | Ga0058863_113707552 | 351 |
| 195 | 3300004799 | Ga0058863_11897541 | Ga0058863_118975413 | 351 |
| 196 | 3300005290 | Ga0065712_10003594 | Ga0065712_100035941 | 351 |
| 197 | 3300005293 | Ga0065715_10023999 | Ga0065715_100239992 | 351 |
| 198 | 3300005327 | Ga0070658_10000510 | Ga0070658_1000051015 | 351 |
| 199 | 3300005329 | Ga0070683_100002619 | Ga0070683_1000026195 | 351 |
| 200 | 3300005329 | Ga0070683_100003346 | Ga0070683_1000033462 | 351 |
| 201 | 3300005329 | Ga0070683_100020451 | Ga0070683_1000204512 | 351 |
| 202 | 3300005329 | Ga0070683_100047912 | Ga0070683_1000479123 | 351 |
| 203 | 3300005329 | Ga0070683_100253386 | Ga0070683_1002533862 | 351 |
| 204 | 3300005331 | Ga0070670_100003002 | Ga0070670_1000030024 | 351 |
| 205 | 3300005334 | Ga0068869_100045274 | Ga0068869_1000452743 | 351 |
| 206 | 3300005335 | Ga0070666_10040313 | Ga0070666_100403134 | 351 |
| 207 | 3300005336 | Ga0070680_100002142 | Ga0070680_10000214210 | 351 |
| 208 | 3300005336 | Ga0070680_100012985 | Ga0070680_1000129854 | 351 |
| 209 | 3300005336 | Ga0070680_100120058 | Ga0070680_1001200582 | 351 |
| 210 | 3300005338 | Ga0068868_100007159 | Ga0068868_1000071593 | 351 |
| 211 | 3300005339 | Ga0070660_100176016 | Ga0070660_1001760162 | 351 |
| 212 | 3300005344 | Ga0070661_100138589 | Ga0070661_1001385892 | 351 |
| 213 | 3300005344 | Ga0070661_100184413 | Ga0070661_1001844132 | 351 |
| 214 | 3300005353 | Ga0070669_100156518 | Ga0070669_1001565182 | 351 |
| 215 | 3300005355 | Ga0070671_100000636 | Ga0070671_1000006366 | 351 |
| 216 | 3300005366 | Ga0070659_100000459 | Ga0070659_10000045917 | 351 |
| 217 | 3300005435 | Ga0070714_100002057 | Ga0070714_1000020571 | 351 |
| 218 | 3300005435 | Ga0070714_100006827 | Ga0070714_1000068273 | 351 |
| 219 | 3300005436 | Ga0070713_100008151 | Ga0070713_1000081514 | 351 |
| 220 | 3300005436 | Ga0070713_100097811 | Ga0070713_1000978112 | 351 |
| 221 | 3300005436 | Ga0070713_100145571 | Ga0070713_1001455712 | 351 |
| 222 | 3300005439 | Ga0070711_100153055 | Ga0070711_1001530552 | 351 |
| 223 | 3300005445 | Ga0070708_100012271 | Ga0070708_1000122713 | 351 |
| 224 | 3300005455 | Ga0070663_100001910 | Ga0070663_10000191011 | 351 |
| 225 | 3300005456 | Ga0070678_100017468 | Ga0070678_1000174682 | 351 |
| 226 | 3300005456 | Ga0070678_100101563 | Ga0070678_1001015633 | 351 |
| 227 | 3300005458 | Ga0070681_10000546 | Ga0070681_1000054623 | 351 |
| 228 | 3300005458 | Ga0070681_10002810 | Ga0070681_1000281010 | 351 |
| 229 | 3300005458 | Ga0070681_10045579 | Ga0070681_100455792 | 351 |
| 230 | 3300005458 | Ga0070681_10056462 | Ga0070681_100564622 | 351 |
| 231 | 3300005458 | Ga0070681_10147147 | Ga0070681_101471473 | 351 |
| 232 | 3300005467 | Ga0070706_100000475 | Ga0070706_1000004759 | 351 |
| 233 | 3300005468 | Ga0070707_100042080 | Ga0070707_1000420803 | 351 |
| 234 | 3300005468 | Ga0070707_100213726 | Ga0070707_1002137262 | 351 |
| 235 | 3300005471 | Ga0070698_100003778 | Ga0070698_1000037787 | 351 |
| 236 | 3300005471 | Ga0070698_100061184 | Ga0070698_1000611842 | 351 |
| 237 | 3300005518 | Ga0070699_100132426 | Ga0070699_1001324262 | 351 |
| 238 | 3300005530 | Ga0070679_100000514 | Ga0070679_1000005146 | 351 |
| 239 | 3300005530 | Ga0070679_100000557 | Ga0070679_1000005574 | 351 |
| 240 | 3300005530 | Ga0070679_100131498 | Ga0070679_1001314983 | 351 |
| 241 | 3300005535 | Ga0070684_100000424 | Ga0070684_1000004245 | 351 |
| 242 | 3300005535 | Ga0070684_100002528 | Ga0070684_1000025288 | 351 |
| 243 | 3300005539 | Ga0068853_100000204 | Ga0068853_1000002049 | 351 |
| 244 | 3300005539 | Ga0068853_100003979 | Ga0068853_1000039797 | 351 |
| 245 | 3300005539 | Ga0068853_100004688 | Ga0068853_1000046888 | 351 |
| 246 | 3300005545 | Ga0070695_100251515 | Ga0070695_1002515151 | 351 |
| 247 | 3300005563 | Ga0068855_100024898 | Ga0068855_1000248989 | 351 |
| 248 | 3300005563 | Ga0068855_100047335 | Ga0068855_1000473352 | 351 |
| 249 | 3300005577 | Ga0068857_100001981 | Ga0068857_1000019815 | 351 |
| 250 | 3300005577 | Ga0068857_100112753 | Ga0068857_1001127532 | 351 |
| 251 | 3300005578 | Ga0068854_100000081 | Ga0068854_10000008124 | 351 |
| 252 | 3300005616 | Ga0068852_100023381 | Ga0068852_1000233813 | 351 |
| 253 | 3300005617 | Ga0068859_100146451 | Ga0068859_1001464513 | 351 |
| 254 | 3300005842 | Ga0068858_100005594 | Ga0068858_1000055946 | 351 |
| 255 | 3300006028 | Ga0070717_10000194 | Ga0070717_1000019421 | 351 |
| 256 | 3300006028 | Ga0070717_10010237 | Ga0070717_100102375 | 351 |
| 257 | 3300006844 | Ga0075428_100013256 | Ga0075428_1000132563 | 351 |
| 258 | 3300006844 | Ga0075428_100032244 | Ga0075428_1000322442 | 351 |
| 259 | 3300006847 | Ga0075431_100005811 | Ga0075431_1000058114 | 351 |
| 260 | 3300006847 | Ga0075431_100095378 | Ga0075431_1000953783 | 351 |
| 261 | 3300006852 | Ga0075433_10072176 | Ga0075433_100721764 | 351 |
| 262 | 3300006880 | Ga0075429_100002325 | Ga0075429_1000023254 | 351 |
| 263 | 3300006931 | Ga0097620_100146445 | Ga0097620_1001464453 | 351 |
| 264 | 3300009093 | Ga0105240_10006804 | Ga0105240_100068047 | 351 |
| 265 | 3300009093 | Ga0105240_10008376 | Ga0105240_1000837610 | 351 |
| 266 | 3300009093 | Ga0105240_10012369 | Ga0105240_100123694 | 351 |
| 267 | 3300009094 | Ga0111539_10290463 | Ga0111539_102904632 | 351 |
| 268 | 3300009147 | Ga0114129_10037159 | Ga0114129_100371593 | 351 |
| 269 | 3300009174 | Ga0105241_10002200 | Ga0105241_1000220010 | 351 |
| 270 | 3300009177 | Ga0105248_10003617 | Ga0105248_100036176 | 351 |
| 271 | 3300009545 | Ga0105237_10004257 | Ga0105237_1000425711 | 351 |
| 272 | 3300009551 | Ga0105238_10003016 | Ga0105238_100030165 | 351 |
| 273 | 3300009551 | Ga0105238_10070087 | Ga0105238_100700874 | 351 |
| 274 | 3300010375 | Ga0105239_10001126 | Ga0105239_100011269 | 351 |
| 275 | 3300013104 | Ga0157370_10008156 | Ga0157370_100081565 | 351 |
| 276 | 3300013104 | Ga0157370_10018606 | Ga0157370_100186067 | 351 |
| 277 | 3300013105 | Ga0157369_10002662 | Ga0157369_1000266215 | 351 |
| 278 | 3300013105 | Ga0157369_10049641 | Ga0157369_100496413 | 351 |
| 279 | 3300013105 | Ga0157369_10088717 | Ga0157369_100887173 | 351 |
| 280 | 3300013307 | Ga0157372_10000871 | Ga0157372_100008715 | 351 |
| 281 | 3300013307 | Ga0157372_10063957 | Ga0157372_100639574 | 351 |
| 282 | 3300013307 | Ga0157372_10166847 | Ga0157372_101668473 | 351 |
| 283 | 3300017792 | Ga0163161_10104621 | Ga0163161_101046213 | 351 |
| 284 | 3300017792 | Ga0163161_10107883 | Ga0163161_101078833 | 351 |
| 285 | 3300020069 | Ga0197907_10291974 | Ga0197907_102919741 | 351 |
| 286 | 3300020078 | Ga0206352_10240072 | Ga0206352_102400725 | 351 |
| 287 | 3300020080 | Ga0206350_10169733 | Ga0206350_101697334 | 351 |
| 288 | 3300020081 | Ga0206354_10022903 | Ga0206354_100229031 | 351 |
| 289 | 3300021388 | Ga0213875_10057493 | Ga0213875_100574932 | 351 |
| 290 | 3300022467 | Ga0224712_10000486 | Ga0224712_100004868 | 351 |
| 291 | 3300022467 | Ga0224712_10039947 | Ga0224712_100399471 | 351 |
| 292 | 3300025908 | Ga0207643_10012368 | Ga0207643_100123683 | 351 |
| 293 | 3300025910 | Ga0207684_10000281 | Ga0207684_1000028156 | 351 |
| 294 | 3300025910 | Ga0207684_10003088 | Ga0207684_100030889 | 351 |
| 295 | 3300025911 | Ga0207654_10007780 | Ga0207654_100077805 | 351 |
| 296 | 3300025912 | Ga0207707_10000774 | Ga0207707_1000077424 | 351 |
| 297 | 3300025912 | Ga0207707_10003775 | Ga0207707_100037759 | 351 |
| 298 | 3300025913 | Ga0207695_10001737 | Ga0207695_1000173723 | 351 |
| 299 | 3300025913 | Ga0207695_10148659 | Ga0207695_101486593 | 351 |
| 300 | 3300025913 | Ga0207695_10255433 | Ga0207695_102554332 | 351 |
| 301 | 3300025914 | Ga0207671_10009523 | Ga0207671_100095234 | 351 |
| 302 | 3300025917 | Ga0207660_10001846 | Ga0207660_100018466 | 351 |
| 303 | 3300025917 | Ga0207660_10134637 | Ga0207660_101346371 | 351 |
| 304 | 3300025919 | Ga0207657_10005473 | Ga0207657_100054735 | 351 |
| 305 | 3300025919 | Ga0207657_10077123 | Ga0207657_100771232 | 351 |
| 306 | 3300025920 | Ga0207649_10109125 | Ga0207649_101091252 | 351 |
| 307 | 3300025921 | Ga0207652_10000566 | Ga0207652_1000056612 | 351 |
| 308 | 3300025921 | Ga0207652_10220754 | Ga0207652_102207542 | 351 |
| 309 | 3300025922 | Ga0207646_10000043 | Ga0207646_1000004311 | 351 |
| 310 | 3300025922 | Ga0207646_10000096 | Ga0207646_1000009672 | 351 |
| 311 | 3300025922 | Ga0207646_10000954 | Ga0207646_1000095426 | 351 |
| 312 | 3300025922 | Ga0207646_10005468 | Ga0207646_100054689 | 351 |
| 313 | 3300025922 | Ga0207646_10169065 | Ga0207646_101690652 | 351 |
| 314 | 3300025924 | Ga0207694_10002225 | Ga0207694_100022257 | 351 |
| 315 | 3300025926 | Ga0207659_10166158 | Ga0207659_101661582 | 351 |
| 316 | 3300025928 | Ga0207700_10003895 | Ga0207700_100038953 | 351 |
| 317 | 3300025928 | Ga0207700_10089634 | Ga0207700_100896342 | 351 |
| 318 | 3300025929 | Ga0207664_10002658 | Ga0207664_1000265811 | 351 |
| 319 | 3300025929 | Ga0207664_10123351 | Ga0207664_101233512 | 351 |
| 320 | 3300025931 | Ga0207644_10003541 | Ga0207644_100035413 | 351 |
| 321 | 3300025931 | Ga0207644_10194540 | Ga0207644_101945402 | 351 |
| 322 | 3300025932 | Ga0207690_10000312 | Ga0207690_1000031219 | 351 |
| 323 | 3300025937 | Ga0207669_10080589 | Ga0207669_100805892 | 351 |
| 324 | 3300025938 | Ga0207704_10092975 | Ga0207704_100929753 | 351 |
| 325 | 3300025939 | Ga0207665_10125188 | Ga0207665_101251882 | 351 |
| 326 | 3300025940 | Ga0207691_10001347 | Ga0207691_1000134724 | 351 |
| 327 | 3300025941 | Ga0207711_10320864 | Ga0207711_103208642 | 351 |
| 328 | 3300025942 | Ga0207689_10056751 | Ga0207689_100567513 | 351 |
| 329 | 3300025944 | Ga0207661_10013348 | Ga0207661_100133483 | 351 |
| 330 | 3300025944 | Ga0207661_10077520 | Ga0207661_100775202 | 351 |
| 331 | 3300025944 | Ga0207661_10214746 | Ga0207661_102147462 | 351 |
| 332 | 3300025949 | Ga0207667_10000797 | Ga0207667_100007976 | 351 |
| 333 | 3300025949 | Ga0207667_10060293 | Ga0207667_100602934 | 351 |
| 334 | 3300025981 | Ga0207640_10000019 | Ga0207640_10000019141 | 351 |
| 335 | 3300025981 | Ga0207640_10123544 | Ga0207640_101235442 | 351 |
| 336 | 3300026035 | Ga0207703_10003930 | Ga0207703_100039306 | 351 |
| 337 | 3300026041 | Ga0207639_10000120 | Ga0207639_100001209 | 351 |
| 338 | 3300026041 | Ga0207639_10007749 | Ga0207639_100077495 | 351 |
| 339 | 3300026041 | Ga0207639_10024662 | Ga0207639_100246626 | 351 |
| 340 | 3300026067 | Ga0207678_10004212 | Ga0207678_100042126 | 351 |
| 341 | 3300026089 | Ga0207648_10392760 | Ga0207648_103927601 | 351 |
| 342 | 3300026116 | Ga0207674_10000995 | Ga0207674_1000099510 | 351 |
| 343 | 3300026116 | Ga0207674_10118480 | Ga0207674_101184803 | 351 |
| 344 | 3300026118 | Ga0207675_100022020 | Ga0207675_1000220207 | 351 |
| 345 | 3300026118 | Ga0207675_100071116 | Ga0207675_1000711164 | 351 |
| 346 | 3300026121 | Ga0207683_10008581 | Ga0207683_100085813 | 351 |
| 347 | 3300026121 | Ga0207683_10215252 | Ga0207683_102152521 | 351 |
| 348 | 3300026142 | Ga0207698_10009002 | Ga0207698_100090025 | 351 |
| 349 | 3300026142 | Ga0207698_10064505 | Ga0207698_100645053 | 351 |
| 350 | 3300027907 | Ga0207428_10000144 | Ga0207428_1000014447 | 351 |
| 351 | 3300027907 | Ga0207428_10144972 | Ga0207428_101449723 | 351 |
| 352 | 3300028800 | Ga0265338_10129377 | Ga0265338_101293772 | 351 |
| 353 | 3300028800 | Ga0265338_10136743 | Ga0265338_101367433 | 351 |
| 354 | 3300031241 | Ga0265325_10067336 | Ga0265325_100673363 | 351 |
| 355 | 3300031247 | Ga0265340_10051722 | Ga0265340_100517223 | 351 |
| 356 | 3300031251 | Ga0265327_10005424 | Ga0265327_1000542410 | 351 |
| 357 | 3300031712 | Ga0265342_10040407 | Ga0265342_100404072 | 351 |
| 358 | 3300031712 | Ga0265342_10157057 | Ga0265342_101570571 | 351 |
| 359 | 3300032002 | Ga0307416_100094864 | Ga0307416_1000948642 | 351 |
| 360 | 3300032004 | Ga0307414_10113899 | Ga0307414_101138992 | 351 |
| 361 | 3300033180 | Ga0307510_10069741 | Ga0307510_100697415 | 351 |
| 362 | 3300035083 | Ga0373926_0004836 | Ga0373926_0004836_2915_4030 | 351 |
| 363 | 3300035086 | Ga0373934_0000873 | Ga0373934_0000873_5706_6821 | 351 |
| 364 | 3300035111 | Ga0373923_0062679 | Ga0373923_0062679_259_1377 | 351 |
| 365 | 3300035116 | Ga0373945_0074926 | Ga0373945_0074926_28_1143 | 351 |
| 366 | 3300035119 | Ga0373956_0002520 | Ga0373956_0002520_54_1169 | 351 |
| 367 | 3300035119 | Ga0373956_0029434 | Ga0373956_0029434_148_1263 | 351 |
| 368 | 3300035119 | Ga0373956_0035423 | Ga0373956_0035423_835_1950 | 351 |
| 369 | 3300035170 | Ga0373943_0005403 | Ga0373943_0005403_961_2076 | 351 |
| 370 | 3300035692 | Ga0373935_0000437 | Ga0373935_0000437_14823_15938 | 351 |
| 371 | 3300035692 | Ga0373935_0001066 | Ga0373935_0001066_5365_6480 | 351 |
| 372 | 3300035695 | Ga0373927_0001407 | Ga0373927_0001407_16642_17757 | 351 |
| 373 | 3300035724 | Ga0373933_0012242 | Ga0373933_0012242_3085_4200 | 351 |
| 374 | 3300035724 | Ga0373933_0032261 | Ga0373933_0032261_419_1534 | 351 |
| 375 | 3300035724 | Ga0373933_0038769 | Ga0373933_0038769_696_1811 | 351 |
| 376 | 3300036401 | Ga0373937_0015324 | Ga0373937_0015324_4803_5918 | 351 |
| 377 | 3300036401 | Ga0373937_0018872 | Ga0373937_0018872_382_1497 | 351 |
| 378 | 3300037068 | Ga0373925_0003908 | Ga0373925_0003908_2977_4092 | 351 |
| 379 | 3300037068 | Ga0373925_0010852 | Ga0373925_0010852_730_1851 | 351 |
| 380 | 3300037312 | Ga0395899_0000734 | Ga0395899_0000734_61_1176 | 351 |
| 381 | 3300037312 | Ga0395899_0003022 | Ga0395899_0003022_12047_13162 | 351 |
| 382 | 3300037418 | Ga0395900_0004531 | Ga0395900_0004531_11119_12234 | 351 |
| 383 | 3300037418 | Ga0395900_0036668 | Ga0395900_0036668_1700_2815 | 351 |
| 384 | 3300037418 | Ga0395900_0170740 | Ga0395900_0170740_51_1166 | 351 |
| 385 | 3300037466 | Ga0395898_0032668 | Ga0395898_0032668_143_1258 | 351 |
| 386 | 3300037853 | Ga0436364_0319228 | Ga0436364_0319228_1521_2636 | 351 |
| 387 | 3300037853 | Ga0436364_1022225 | Ga0436364_1022225_269_1405 | 351 |
| 388 | 3300037853 | Ga0436364_1214168 | Ga0436364_1214168_1922_3037 | 351 |
| 389 | 3300038443 | Ga0395901_0000376 | Ga0395901_0000376_32164_33279 | 351 |
| 390 | 3300038443 | Ga0395901_0005500 | Ga0395901_0005500_10524_11639 | 351 |
| 391 | 3300039437 | Ga0436365_0592662 | Ga0436365_0592662_1497_2612 | 351 |
| 392 | 3300039437 | Ga0436365_0682928 | Ga0436365_0682928_5011_6216 | 351 |
| 393 | 3300039437 | Ga0436365_1483147 | Ga0436365_1483147_189_1304 | 351 |
| 394 | 3300039447 | Ga0436361_1032002 | Ga0436361_1032002_108_1223 | 351 |
| 395 | 3300039447 | Ga0436361_1111202 | Ga0436361_1111202_82_1197 | 351 |
| 396 | 3300039450 | Ga0436363_0157307 | Ga0436363_0157307_1925_3103 | 351 |
| 397 | 3300044684 | Ga0466966_0003787 | Ga0466966_0003787_6128_7243 | 351 |
| 398 | 3300044694 | Ga0466963_0271619 | Ga0466963_0271619_27_1142 | 351 |
| 399 | 3300045049 | Ga0466959_0109125 | Ga0466959_0109125_469_1584 | 351 |
| 400 | 3300045976 | Ga0466967_0522613 | Ga0466967_0522613_16_1131 | 351 |
| 401 | 3300046462 | Ga0495651_0005897 | Ga0495651_0005897_7639_8754 | 351 |
| 402 | 3300046472 | Ga0495580_0155157 | Ga0495580_0155157_93_1208 | 351 |
| 403 | 3300046473 | Ga0495582_0016388 | Ga0495582_0016388_2287_3402 | 351 |
| 404 | 3300046475 | Ga0495639_0002384 | Ga0495639_0002384_4108_5223 | 351 |
| 405 | 3300046506 | Ga0495583_0063970 | Ga0495583_0063970_24_1178 | 351 |
| 406 | 3300046511 | Ga0495608_0090523 | Ga0495608_0090523_614_1729 | 351 |
| 407 | 3300046517 | Ga0495630_0012714 | Ga0495630_0012714_4977_6092 | 351 |
| 408 | 3300046517 | Ga0495630_0119925 | Ga0495630_0119925_86_1201 | 351 |
| 409 | 3300046529 | Ga0495652_0150611 | Ga0495652_0150611_235_1350 | 351 |
| 410 | 3300046531 | Ga0495665_0000700 | Ga0495665_0000700_15757_16872 | 351 |
| 411 | 3300046536 | Ga0495587_0000289 | Ga0495587_0000289_17468_18583 | 351 |
| 412 | 3300046536 | Ga0495587_0065305 | Ga0495587_0065305_604_1719 | 351 |
| 413 | 3300046538 | Ga0495609_0036538 | Ga0495609_0036538_431_1546 | 351 |
| 414 | 3300046559 | Ga0495667_0011555 | Ga0495667_0011555_1665_2780 | 351 |
| 415 | 3300046674 | Ga0495588_0001897 | Ga0495588_0001897_2970_4085 | 351 |
| 416 | 3300046679 | Ga0495623_0052130 | Ga0495623_0052130_392_1507 | 351 |
| 417 | 3300046680 | Ga0495646_0098447 | Ga0495646_0098447_492_1607 | 351 |
| 418 | 3300046683 | Ga0495658_0001571 | Ga0495658_0001571_10425_11540 | 351 |
| 419 | 3300046689 | Ga0495613_0003274 | Ga0495613_0003274_7535_8650 | 351 |
| 420 | 3300046689 | Ga0495613_0175172 | Ga0495613_0175172_87_1202 | 351 |
| 421 | 3300047315 | Ga0495581_0009887 | Ga0495581_0009887_2180_3295 | 351 |
| 422 | 3300047317 | Ga0495604_0020529 | Ga0495604_0020529_2631_3746 | 351 |
| 423 | 3300047322 | Ga0495680_0033646 | Ga0495680_0033646_1197_2312 | 351 |
| 424 | 3300047444 | Ga0495675_0073571 | Ga0495675_0073571_341_1456 | 351 |
| 425 | 3300047471 | Ga0495684_0027510 | Ga0495684_0027510_1824_2939 | 351 |
| 426 | 3300048088 | Ga0495602_0008192 | Ga0495602_0008192_145_1260 | 351 |
| 427 | 3300048088 | Ga0495602_0032220 | Ga0495602_0032220_3438_4553 | 351 |
| 428 | 3300048089 | Ga0495614_0000914 | Ga0495614_0000914_9785_10900 | 351 |
| 429 | 3300048907 | Ga0496104_0016151 | Ga0496104_0016151_5562_6677 | 351 |
| 430 | 3300048911 | Ga0496108_0036508 | Ga0496108_0036508_1549_2664 | 351 |
| 431 | 3300048912 | Ga0496109_0003051 | Ga0496109_0003051_7721_8836 | 351 |
| 432 | 3300048913 | Ga0496110_0036628 | Ga0496110_0036628_2754_3869 | 351 |
| 433 | 3300048913 | Ga0496110_0037020 | Ga0496110_0037020_427_1542 | 351 |
| 434 | 3300048913 | Ga0496110_0124198 | Ga0496110_0124198_1147_2262 | 351 |
| 435 | 3300048913 | Ga0496110_0450383 | Ga0496110_0450383_26_1141 | 351 |
| 436 | 3300048914 | Ga0496111_0239216 | Ga0496111_0239216_179_1294 | 351 |
| 437 | 3300048915 | Ga0496112_0007149 | Ga0496112_0007149_8657_9772 | 351 |
| 438 | 3300048915 | Ga0496112_0206794 | Ga0496112_0206794_193_1308 | 351 |
| 439 | 3300048916 | Ga0496113_0075926 | Ga0496113_0075926_688_1803 | 351 |
| 440 | 3300048917 | Ga0496114_0195605 | Ga0496114_0195605_595_1710 | 351 |
| 441 | 3300048918 | Ga0496115_0259464 | Ga0496115_0259464_272_1387 | 351 |
| 442 | 3300048929 | Ga0496126_0000020 | Ga0496126_0000020_211349_212464 | 351 |
| 443 | 3300049568 | Ga0501031_0008717 | Ga0501031_0008717_1713_2828 | 351 |
| 444 | 3300049569 | Ga0501032_0000463 | Ga0501032_0000463_4520_5635 | 351 |
| 445 | 3300049570 | Ga0501033_0019994 | Ga0501033_0019994_1976_3091 | 351 |
| 446 | 3300049571 | Ga0501034_0005208 | Ga0501034_0005208_1146_2261 | 351 |
| 447 | 3300049571 | Ga0501034_0006548 | Ga0501034_0006548_7955_9070 | 351 |
| 448 | 3300049572 | Ga0501036_0003645 | Ga0501036_0003645_10884_11999 | 351 |
| 449 | 3300049572 | Ga0501036_0004808 | Ga0501036_0004808_8033_9148 | 351 |
| 450 | 3300049573 | Ga0501037_0016891 | Ga0501037_0016891_1795_2910 | 351 |
| 451 | 3300049574 | Ga0501038_0008187 | Ga0501038_0008187_1328_2443 | 351 |
| 452 | 3300049575 | Ga0501039_0044212 | Ga0501039_0044212_480_1595 | 351 |
| 453 | 3300049578 | Ga0501042_0012676 | Ga0501042_0012676_1626_2741 | 351 |
| 454 | 3300049578 | Ga0501042_0139472 | Ga0501042_0139472_430_1545 | 351 |
| 455 | 3300049579 | Ga0501043_0002327 | Ga0501043_0002327_576_1691 | 351 |
| 456 | 3300049579 | Ga0501043_0072027 | Ga0501043_0072027_483_1598 | 351 |
| 457 | 3300049580 | Ga0501046_0000091 | Ga0501046_0000091_94242_95357 | 351 |
| 458 | 3300049581 | Ga0501047_0000929 | Ga0501047_0000929_1883_2998 | 351 |
| 459 | 3300049581 | Ga0501047_0001874 | Ga0501047_0001874_8998_10113 | 351 |
| 460 | 3300049582 | Ga0501048_0008299 | Ga0501048_0008299_2766_3881 | 351 |
| 461 | 3300049583 | Ga0501067_0019729 | Ga0501067_0019729_2350_3465 | 351 |
| 462 | 3300049584 | Ga0501068_0046929 | Ga0501068_0046929_391_1506 | 351 |
| 463 | 3300049585 | Ga0501069_0029958 | Ga0501069_0029958_1386_2501 | 351 |
| 464 | 3300049589 | Ga0501073_0007003 | Ga0501073_0007003_5585_6700 | 351 |
| 465 | 3300049589 | Ga0501073_0077052 | Ga0501073_0077052_915_2030 | 351 |
| 466 | 3300049590 | Ga0501074_0006347 | Ga0501074_0006347_1505_2620 | 351 |
| 467 | 3300049822 | Ga0501035_0006266 | Ga0501035_0006266_9033_10148 | 351 |
| 468 | 3300049823 | Ga0501044_0066566 | Ga0501044_0066566_2195_3310 | 351 |
| 469 | 3300050507 | nmdc:mga05p37_20365_c1 | nmdc:mga05p37_20365_c1_5818_6933 | 351 |
| 470 | 3300050507 | nmdc:mga05p37_26722_c1 | nmdc:mga05p37_26722_c1_965_2098 | 351 |
| 471 | 3300050510 | nmdc:mga06r32_10909_c1 | nmdc:mga06r32_10909_c1_291_1406 | 351 |
| 472 | 3300050511 | nmdc:mga08y16_128717_c1 | nmdc:mga08y16_128717_c1_193_1308 | 351 |
| 473 | 3300050511 | nmdc:mga08y16_421677_c1 | nmdc:mga08y16_421677_c1_38_1153 | 351 |
| 474 | 3300050511 | nmdc:mga08y16_89775_c1 | nmdc:mga08y16_89775_c1_410_1525 | 351 |
| 475 | 3300050512 | nmdc:mga0n895_179969_c1 | nmdc:mga0n895_179969_c1_864_1979 | 351 |
| 476 | 3300050512 | nmdc:mga0n895_86181_c1 | nmdc:mga0n895_86181_c1_457_1572 | 351 |
| 477 | 3300050514 | nmdc:mga08x19_96718_c1 | nmdc:mga08x19_96718_c1_452_1567 | 351 |
| 478 | 3300050515 | nmdc:mga0a205_16929_c1 | nmdc:mga0a205_16929_c1_4956_6071 | 351 |
| 479 | 3300050515 | nmdc:mga0a205_6577_c1 | nmdc:mga0a205_6577_c1_1449_2564 | 351 |
| 480 | 3300053119 | Ga0500595_033209 | Ga0500595_033209_112_1227 | 351 |
| 481 | 3300059421 | Ga0590071_001719 | Ga0590071_001719_2878_3993 | 351 |
| 482 | 3300061734 | Ga0530510_0044435 | Ga0530510_0044435_2016_3131 | 351 |
| 483 | 3300005985 | Ga0081539_10014701 | Ga0081539_100147016 | 353 |
| 484 | 3300028800 | Ga0265338_10122182 | Ga0265338_101221821 | 355 |
| 485 | 3300036401 | Ga0373937_0081661 | Ga0373937_0081661_292_1449 | 355 |
| 486 | 3300046663 | Ga0495635_0191159 | Ga0495635_0191159_78_1253 | 355 |
| 487 | 3300046689 | Ga0495613_0002408 | Ga0495613_0002408_1999_3156 | 355 |
| 488 | 3300047471 | Ga0495684_0008447 | Ga0495684_0008447_366_1523 | 355 |
| 489 | 3300049573 | Ga0501037_0000073 | Ga0501037_0000073_39615_40772 | 355 |
| 490 | 3300049823 | Ga0501044_0000946 | Ga0501044_0000946_22053_23210 | 355 |
| 491 | 3300009177 | Ga0105248_10310836 | Ga0105248_103108363 | 356 |
| 492 | 3300049571 | Ga0501034_0008653 | Ga0501034_0008653_2413_3579 | 356 |
| 493 | 3300006028 | Ga0070717_10082230 | Ga0070717_100822304 | 359 |
| 494 | 3300025928 | Ga0207700_10025491 | Ga0207700_100254913 | 359 |
| 495 | 3300046536 | Ga0495587_0138060 | Ga0495587_0138060_60_1235 | 359 |
| 496 | 3300053077 | Ga0495601_0000713 | Ga0495601_0000713_1230_2405 | 359 |
| 497 | 3300053085 | Ga0495619_0093101 | Ga0495619_0093101_569_1744 | 359 |
| 498 | 3300013307 | Ga0157372_10020715 | Ga0157372_100207152 | 360 |
| 499 | 3300003203 | JGI25406J46586_10000459 | JGI25406J46586_1000045916 | 362 |
| 500 | 3300005518 | Ga0070699_100031616 | Ga0070699_1000316163 | 362 |
| 501 | 3300006846 | Ga0075430_100014515 | Ga0075430_1000145154 | 362 |
| 502 | 3300006847 | Ga0075431_100027132 | Ga0075431_1000271326 | 362 |
| 503 | 3300009094 | Ga0111539_10060682 | Ga0111539_100606822 | 362 |
| 504 | 3300049592 | Ga0501076_0272211 | Ga0501076_0272211_171_1355 | 362 |
| 505 | 3300050509 | nmdc:mga0qj67_37712_c1 | nmdc:mga0qj67_37712_c1_2282_3457 | 362 |
| 506 | 3300005536 | Ga0070697_100010685 | Ga0070697_1000106857 | 363 |
| 507 | 3300003203 | JGI25406J46586_10007505 | JGI25406J46586_100075055 | 370 |
| 508 | 3300005444 | Ga0070694_100163079 | Ga0070694_1001630792 | 370 |
| 509 | 3300005577 | Ga0068857_100161268 | Ga0068857_1001612683 | 370 |
| 510 | 3300005617 | Ga0068859_100564957 | Ga0068859_1005649571 | 370 |
| 511 | 3300005719 | Ga0068861_100059001 | Ga0068861_1000590012 | 370 |
| 512 | 3300005844 | Ga0068862_100013791 | Ga0068862_1000137915 | 370 |
| 513 | 3300005985 | Ga0081539_10000605 | Ga0081539_1000060513 | 370 |
| 514 | 3300006931 | Ga0097620_100564976 | Ga0097620_1005649761 | 370 |
| 515 | 3300014326 | Ga0157380_10000337 | Ga0157380_100003378 | 370 |
| 516 | 3300021384 | Ga0213876_10000119 | Ga0213876_1000011933 | 370 |
| 517 | 3300026118 | Ga0207675_100082853 | Ga0207675_1000828532 | 370 |
| 518 | 3300005458 | Ga0070681_10102309 | Ga0070681_101023093 | 372 |
| 519 | 3300000546 | LJNas_1000658 | LJNas_10006586 | 373 |
| 520 | 3300005345 | Ga0070692_10003160 | Ga0070692_100031606 | 373 |
| 521 | 3300005406 | Ga0070703_10010129 | Ga0070703_100101294 | 373 |
| 522 | 3300005444 | Ga0070694_100004994 | Ga0070694_1000049946 | 373 |
| 523 | 3300005545 | Ga0070695_100037493 | Ga0070695_1000374933 | 373 |
| 524 | 3300005616 | Ga0068852_100051861 | Ga0068852_1000518613 | 373 |
| 525 | 3300005617 | Ga0068859_100073611 | Ga0068859_1000736113 | 373 |
| 526 | 3300005834 | Ga0068851_10003914 | Ga0068851_100039146 | 373 |
| 527 | 3300006358 | Ga0068871_100195163 | Ga0068871_1001951633 | 373 |
| 528 | 3300006844 | Ga0075428_100004203 | Ga0075428_1000042034 | 373 |
| 529 | 3300006852 | Ga0075433_10081503 | Ga0075433_100815034 | 373 |
| 530 | 3300006871 | Ga0075434_100092930 | Ga0075434_1000929302 | 373 |
| 531 | 3300006931 | Ga0097620_100073606 | Ga0097620_1000736063 | 373 |
| 532 | 3300009147 | Ga0114129_10043369 | Ga0114129_100433699 | 373 |
| 533 | 3300009545 | Ga0105237_10004306 | Ga0105237_1000430615 | 373 |
| 534 | 3300047471 | Ga0495684_0126427 | Ga0495684_0126427_247_1434 | 373 |
| 535 | 3300050508 | nmdc:mga09592_104155_c1 | nmdc:mga09592_104155_c1_1110_2297 | 373 |
| 536 | 3300050515 | nmdc:mga0a205_222245_c1 | nmdc:mga0a205_222245_c1_77_1264 | 373 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1bne-assembly3.cif.gz_C | barnase a43c/s80c disulfide mutant | 0.8804 | 138 | 161 |
| 3b7f-assembly1.cif.gz_A | crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution | 0.8289 | 2 | 373 |
| 3b7f-assembly1.cif.gz_A | crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution | 0.8137 | 2 | 373 |
| 6qfb-assembly2.cif.gz_C-3 | structure of the human atp citrate lyase holoenzyme in complex with citrate, coenzyme a and mg.adp | 0.7833 | 2 | 19 |
| 7s0u-assembly1.cif.gz_B | prmt5/mep50 crystal structure with mta and phthalazinone fragment bound | 0.7768 | 5 | 298 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3b7fA00 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8211 | 1 | 373 | 2.130.10.10 |
| 3b7fA00 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8102 | 1 | 373 | 2.130.10.10 |
| 1noyB01 | Alpha Beta;2-Layer Sandwich;DNA Polymerase; Chain A, domain 1;DNA Polymerase, chain B, domain 1 | 0.7547 | 36 | 68 | 3.30.342.10 |
| af_A0A0P0X1D1_62_249_2.130.10.30 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II | 0.7532 | 183 | 329 | 2.130.10.30 |
| af_Q54CB5_1782_1989_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7435 | 36 | 320 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535EHK9-F1-model_v4 | Exo-alpha-sialidase | 0.9855 | 1 | 323 |
GO:0000272
GO:0010411 GO:0016798 |
| AF-A0A535EHK9-F1-model_v4 | Exo-alpha-sialidase | 0.9822 | 1 | 323 |
GO:0000272
GO:0010411 GO:0016798 |
| AF-A0A2V8B9L8-F1-model_v4 | Exo-alpha-sialidase | 0.9768 | 1 | 253 |
GO:0000272
GO:0010411 GO:0016798 |
| AF-A0A838S5Q7-F1-model_v4 | Exo-alpha-sialidase | 0.9734 | 1 | 270 |
GO:0000272
GO:0010411 GO:0016798 |
| AF-A0A2V8B9L8-F1-model_v4 | Exo-alpha-sialidase | 0.9727 | 1 | 253 |
GO:0000272
GO:0010411 GO:0016798 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar