F460772

General Info

Members Datasets Scaffolds Average Seq Length
536 282 534 353

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10060682|Ga0111539_100606822
Length 395
Sequence LTFTYVTGKPTGHDSQKENHMSAVRVLVGTKKGAFICSADAKRQKWEVSGPLFGGWEVYHMKGSPSDPNRIYASQSSGWFGQIIQRSDDGGKSWNTPGTPSEPTTGASTEGMPKGESNKFVYDTSPKTGKPLTTHQWYDGTQHPWEFKRVWHLEPSLSDANTVYAGVEDAAFFKTTDGGKNWQEMAGLRAAHGDKWSPGAGGLGLHTILIDPTNPNRMYIAISAAGAFRTDDGGKTWKPINKGLKSEYIPDPDAPVGHCVHRIALHKSKPGTLYMQKHWDVMRTDDAGENWREVSGNLPSDFGFPIDVHAHEPETIYVVPITSDSLHYPPEGKLRVYRSKTGGGEWEPLTRGLPQKDCYVNVLRDAMAVDQLPDCGVYFGTTGGAVLSVEVQTLK

Samples

Sample ID Description Type Environment
1 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
2 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
198 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
279 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
280 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.83
Metatranscriptomes 2.8
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 3.92
Rhizosphere 92.91
Stem 0
Stem Tuber 0
Unclassified 2.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000658 3300000546 Bacteria 5820
2 JGI25406J46586_10000459 3300003203 Bacteria 19008
3 JGI25406J46586_10007505 3300003203 Bacteria 4972
4 Ga0058863_10054814 3300004799 Bacteria 3565
5 Ga0058863_11370755 3300004799 Bacteria 1569
6 Ga0058863_11897541 3300004799 Bacteria 2599
7 Ga0065712_10003594 3300005290 Bacteria 5224
8 Ga0065712_10009242 3300005290 Bacteria 3598
9 Ga0065715_10023999 3300005293 Bacteria 1534
10 Ga0070658_10000510 3300005327 Bacteria 33665
11 Ga0070683_100002619 3300005329 Bacteria 14392
12 Ga0070683_100003346 3300005329 Bacteria 12977
13 Ga0070683_100020451 3300005329 Bacteria 5891
14 Ga0070683_100047912 3300005329 Bacteria 3950
15 Ga0070683_100071483 3300005329 Bacteria 3238
16 Ga0070683_100253386 3300005329 Bacteria 1674
17 Ga0070670_100003002 3300005331 Bacteria 13969
18 Ga0068869_100045274 3300005334 Bacteria 3167
19 Ga0070666_10040313 3300005335 Bacteria 3116
20 Ga0070680_100002142 3300005336 Bacteria 14595
21 Ga0070680_100012985 3300005336 Bacteria 6480
22 Ga0070680_100120058 3300005336 Bacteria 2194
23 Ga0068868_100007159 3300005338 Bacteria 7928
24 Ga0070660_100176016 3300005339 Bacteria 1730
25 Ga0070661_100138589 3300005344 Bacteria 1832
26 Ga0070661_100184413 3300005344 Bacteria 1589
27 Ga0070692_10003160 3300005345 Bacteria 6614
28 Ga0070669_100028562 3300005353 Bacteria 4017
29 Ga0070669_100156518 3300005353 Bacteria 1768
30 Ga0070669_100243346 3300005353 Bacteria 1430
31 Ga0070675_100065250 3300005354 Bacteria 3010
32 Ga0070671_100000636 3300005355 Bacteria 25081
33 Ga0070674_100056331 3300005356 Bacteria 2726
34 Ga0070659_100000459 3300005366 Bacteria 30099
35 Ga0070703_10010129 3300005406 Bacteria 2659
36 Ga0070709_10004736 3300005434 Bacteria 7347
37 Ga0070709_10169299 3300005434 Bacteria 1525
38 Ga0070709_10208824 3300005434 Bacteria 1387
39 Ga0070714_100000518 3300005435 Bacteria 27963
40 Ga0070714_100002057 3300005435 Bacteria 14737
41 Ga0070714_100006827 3300005435 Bacteria 8847
42 Ga0070713_100008151 3300005436 Bacteria 7418
43 Ga0070713_100097811 3300005436 Bacteria 2537
44 Ga0070713_100145571 3300005436 Bacteria 2103
45 Ga0070711_100153055 3300005439 Bacteria 1741
46 Ga0070694_100004994 3300005444 Bacteria 7999
47 Ga0070694_100163079 3300005444 Bacteria 1637
48 Ga0070708_100010165 3300005445 Bacteria 7617
49 Ga0070708_100012271 3300005445 Bacteria 6985
50 Ga0070663_100001910 3300005455 Bacteria 11634
51 Ga0070678_100017468 3300005456 Bacteria 4621
52 Ga0070678_100101563 3300005456 Bacteria 2230
53 Ga0070681_10000546 3300005458 Bacteria 31019
54 Ga0070681_10002810 3300005458 Bacteria 16070
55 Ga0070681_10045579 3300005458 Bacteria 4387
56 Ga0070681_10056462 3300005458 Bacteria 3907
57 Ga0070681_10102309 3300005458 Bacteria 2810
58 Ga0070681_10147147 3300005458 Bacteria 2284
59 Ga0070706_100000403 3300005467 Bacteria 52164
60 Ga0070706_100000475 3300005467 Bacteria 47520
61 Ga0070706_100019605 3300005467 Bacteria 6239
62 Ga0070707_100003950 3300005468 Bacteria 13959
63 Ga0070707_100006419 3300005468 Bacteria 10932
64 Ga0070707_100042080 3300005468 Bacteria 4373
65 Ga0070707_100213726 3300005468 Bacteria 1879
66 Ga0070698_100003778 3300005471 Bacteria 16634
67 Ga0070698_100006375 3300005471 Bacteria 12809
68 Ga0070698_100009744 3300005471 Bacteria 10268
69 Ga0070698_100061184 3300005471 Bacteria 3799
70 Ga0070699_100031616 3300005518 Bacteria 4570
71 Ga0070699_100041319 3300005518 Bacteria 3992
72 Ga0070699_100132426 3300005518 Bacteria 2198
73 Ga0070679_100000514 3300005530 Bacteria 32919
74 Ga0070679_100000557 3300005530 Bacteria 31630
75 Ga0070679_100131498 3300005530 Bacteria 2484
76 Ga0070684_100000424 3300005535 Bacteria 29037
77 Ga0070684_100002528 3300005535 Bacteria 13494
78 Ga0070697_100006899 3300005536 Bacteria 8826
79 Ga0070697_100010685 3300005536 Bacteria 7165
80 Ga0070697_100045968 3300005536 Bacteria 3539
81 Ga0068853_100000204 3300005539 Bacteria 41777
82 Ga0068853_100003979 3300005539 Bacteria 11358
83 Ga0068853_100004688 3300005539 Bacteria 10604
84 Ga0070695_100037493 3300005545 Bacteria 3056
85 Ga0070695_100251515 3300005545 Bacteria 1286
86 Ga0070665_100345479 3300005548 Bacteria 1493
87 Ga0068855_100024898 3300005563 Bacteria 7161
88 Ga0068855_100047335 3300005563 Bacteria 5080
89 Ga0068857_100001981 3300005577 Bacteria 16573
90 Ga0068857_100112753 3300005577 Bacteria 2445
91 Ga0068857_100161268 3300005577 Bacteria 2035
92 Ga0068854_100000081 3300005578 Bacteria 68807
93 Ga0068856_100107772 3300005614 Bacteria 2782
94 Ga0068852_100023381 3300005616 Bacteria 4974
95 Ga0068852_100051861 3300005616 Bacteria 3524
96 Ga0068859_100073611 3300005617 Bacteria 3455
97 Ga0068859_100146451 3300005617 Bacteria 2437
98 Ga0068859_100564957 3300005617 Bacteria 1232
99 Ga0068861_100059001 3300005719 Bacteria 2936
100 Ga0068851_10003914 3300005834 Bacteria 6667
101 Ga0068858_100005594 3300005842 Bacteria 12291
102 Ga0068862_100013791 3300005844 Bacteria 6698
103 Ga0081455_10169376 3300005937 Bacteria 1665
104 Ga0081539_10000605 3300005985 Bacteria 72953
105 Ga0081539_10014701 3300005985 Bacteria 5757
106 Ga0070717_10000194 3300006028 Bacteria 43030
107 Ga0070717_10010237 3300006028 Bacteria 7066
108 Ga0070717_10082230 3300006028 Bacteria 2706
109 Ga0070715_10007474 3300006163 Bacteria 3764
110 Ga0070715_10049125 3300006163 Bacteria 1807
111 Ga0075366_10123088 3300006195 Unclassified 1564
112 Ga0068871_100034486 3300006358 Bacteria 4016
113 Ga0068871_100195163 3300006358 Bacteria 1745
114 Ga0075428_100004203 3300006844 Bacteria 15860
115 Ga0075428_100013256 3300006844 Bacteria 9171
116 Ga0075428_100032244 3300006844 Bacteria 5787
117 Ga0075430_100014515 3300006846 Bacteria 6710
118 Ga0075431_100005811 3300006847 Bacteria 12208
119 Ga0075431_100027132 3300006847 Bacteria 5874
120 Ga0075431_100095378 3300006847 Bacteria 3071
121 Ga0075433_10072176 3300006852 Bacteria 3035
122 Ga0075433_10081503 3300006852 Bacteria 2853
123 Ga0075434_100092930 3300006871 Bacteria 3019
124 Ga0075429_100002325 3300006880 Bacteria 15963
125 Ga0097620_100073606 3300006931 Bacteria 3455
126 Ga0097620_100146445 3300006931 Bacteria 2437
127 Ga0097620_100564976 3300006931 Bacteria 1232
128 Ga0075435_100065793 3300007076 Bacteria 2947
129 Ga0105240_10006804 3300009093 Bacteria 16718
130 Ga0105240_10008376 3300009093 Bacteria 14797
131 Ga0105240_10012369 3300009093 Bacteria 11785
132 Ga0111539_10060682 3300009094 Bacteria 4481
133 Ga0111539_10290463 3300009094 Bacteria 1903
134 Ga0114129_10037159 3300009147 Bacteria 6876
135 Ga0114129_10043369 3300009147 Bacteria 6328
136 Ga0114129_10308145 3300009147 Bacteria 2109
137 Ga0105241_10002200 3300009174 Bacteria 14670
138 Ga0105248_10003617 3300009177 Bacteria 17149
139 Ga0105248_10310836 3300009177 Bacteria 1775
140 Ga0105237_10004257 3300009545 Bacteria 16655
141 Ga0105237_10004306 3300009545 Bacteria 16505
142 Ga0105237_10036271 3300009545 Bacteria 4988
143 Ga0105238_10003016 3300009551 Bacteria 16812
144 Ga0105238_10070087 3300009551 Bacteria 3506
145 Ga0105239_10001126 3300010375 Bacteria 36867
146 Ga0105246_10221151 3300011119 Bacteria 1484
147 Ga0157370_10008156 3300013104 Bacteria 11327
148 Ga0157370_10018606 3300013104 Bacteria 6984
149 Ga0157369_10002662 3300013105 Bacteria 21319
150 Ga0157369_10049641 3300013105 Bacteria 4548
151 Ga0157369_10088717 3300013105 Bacteria 3302
152 Ga0157374_10257303 3300013296 Bacteria 1719
153 Ga0157372_10000871 3300013307 Bacteria 32767
154 Ga0157372_10020715 3300013307 Bacteria 7097
155 Ga0157372_10063957 3300013307 Bacteria 4127
156 Ga0157372_10166847 3300013307 Bacteria 2546
157 Ga0157380_10000337 3300014326 Bacteria 27979
158 Ga0157376_10258515 3300014969 Bacteria 1630
159 Ga0163161_10104621 3300017792 Bacteria 2110
160 Ga0163161_10107883 3300017792 Bacteria 2079
161 Ga0197907_10291974 3300020069 Bacteria 3416
162 Ga0197907_10511865 3300020069 Bacteria 1725
163 Ga0206356_10262640 3300020070 Bacteria 2063
164 Ga0206352_10240072 3300020078 Bacteria 3873
165 Ga0206352_11239808 3300020078 Bacteria 1453
166 Ga0206350_10169733 3300020080 Bacteria 3125
167 Ga0206354_10022903 3300020081 Bacteria 1596
168 Ga0206353_11681877 3300020082 Bacteria 2940
169 Ga0213876_10000119 3300021384 Bacteria 85523
170 Ga0213875_10057493 3300021388 Bacteria 1822
171 Ga0224712_10000486 3300022467 Bacteria 7964
172 Ga0224712_10025647 3300022467 Bacteria 2074
173 Ga0224712_10039947 3300022467 Bacteria 1762
174 Ga0224712_10059171 3300022467 Bacteria 1520
175 Ga0207699_10009049 3300025906 Bacteria 4942
176 Ga0207699_10015355 3300025906 Bacteria 3975
177 Ga0207643_10012368 3300025908 Bacteria 4613
178 Ga0207705_10008937 3300025909 Bacteria 7296
179 Ga0207684_10000031 3300025910 Bacteria 296401
180 Ga0207684_10000281 3300025910 Bacteria 74030
181 Ga0207684_10003088 3300025910 Bacteria 16449
182 Ga0207684_10436516 3300025910 Bacteria 1125
183 Ga0207654_10007780 3300025911 Bacteria 5409
184 Ga0207707_10000774 3300025912 Bacteria 31479
185 Ga0207707_10003775 3300025912 Bacteria 13426
186 Ga0207695_10001737 3300025913 Bacteria 34673
187 Ga0207695_10148659 3300025913 Bacteria 2284
188 Ga0207695_10255433 3300025913 Bacteria 1651
189 Ga0207671_10009523 3300025914 Bacteria 8112
190 Ga0207693_10103392 3300025915 Bacteria 2234
191 Ga0207663_10043154 3300025916 Bacteria 2759
192 Ga0207660_10001846 3300025917 Bacteria 14129
193 Ga0207660_10134637 3300025917 Bacteria 1884
194 Ga0207657_10005473 3300025919 Bacteria 13256
195 Ga0207657_10077123 3300025919 Bacteria 2810
196 Ga0207649_10109125 3300025920 Bacteria 1846
197 Ga0207652_10000566 3300025921 Bacteria 37275
198 Ga0207652_10220754 3300025921 Bacteria 1708
199 Ga0207646_10000043 3300025922 Bacteria 184713
200 Ga0207646_10000096 3300025922 Bacteria 117197
201 Ga0207646_10000145 3300025922 Bacteria 96479
202 Ga0207646_10000954 3300025922 Bacteria 37245
203 Ga0207646_10005468 3300025922 Bacteria 13354
204 Ga0207646_10007955 3300025922 Bacteria 10697
205 Ga0207646_10169065 3300025922 Bacteria 1974
206 Ga0207681_10240955 3300025923 Bacteria 1408
207 Ga0207694_10002225 3300025924 Bacteria 15919
208 Ga0207659_10048848 3300025926 Bacteria 2999
209 Ga0207659_10166158 3300025926 Bacteria 1737
210 Ga0207700_10003895 3300025928 Bacteria 8712
211 Ga0207700_10009798 3300025928 Bacteria 6008
212 Ga0207700_10023650 3300025928 Bacteria 4242
213 Ga0207700_10025491 3300025928 Bacteria 4107
214 Ga0207700_10089634 3300025928 Bacteria 2425
215 Ga0207664_10002658 3300025929 Bacteria 11851
216 Ga0207664_10002687 3300025929 Bacteria 11799
217 Ga0207664_10003470 3300025929 Bacteria 10518
218 Ga0207664_10123351 3300025929 Bacteria 2171
219 Ga0207644_10003541 3300025931 Bacteria 10108
220 Ga0207644_10194540 3300025931 Bacteria 1596
221 Ga0207690_10000312 3300025932 Bacteria 32887
222 Ga0207669_10080589 3300025937 Bacteria 2082
223 Ga0207704_10092975 3300025938 Bacteria 1986
224 Ga0207665_10125188 3300025939 Bacteria 1819
225 Ga0207691_10001347 3300025940 Bacteria 24493
226 Ga0207711_10320864 3300025941 Bacteria 1431
227 Ga0207689_10056751 3300025942 Bacteria 3222
228 Ga0207661_10013348 3300025944 Bacteria 6000
229 Ga0207661_10077520 3300025944 Bacteria 2733
230 Ga0207661_10214746 3300025944 Bacteria 1697
231 Ga0207667_10000797 3300025949 Bacteria 40904
232 Ga0207667_10060293 3300025949 Bacteria 3971
233 Ga0207640_10000019 3300025981 Bacteria 185255
234 Ga0207640_10123544 3300025981 Bacteria 1859
235 Ga0207703_10003930 3300026035 Bacteria 12330
236 Ga0207639_10000120 3300026041 Bacteria 59978
237 Ga0207639_10007749 3300026041 Bacteria 7336
238 Ga0207639_10024662 3300026041 Bacteria 4356
239 Ga0207678_10004212 3300026067 Bacteria 12909
240 Ga0207648_10392760 3300026089 Bacteria 1256
241 Ga0207674_10000995 3300026116 Bacteria 36986
242 Ga0207674_10118480 3300026116 Bacteria 2617
243 Ga0207675_100022020 3300026118 Bacteria 5932
244 Ga0207675_100071116 3300026118 Bacteria 3252
245 Ga0207675_100082853 3300026118 Bacteria 3008
246 Ga0207683_10008581 3300026121 Bacteria 8747
247 Ga0207683_10215252 3300026121 Bacteria 1750
248 Ga0207698_10009002 3300026142 Bacteria 6339
249 Ga0207698_10064505 3300026142 Bacteria 2871
250 Ga0207428_10000144 3300027907 Bacteria 96684
251 Ga0207428_10144972 3300027907 Bacteria 1810
252 Ga0268265_10155054 3300028380 Bacteria 1937
253 Ga0265338_10122182 3300028800 Bacteria 2073
254 Ga0265338_10129377 3300028800 Bacteria 1997
255 Ga0265338_10136743 3300028800 Bacteria 1925
256 Ga0265325_10067336 3300031241 Bacteria 1804
257 Ga0265340_10051722 3300031247 Bacteria 1988
258 Ga0265327_10005424 3300031251 Bacteria 10635
259 Ga0265342_10040407 3300031712 Bacteria 2829
260 Ga0265342_10157057 3300031712 Bacteria 1259
261 Ga0307416_100094864 3300032002 Bacteria 2574
262 Ga0307414_10113899 3300032004 Bacteria 2065
263 Ga0307415_100051906 3300032126 Bacteria 2786
264 Ga0307510_10069741 3300033180 Bacteria 3518
265 Ga0373926_0002829 3300035083 Bacteria 5550
266 Ga0373926_0004836 3300035083 Bacteria 4428
267 Ga0373934_0000873 3300035086 Bacteria 10874
268 Ga0373934_0040810 3300035086 Bacteria 1831
269 Ga0373944_0000495 3300035089 Bacteria 9161
270 Ga0373923_0052193 3300035111 Bacteria 1717
271 Ga0373923_0062679 3300035111 Bacteria 1582
272 Ga0373936_0000130 3300035113 Bacteria 26133
273 Ga0373936_0009723 3300035113 Bacteria 3627
274 Ga0373945_0000149 3300035116 Bacteria 17816
275 Ga0373945_0074926 3300035116 Bacteria 1287
276 Ga0373953_0027173 3300035117 Bacteria 2197
277 Ga0373956_0002520 3300035119 Bacteria 7452
278 Ga0373956_0029434 3300035119 Bacteria 2395
279 Ga0373956_0035423 3300035119 Bacteria 2201
280 Ga0373957_0016094 3300035120 Bacteria 2584
281 Ga0373943_0000215 3300035170 Bacteria 23592
282 Ga0373943_0005403 3300035170 Bacteria 5749
283 Ga0373943_0022310 3300035170 Bacteria 2932
284 Ga0373946_0000093 3300035171 Bacteria 24751
285 Ga0373955_0023064 3300035172 Bacteria 3166
286 Ga0373955_0133535 3300035172 Bacteria 1450
287 Ga0373924_0005835 3300035410 Bacteria 4383
288 Ga0373935_0000437 3300035692 Bacteria 21735
289 Ga0373935_0001066 3300035692 Bacteria 14950
290 Ga0373935_0009441 3300035692 Bacteria 5836
291 Ga0373927_0001407 3300035695 Bacteria 18138
292 Ga0373933_0012242 3300035724 Bacteria 4738
293 Ga0373933_0023812 3300035724 Bacteria 3501
294 Ga0373933_0032261 3300035724 Bacteria 3043
295 Ga0373933_0038769 3300035724 Bacteria 2801
296 Ga0373947_0000281 3300035725 Bacteria 28827
297 Ga0373937_0000631 3300036401 Bacteria 30842
298 Ga0373937_0015324 3300036401 Bacteria 6779
299 Ga0373937_0018872 3300036401 Bacteria 6164
300 Ga0373937_0062469 3300036401 Bacteria 3424
301 Ga0373937_0081661 3300036401 Bacteria 2991
302 Ga0373925_0000938 3300037068 Bacteria 26552
303 Ga0373925_0002793 3300037068 Bacteria 13796
304 Ga0373925_0003908 3300037068 Bacteria 11384
305 Ga0373925_0010852 3300037068 Bacteria 6607
306 Ga0395899_0000734 3300037312 Bacteria 32689
307 Ga0395899_0003022 3300037312 Bacteria 13432
308 Ga0395899_0092459 3300037312 Bacteria 2191
309 Ga0395900_0004531 3300037418 Bacteria 14705
310 Ga0395900_0036668 3300037418 Bacteria 5055
311 Ga0395900_0042794 3300037418 Bacteria 4666
312 Ga0395900_0170740 3300037418 Bacteria 2214
313 Ga0395898_0005154 3300037466 Bacteria 14140
314 Ga0395898_0032668 3300037466 Bacteria 5195
315 Ga0395905_0022257 3300037471 Bacteria 5998
316 Ga0436364_0319228 3300037853 Bacteria 2916
317 Ga0436364_0653358 3300037853 Bacteria 4814
318 Ga0436364_1022225 3300037853 Bacteria 5377
319 Ga0436364_1214168 3300037853 Bacteria 4658
320 Ga0395901_0000376 3300038443 Bacteria 53640
321 Ga0395901_0005500 3300038443 Bacteria 12835
322 Ga0436365_0592662 3300039437 Bacteria 3849
323 Ga0436365_0682928 3300039437 Bacteria 6236
324 Ga0436365_1483147 3300039437 Bacteria 1746
325 Ga0436361_0464657 3300039447 Bacteria 5608
326 Ga0436361_1032002 3300039447 Bacteria 1518
327 Ga0436361_1111202 3300039447 Bacteria 1710
328 Ga0436363_0157307 3300039450 Bacteria 3552
329 Ga0436363_0209627 3300039450 Unclassified 2119
330 Ga0436362_0104738 3300039453 Bacteria 2138
331 Ga0453683_0002195 3300044673 Bacteria 15518
332 Ga0466966_0003787 3300044684 Bacteria 9978
333 Ga0466963_0271619 3300044694 Bacteria 1191
334 Ga0453684_0001473 3300044712 Bacteria 66422
335 Ga0453684_0284408 3300044712 Bacteria 1885
336 Ga0466970_0030341 3300044765 Bacteria 2851
337 Ga0466959_0109125 3300045049 Bacteria 1976
338 Ga0451576_0012980 3300045051 Bacteria 9336
339 Ga0451576_0125243 3300045051 Bacteria 2677
340 Ga0466958_0213996 3300045836 Bacteria 1229
341 Ga0466967_0224492 3300045976 Bacteria 1786
342 Ga0466967_0522613 3300045976 Bacteria 1166
343 Ga0495603_0000150 3300046455 Bacteria 34573
344 Ga0495629_0200629 3300046459 Bacteria 1379
345 Ga0495641_0034092 3300046461 Bacteria 2409
346 Ga0495641_0045600 3300046461 Bacteria 2018
347 Ga0495651_0005897 3300046462 Bacteria 9345
348 Ga0495651_0010002 3300046462 Bacteria 7291
349 Ga0495651_0157367 3300046462 Bacteria 1631
350 Ga0495651_0160903 3300046462 Bacteria 1608
351 Ga0495653_0000632 3300046463 Bacteria 26856
352 Ga0495653_0018969 3300046463 Bacteria 5582
353 Ga0495653_0114125 3300046463 Bacteria 1936
354 Ga0495580_0052503 3300046472 Bacteria 2879
355 Ga0495580_0155157 3300046472 Bacteria 1585
356 Ga0495582_0016388 3300046473 Bacteria 4060
357 Ga0495639_0002384 3300046475 Bacteria 8213
358 Ga0495639_0016341 3300046475 Bacteria 3222
359 Ga0495664_0000201 3300046477 Bacteria 28936
360 Ga0495664_0024014 3300046477 Bacteria 3541
361 Ga0495664_0025253 3300046477 Bacteria 3458
362 Ga0495585_0009697 3300046492 Bacteria 5765
363 Ga0495594_0000071 3300046499 Bacteria 43649
364 Ga0495594_0001326 3300046499 Bacteria 12874
365 Ga0495594_0008374 3300046499 Bacteria 5327
366 Ga0495596_0007619 3300046500 Bacteria 4874
367 Ga0495583_0048092 3300046506 Bacteria 1959
368 Ga0495583_0063970 3300046506 Bacteria 1633
369 Ga0495608_0021357 3300046511 Bacteria 4443
370 Ga0495608_0090523 3300046511 Bacteria 1979
371 Ga0495618_0015458 3300046514 Bacteria 4660
372 Ga0495628_0024439 3300046516 Bacteria 4946
373 Ga0495630_0011532 3300046517 Bacteria 6400
374 Ga0495630_0012714 3300046517 Bacteria 6117
375 Ga0495630_0024804 3300046517 Bacteria 4433
376 Ga0495630_0119925 3300046517 Bacteria 1995
377 Ga0495631_0084778 3300046518 Bacteria 1365
378 Ga0495644_0000059 3300046523 Bacteria 53320
379 Ga0495666_0007409 3300046526 Bacteria 5501
380 Ga0495652_0150611 3300046529 Bacteria 1818
381 Ga0495665_0000700 3300046531 Bacteria 17258
382 Ga0495665_0002287 3300046531 Bacteria 10350
383 Ga0495640_0009380 3300046533 Bacteria 7620
384 Ga0495640_0014685 3300046533 Bacteria 5915
385 Ga0495587_0000289 3300046536 Bacteria 35652
386 Ga0495587_0065305 3300046536 Bacteria 2125
387 Ga0495587_0138060 3300046536 Bacteria 1392
388 Ga0495609_0036538 3300046538 Bacteria 2217
389 Ga0495645_0098903 3300046543 Bacteria 2076
390 Ga0495622_0061852 3300046557 Bacteria 1733
391 Ga0495667_0003309 3300046559 Bacteria 10795
392 Ga0495667_0011555 3300046559 Bacteria 5977
393 Ga0495667_0088085 3300046559 Bacteria 2012
394 Ga0495611_0011935 3300046648 Bacteria 3690
395 Ga0495625_0006612 3300046660 Bacteria 10291
396 Ga0495625_0023217 3300046660 Bacteria 4740
397 Ga0495635_0000377 3300046663 Bacteria 28228
398 Ga0495635_0006693 3300046663 Bacteria 8052
399 Ga0495635_0011741 3300046663 Bacteria 6142
400 Ga0495635_0191159 3300046663 Bacteria 1390
401 Ga0495588_0001897 3300046674 Bacteria 8923
402 Ga0495657_0102053 3300046675 Bacteria 1826
403 Ga0495599_0011886 3300046678 Bacteria 5356
404 Ga0495599_0062564 3300046678 Bacteria 2325
405 Ga0495623_0052130 3300046679 Bacteria 2586
406 Ga0495623_0062298 3300046679 Bacteria 2338
407 Ga0495623_0111532 3300046679 Bacteria 1657
408 Ga0495646_0014543 3300046680 Bacteria 5001
409 Ga0495646_0098447 3300046680 Bacteria 1680
410 Ga0495658_0001571 3300046683 Bacteria 11915
411 Ga0495658_0047774 3300046683 Bacteria 2411
412 Ga0495669_0012957 3300046684 Bacteria 3551
413 Ga0495613_0002408 3300046689 Bacteria 14147
414 Ga0495613_0003274 3300046689 Bacteria 12112
415 Ga0495613_0029923 3300046689 Bacteria 4046
416 Ga0495613_0040700 3300046689 Bacteria 3442
417 Ga0495613_0175172 3300046689 Bacteria 1521
418 Ga0495624_0086628 3300046690 Bacteria 1934
419 Ga0495589_0077885 3300046794 Bacteria 1615
420 Ga0495600_0002144 3300046809 Bacteria 11183
421 Ga0495600_0074171 3300046809 Bacteria 2221
422 Ga0495581_0009887 3300047315 Bacteria 5518
423 Ga0495604_0009078 3300047317 Bacteria 7866
424 Ga0495604_0020529 3300047317 Bacteria 5276
425 Ga0495674_0001255 3300047319 Bacteria 24635
426 Ga0495674_0012606 3300047319 Bacteria 7965
427 Ga0495674_0062901 3300047319 Bacteria 3230
428 Ga0495674_0094297 3300047319 Bacteria 2553
429 Ga0495676_0001118 3300047321 Bacteria 22768
430 Ga0495676_0008030 3300047321 Bacteria 9675
431 Ga0495680_0006058 3300047322 Bacteria 11305
432 Ga0495680_0033646 3300047322 Bacteria 4147
433 Ga0495680_0039529 3300047322 Bacteria 3762
434 Ga0495680_0046181 3300047322 Bacteria 3435
435 Ga0495680_0067967 3300047322 Bacteria 2723
436 Ga0495683_0085285 3300047323 Bacteria 1536
437 Ga0495675_0072513 3300047444 Bacteria 2172
438 Ga0495675_0073571 3300047444 Bacteria 2155
439 Ga0495677_0046642 3300047445 Bacteria 1590
440 Ga0495684_0008447 3300047471 Bacteria 7975
441 Ga0495684_0027510 3300047471 Bacteria 4366
442 Ga0495684_0110168 3300047471 Bacteria 2078
443 Ga0495684_0126427 3300047471 Bacteria 1923
444 Ga0495684_0132989 3300047471 Bacteria 1867
445 Ga0495686_0000035 3300047472 Bacteria 314930
446 Ga0495602_0008192 3300048088 Bacteria 10919
447 Ga0495602_0032220 3300048088 Bacteria 4939
448 Ga0495602_0111235 3300048088 Bacteria 2224
449 Ga0495602_0185991 3300048088 Bacteria 1597
450 Ga0495614_0000914 3300048089 Bacteria 12582
451 Ga0496104_0000137 3300048907 Bacteria 67856
452 Ga0496104_0016151 3300048907 Bacteria 6775
453 Ga0496104_0023708 3300048907 Bacteria 5643
454 Ga0496105_0001487 3300048908 Bacteria 16545
455 Ga0496108_0036508 3300048911 Bacteria 4089
456 Ga0496109_0003051 3300048912 Bacteria 13958
457 Ga0496109_0019349 3300048912 Bacteria 6002
458 Ga0496110_0036628 3300048913 Bacteria 4261
459 Ga0496110_0037020 3300048913 Bacteria 4239
460 Ga0496110_0124198 3300048913 Bacteria 2328
461 Ga0496110_0450383 3300048913 Bacteria 1173
462 Ga0496111_0239216 3300048914 Bacteria 1348
463 Ga0496112_0007149 3300048915 Bacteria 9882
464 Ga0496112_0009522 3300048915 Bacteria 8761
465 Ga0496112_0206794 3300048915 Bacteria 1921
466 Ga0496113_0011681 3300048916 Bacteria 5874
467 Ga0496113_0075926 3300048916 Bacteria 2566
468 Ga0496114_0058637 3300048917 Bacteria 3215
469 Ga0496114_0195605 3300048917 Bacteria 1770
470 Ga0496115_0067633 3300048918 Bacteria 2890
471 Ga0496115_0259464 3300048918 Bacteria 1429
472 Ga0496126_0000020 3300048929 Bacteria 490805
473 Ga0501031_0008717 3300049568 Bacteria 6595
474 Ga0501032_0000463 3300049569 Bacteria 32728
475 Ga0501033_0019994 3300049570 Bacteria 5060
476 Ga0501034_0005208 3300049571 Bacteria 14269
477 Ga0501034_0006548 3300049571 Bacteria 12510
478 Ga0501034_0008653 3300049571 Bacteria 10736
479 Ga0501036_0003645 3300049572 Bacteria 12314
480 Ga0501036_0004808 3300049572 Bacteria 10918
481 Ga0501037_0000073 3300049573 Bacteria 93756
482 Ga0501037_0016891 3300049573 Bacteria 5370
483 Ga0501037_0060753 3300049573 Bacteria 2757
484 Ga0501038_0008187 3300049574 Bacteria 9616
485 Ga0501039_0044212 3300049575 Bacteria 3440
486 Ga0501042_0012676 3300049578 Bacteria 5720
487 Ga0501042_0078418 3300049578 Bacteria 2366
488 Ga0501042_0139472 3300049578 Bacteria 1748
489 Ga0501043_0002327 3300049579 Bacteria 16093
490 Ga0501043_0072027 3300049579 Bacteria 2714
491 Ga0501046_0000091 3300049580 Bacteria 98095
492 Ga0501047_0000929 3300049581 Bacteria 29943
493 Ga0501047_0001874 3300049581 Bacteria 20248
494 Ga0501047_0002031 3300049581 Bacteria 19353
495 Ga0501048_0008299 3300049582 Bacteria 7857
496 Ga0501067_0019729 3300049583 Bacteria 3731
497 Ga0501068_0046929 3300049584 Bacteria 2605
498 Ga0501069_0029958 3300049585 Bacteria 2987
499 Ga0501070_0079441 3300049586 Bacteria 2715
500 Ga0501073_0007003 3300049589 Bacteria 8401
501 Ga0501073_0077052 3300049589 Bacteria 2320
502 Ga0501074_0006347 3300049590 Bacteria 8539
503 Ga0501076_0272211 3300049592 Bacteria 1387
504 Ga0501083_0003972 3300049744 Bacteria 10385
505 Ga0501035_0001860 3300049822 Bacteria 21260
506 Ga0501035_0006266 3300049822 Bacteria 11186
507 Ga0501044_0000769 3300049823 Bacteria 38869
508 Ga0501044_0000946 3300049823 Bacteria 34826
509 Ga0501044_0066566 3300049823 Bacteria 3672
510 nmdc:mga05p37_20365_c1 3300050507 Bacteria 8026
511 nmdc:mga05p37_26722_c1 3300050507 Bacteria 7019
512 nmdc:mga09592_104155_c1 3300050508 Bacteria 2431
513 nmdc:mga09592_15431_c1 3300050508 Bacteria 6241
514 nmdc:mga09592_18860_c1 3300050508 Bacteria 5659
515 nmdc:mga0qj67_37712_c1 3300050509 Bacteria 3789
516 nmdc:mga06r32_10909_c1 3300050510 Bacteria 8182
517 nmdc:mga06r32_6184_c1 3300050510 Bacteria 10747
518 nmdc:mga08y16_128717_c1 3300050511 Bacteria 1575
519 nmdc:mga08y16_421677_c1 3300050511 Bacteria 1364
520 nmdc:mga08y16_89775_c1 3300050511 Bacteria 3202
521 nmdc:mga0n895_179969_c1 3300050512 Bacteria 2146
522 nmdc:mga0n895_327323_c1 3300050512 Bacteria 1553
523 nmdc:mga0n895_86181_c1 3300050512 Bacteria 3137
524 nmdc:mga08x19_96718_c1 3300050514 Bacteria 1955
525 nmdc:mga0a205_16929_c1 3300050515 Bacteria 6826
526 nmdc:mga0a205_222245_c1 3300050515 Bacteria 1774
527 nmdc:mga0a205_6577_c1 3300050515 Bacteria 10516
528 Ga0495601_0000713 3300053077 Bacteria 17851
529 Ga0495619_0093101 3300053085 Bacteria 2043
530 Ga0500595_033209 3300053119 Bacteria 1714
531 Ga0500559_0003914 3300053136 Bacteria 7190
532 Ga0590071_001719 3300059421 Bacteria 5670
533 Ga0501082_0000448 3300060353 Bacteria 36479
534 Ga0530510_0044435 3300061734 Bacteria 3210

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005290 Ga0065712_10009242 Ga0065712_100092422 310
2 3300036401 Ga0373937_0000631 Ga0373937_0000631_19_1014 311
3 3300046516 Ga0495628_0024439 Ga0495628_0024439_19_1014 311
4 3300046517 Ga0495630_0011532 Ga0495630_0011532_3996_4991 311
5 3300049586 Ga0501070_0079441 Ga0501070_0079441_65_1060 311
6 3300025910 Ga0207684_10436516 Ga0207684_104365161 318
7 3300044673 Ga0453683_0002195 Ga0453683_0002195_8848_9915 321
8 3300005937 Ga0081455_10169376 Ga0081455_101693762 322
9 3300045051 Ga0451576_0125243 Ga0451576_0125243_23_1087 322
10 3300039447 Ga0436361_0464657 Ga0436361_0464657_4401_5435 324
11 3300037853 Ga0436364_0653358 Ga0436364_0653358_3612_4679 335
12 3300039450 Ga0436363_0209627 Ga0436363_0209627_460_1530 336
13 3300053136 Ga0500559_0003914 Ga0500559_0003914_2223_3338 336
14 3300005435 Ga0070714_100000518 Ga0070714_10000051819 339
15 3300025929 Ga0207664_10002687 Ga0207664_1000268715 339
16 3300037418 Ga0395900_0042794 Ga0395900_0042794_416_1531 340
17 3300039453 Ga0436362_0104738 Ga0436362_0104738_752_1867 340
18 3300014969 Ga0157376_10258515 Ga0157376_102585151 341
19 3300036401 Ga0373937_0062469 Ga0373937_0062469_769_1860 342
20 3300032126 Ga0307415_100051906 Ga0307415_1000519062 343
21 3300035086 Ga0373934_0040810 Ga0373934_0040810_564_1658 343
22 3300035113 Ga0373936_0009723 Ga0373936_0009723_433_1527 343
23 3300035117 Ga0373953_0027173 Ga0373953_0027173_147_1241 343
24 3300035120 Ga0373957_0016094 Ga0373957_0016094_1259_2353 343
25 3300035172 Ga0373955_0023064 Ga0373955_0023064_1876_2970 343
26 3300035172 Ga0373955_0133535 Ga0373955_0133535_196_1290 343
27 3300046463 Ga0495653_0018969 Ga0495653_0018969_4436_5530 343
28 3300046559 Ga0495667_0088085 Ga0495667_0088085_560_1654 343
29 3300046675 Ga0495657_0102053 Ga0495657_0102053_265_1359 343
30 3300046678 Ga0495599_0011886 Ga0495599_0011886_2699_3793 343
31 3300046809 Ga0495600_0074171 Ga0495600_0074171_529_1623 343
32 3300047319 Ga0495674_0094297 Ga0495674_0094297_1187_2281 343
33 3300048088 Ga0495602_0185991 Ga0495602_0185991_424_1518 343
34 3300005434 Ga0070709_10004736 Ga0070709_100047366 345
35 3300005434 Ga0070709_10169299 Ga0070709_101692992 345
36 3300005471 Ga0070698_100009744 Ga0070698_1000097448 345
37 3300005536 Ga0070697_100045968 Ga0070697_1000459683 345
38 3300005548 Ga0070665_100345479 Ga0070665_1003454792 345
39 3300005614 Ga0068856_100107772 Ga0068856_1001077723 345
40 3300006163 Ga0070715_10007474 Ga0070715_100074744 345
41 3300022467 Ga0224712_10025647 Ga0224712_100256471 345
42 3300025906 Ga0207699_10009049 Ga0207699_100090496 345
43 3300025906 Ga0207699_10015355 Ga0207699_100153554 345
44 3300025928 Ga0207700_10023650 Ga0207700_100236502 345
45 3300025929 Ga0207664_10003470 Ga0207664_100034705 345
46 3300046679 Ga0495623_0111532 Ga0495623_0111532_547_1644 345
47 3300048907 Ga0496104_0023708 Ga0496104_0023708_3739_4854 345
48 3300048908 Ga0496105_0001487 Ga0496105_0001487_5696_6811 345
49 3300048912 Ga0496109_0019349 Ga0496109_0019349_3582_4697 345
50 3300048915 Ga0496112_0009522 Ga0496112_0009522_3602_4717 345
51 3300048916 Ga0496113_0011681 Ga0496113_0011681_3920_5035 345
52 3300048918 Ga0496115_0067633 Ga0496115_0067633_1664_2779 345
53 3300049578 Ga0501042_0078418 Ga0501042_0078418_1174_2289 345
54 3300005353 Ga0070669_100028562 Ga0070669_1000285621 346
55 3300005354 Ga0070675_100065250 Ga0070675_1000652501 346
56 3300005356 Ga0070674_100056331 Ga0070674_1000563313 346
57 3300009147 Ga0114129_10308145 Ga0114129_103081452 346
58 3300011119 Ga0105246_10221151 Ga0105246_102211511 346
59 3300013296 Ga0157374_10257303 Ga0157374_102573031 346
60 3300025926 Ga0207659_10048848 Ga0207659_100488481 346
61 3300046794 Ga0495589_0077885 Ga0495589_0077885_19_1134 346
62 3300050508 nmdc:mga09592_18860_c1 nmdc:mga09592_18860_c1_2871_3971 346
63 3300050510 nmdc:mga06r32_6184_c1 nmdc:mga06r32_6184_c1_1651_2751 346
64 3300060353 Ga0501082_0000448 Ga0501082_0000448_31152_32252 346
65 iso_pu_bacteria 2832004796 2832008372 347
66 iso_pu_bacteria 2863067949 2863070446 347
67 3300037312 Ga0395899_0092459 Ga0395899_0092459_284_1390 348
68 3300037466 Ga0395898_0005154 Ga0395898_0005154_10966_12072 348
69 3300037471 Ga0395905_0022257 Ga0395905_0022257_586_1692 348
70 3300049744 Ga0501083_0003972 Ga0501083_0003972_5972_7117 348
71 3300006163 Ga0070715_10049125 Ga0070715_100491252 349
72 3300044765 Ga0466970_0030341 Ga0466970_0030341_595_1707 349
73 3300048088 Ga0495602_0111235 Ga0495602_0111235_200_1312 349
74 3300005329 Ga0070683_100071483 Ga0070683_1000714834 350
75 3300005353 Ga0070669_100243346 Ga0070669_1002433462 350
76 3300005434 Ga0070709_10208824 Ga0070709_102088241 350
77 3300005445 Ga0070708_100010165 Ga0070708_1000101656 350
78 3300005467 Ga0070706_100000403 Ga0070706_10000040345 350
79 3300005467 Ga0070706_100019605 Ga0070706_1000196055 350
80 3300005468 Ga0070707_100003950 Ga0070707_1000039506 350
81 3300005468 Ga0070707_100006419 Ga0070707_1000064196 350
82 3300005471 Ga0070698_100006375 Ga0070698_1000063752 350
83 3300005518 Ga0070699_100041319 Ga0070699_1000413192 350
84 3300005536 Ga0070697_100006899 Ga0070697_1000068995 350
85 3300006195 Ga0075366_10123088 Ga0075366_101230883 350
86 3300006358 Ga0068871_100034486 Ga0068871_1000344865 350
87 3300007076 Ga0075435_100065793 Ga0075435_1000657932 350
88 3300009545 Ga0105237_10036271 Ga0105237_100362714 350
89 3300020069 Ga0197907_10511865 Ga0197907_105118653 350
90 3300020070 Ga0206356_10262640 Ga0206356_102626403 350
91 3300020078 Ga0206352_11239808 Ga0206352_112398082 350
92 3300020082 Ga0206353_11681877 Ga0206353_116818773 350
93 3300022467 Ga0224712_10059171 Ga0224712_100591712 350
94 3300025909 Ga0207705_10008937 Ga0207705_100089375 350
95 3300025910 Ga0207684_10000031 Ga0207684_1000003192 350
96 3300025915 Ga0207693_10103392 Ga0207693_101033922 350
97 3300025916 Ga0207663_10043154 Ga0207663_100431541 350
98 3300025922 Ga0207646_10000145 Ga0207646_10000145101 350
99 3300025922 Ga0207646_10007955 Ga0207646_100079555 350
100 3300025923 Ga0207681_10240955 Ga0207681_102409551 350
101 3300025928 Ga0207700_10009798 Ga0207700_100097985 350
102 3300028380 Ga0268265_10155054 Ga0268265_101550542 350
103 3300035083 Ga0373926_0002829 Ga0373926_0002829_572_1687 350
104 3300035089 Ga0373944_0000495 Ga0373944_0000495_220_1335 350
105 3300035111 Ga0373923_0052193 Ga0373923_0052193_427_1542 350
106 3300035113 Ga0373936_0000130 Ga0373936_0000130_13218_14333 350
107 3300035116 Ga0373945_0000149 Ga0373945_0000149_14503_15618 350
108 3300035170 Ga0373943_0000215 Ga0373943_0000215_2107_3222 350
109 3300035170 Ga0373943_0022310 Ga0373943_0022310_1406_2521 350
110 3300035171 Ga0373946_0000093 Ga0373946_0000093_11801_12916 350
111 3300035410 Ga0373924_0005835 Ga0373924_0005835_126_1241 350
112 3300035692 Ga0373935_0009441 Ga0373935_0009441_2324_3439 350
113 3300035724 Ga0373933_0023812 Ga0373933_0023812_919_2034 350
114 3300035725 Ga0373947_0000281 Ga0373947_0000281_16641_17756 350
115 3300037068 Ga0373925_0000938 Ga0373925_0000938_10969_12084 350
116 3300037068 Ga0373925_0002793 Ga0373925_0002793_738_1853 350
117 3300044712 Ga0453684_0001473 Ga0453684_0001473_56476_57621 350
118 3300044712 Ga0453684_0284408 Ga0453684_0284408_36_1151 350
119 3300045051 Ga0451576_0012980 Ga0451576_0012980_5205_6434 350
120 3300045836 Ga0466958_0213996 Ga0466958_0213996_100_1212 350
121 3300045976 Ga0466967_0224492 Ga0466967_0224492_243_1358 350
122 3300046455 Ga0495603_0000150 Ga0495603_0000150_20205_21320 350
123 3300046459 Ga0495629_0200629 Ga0495629_0200629_68_1183 350
124 3300046461 Ga0495641_0034092 Ga0495641_0034092_248_1363 350
125 3300046461 Ga0495641_0045600 Ga0495641_0045600_841_1953 350
126 3300046462 Ga0495651_0010002 Ga0495651_0010002_581_1696 350
127 3300046462 Ga0495651_0157367 Ga0495651_0157367_329_1444 350
128 3300046462 Ga0495651_0160903 Ga0495651_0160903_451_1566 350
129 3300046463 Ga0495653_0000632 Ga0495653_0000632_20671_21786 350
130 3300046463 Ga0495653_0114125 Ga0495653_0114125_445_1560 350
131 3300046472 Ga0495580_0052503 Ga0495580_0052503_33_1145 350
132 3300046475 Ga0495639_0016341 Ga0495639_0016341_70_1185 350
133 3300046477 Ga0495664_0000201 Ga0495664_0000201_10440_11555 350
134 3300046477 Ga0495664_0024014 Ga0495664_0024014_1352_2464 350
135 3300046477 Ga0495664_0025253 Ga0495664_0025253_112_1227 350
136 3300046492 Ga0495585_0009697 Ga0495585_0009697_750_1865 350
137 3300046499 Ga0495594_0000071 Ga0495594_0000071_14171_15286 350
138 3300046499 Ga0495594_0001326 Ga0495594_0001326_6580_7695 350
139 3300046499 Ga0495594_0008374 Ga0495594_0008374_1566_2678 350
140 3300046500 Ga0495596_0007619 Ga0495596_0007619_2583_3698 350
141 3300046506 Ga0495583_0048092 Ga0495583_0048092_289_1404 350
142 3300046511 Ga0495608_0021357 Ga0495608_0021357_285_1400 350
143 3300046514 Ga0495618_0015458 Ga0495618_0015458_1758_2870 350
144 3300046517 Ga0495630_0024804 Ga0495630_0024804_1647_2759 350
145 3300046518 Ga0495631_0084778 Ga0495631_0084778_212_1327 350
146 3300046523 Ga0495644_0000059 Ga0495644_0000059_47563_48678 350
147 3300046526 Ga0495666_0007409 Ga0495666_0007409_3745_4860 350
148 3300046531 Ga0495665_0002287 Ga0495665_0002287_2759_3874 350
149 3300046533 Ga0495640_0009380 Ga0495640_0009380_5925_7040 350
150 3300046533 Ga0495640_0014685 Ga0495640_0014685_3132_4247 350
151 3300046543 Ga0495645_0098903 Ga0495645_0098903_308_1423 350
152 3300046557 Ga0495622_0061852 Ga0495622_0061852_121_1236 350
153 3300046559 Ga0495667_0003309 Ga0495667_0003309_184_1299 350
154 3300046648 Ga0495611_0011935 Ga0495611_0011935_1017_2132 350
155 3300046660 Ga0495625_0006612 Ga0495625_0006612_4610_5725 350
156 3300046660 Ga0495625_0023217 Ga0495625_0023217_1657_2772 350
157 3300046663 Ga0495635_0000377 Ga0495635_0000377_3864_4979 350
158 3300046663 Ga0495635_0006693 Ga0495635_0006693_3620_4735 350
159 3300046663 Ga0495635_0011741 Ga0495635_0011741_3368_4483 350
160 3300046678 Ga0495599_0062564 Ga0495599_0062564_725_1840 350
161 3300046679 Ga0495623_0062298 Ga0495623_0062298_1064_2179 350
162 3300046680 Ga0495646_0014543 Ga0495646_0014543_131_1246 350
163 3300046683 Ga0495658_0047774 Ga0495658_0047774_662_1774 350
164 3300046684 Ga0495669_0012957 Ga0495669_0012957_1896_3011 350
165 3300046689 Ga0495613_0029923 Ga0495613_0029923_1280_2395 350
166 3300046689 Ga0495613_0040700 Ga0495613_0040700_1283_2398 350
167 3300046690 Ga0495624_0086628 Ga0495624_0086628_516_1631 350
168 3300046809 Ga0495600_0002144 Ga0495600_0002144_2311_3426 350
169 3300047317 Ga0495604_0009078 Ga0495604_0009078_554_1669 350
170 3300047319 Ga0495674_0001255 Ga0495674_0001255_6777_7892 350
171 3300047319 Ga0495674_0012606 Ga0495674_0012606_2926_4041 350
172 3300047319 Ga0495674_0062901 Ga0495674_0062901_1702_2814 350
173 3300047321 Ga0495676_0001118 Ga0495676_0001118_20911_22026 350
174 3300047321 Ga0495676_0008030 Ga0495676_0008030_7979_9094 350
175 3300047322 Ga0495680_0006058 Ga0495680_0006058_7509_8624 350
176 3300047322 Ga0495680_0039529 Ga0495680_0039529_18_1133 350
177 3300047322 Ga0495680_0046181 Ga0495680_0046181_1885_3000 350
178 3300047322 Ga0495680_0067967 Ga0495680_0067967_35_1147 350
179 3300047323 Ga0495683_0085285 Ga0495683_0085285_392_1507 350
180 3300047444 Ga0495675_0072513 Ga0495675_0072513_668_1783 350
181 3300047445 Ga0495677_0046642 Ga0495677_0046642_222_1337 350
182 3300047471 Ga0495684_0110168 Ga0495684_0110168_603_1718 350
183 3300047471 Ga0495684_0132989 Ga0495684_0132989_444_1556 350
184 3300047472 Ga0495686_0000035 Ga0495686_0000035_67596_68711 350
185 3300048907 Ga0496104_0000137 Ga0496104_0000137_19524_20639 350
186 3300048917 Ga0496114_0058637 Ga0496114_0058637_1255_2370 350
187 3300049573 Ga0501037_0060753 Ga0501037_0060753_904_2016 350
188 3300049581 Ga0501047_0002031 Ga0501047_0002031_9431_10543 350
189 3300049822 Ga0501035_0001860 Ga0501035_0001860_9150_10262 350
190 3300049823 Ga0501044_0000769 Ga0501044_0000769_13683_14795 350
191 3300050508 nmdc:mga09592_15431_c1 nmdc:mga09592_15431_c1_1164_2279 350
192 3300050512 nmdc:mga0n895_327323_c1 nmdc:mga0n895_327323_c1_34_1146 350
193 3300004799 Ga0058863_10054814 Ga0058863_100548141 351
194 3300004799 Ga0058863_11370755 Ga0058863_113707552 351
195 3300004799 Ga0058863_11897541 Ga0058863_118975413 351
196 3300005290 Ga0065712_10003594 Ga0065712_100035941 351
197 3300005293 Ga0065715_10023999 Ga0065715_100239992 351
198 3300005327 Ga0070658_10000510 Ga0070658_1000051015 351
199 3300005329 Ga0070683_100002619 Ga0070683_1000026195 351
200 3300005329 Ga0070683_100003346 Ga0070683_1000033462 351
201 3300005329 Ga0070683_100020451 Ga0070683_1000204512 351
202 3300005329 Ga0070683_100047912 Ga0070683_1000479123 351
203 3300005329 Ga0070683_100253386 Ga0070683_1002533862 351
204 3300005331 Ga0070670_100003002 Ga0070670_1000030024 351
205 3300005334 Ga0068869_100045274 Ga0068869_1000452743 351
206 3300005335 Ga0070666_10040313 Ga0070666_100403134 351
207 3300005336 Ga0070680_100002142 Ga0070680_10000214210 351
208 3300005336 Ga0070680_100012985 Ga0070680_1000129854 351
209 3300005336 Ga0070680_100120058 Ga0070680_1001200582 351
210 3300005338 Ga0068868_100007159 Ga0068868_1000071593 351
211 3300005339 Ga0070660_100176016 Ga0070660_1001760162 351
212 3300005344 Ga0070661_100138589 Ga0070661_1001385892 351
213 3300005344 Ga0070661_100184413 Ga0070661_1001844132 351
214 3300005353 Ga0070669_100156518 Ga0070669_1001565182 351
215 3300005355 Ga0070671_100000636 Ga0070671_1000006366 351
216 3300005366 Ga0070659_100000459 Ga0070659_10000045917 351
217 3300005435 Ga0070714_100002057 Ga0070714_1000020571 351
218 3300005435 Ga0070714_100006827 Ga0070714_1000068273 351
219 3300005436 Ga0070713_100008151 Ga0070713_1000081514 351
220 3300005436 Ga0070713_100097811 Ga0070713_1000978112 351
221 3300005436 Ga0070713_100145571 Ga0070713_1001455712 351
222 3300005439 Ga0070711_100153055 Ga0070711_1001530552 351
223 3300005445 Ga0070708_100012271 Ga0070708_1000122713 351
224 3300005455 Ga0070663_100001910 Ga0070663_10000191011 351
225 3300005456 Ga0070678_100017468 Ga0070678_1000174682 351
226 3300005456 Ga0070678_100101563 Ga0070678_1001015633 351
227 3300005458 Ga0070681_10000546 Ga0070681_1000054623 351
228 3300005458 Ga0070681_10002810 Ga0070681_1000281010 351
229 3300005458 Ga0070681_10045579 Ga0070681_100455792 351
230 3300005458 Ga0070681_10056462 Ga0070681_100564622 351
231 3300005458 Ga0070681_10147147 Ga0070681_101471473 351
232 3300005467 Ga0070706_100000475 Ga0070706_1000004759 351
233 3300005468 Ga0070707_100042080 Ga0070707_1000420803 351
234 3300005468 Ga0070707_100213726 Ga0070707_1002137262 351
235 3300005471 Ga0070698_100003778 Ga0070698_1000037787 351
236 3300005471 Ga0070698_100061184 Ga0070698_1000611842 351
237 3300005518 Ga0070699_100132426 Ga0070699_1001324262 351
238 3300005530 Ga0070679_100000514 Ga0070679_1000005146 351
239 3300005530 Ga0070679_100000557 Ga0070679_1000005574 351
240 3300005530 Ga0070679_100131498 Ga0070679_1001314983 351
241 3300005535 Ga0070684_100000424 Ga0070684_1000004245 351
242 3300005535 Ga0070684_100002528 Ga0070684_1000025288 351
243 3300005539 Ga0068853_100000204 Ga0068853_1000002049 351
244 3300005539 Ga0068853_100003979 Ga0068853_1000039797 351
245 3300005539 Ga0068853_100004688 Ga0068853_1000046888 351
246 3300005545 Ga0070695_100251515 Ga0070695_1002515151 351
247 3300005563 Ga0068855_100024898 Ga0068855_1000248989 351
248 3300005563 Ga0068855_100047335 Ga0068855_1000473352 351
249 3300005577 Ga0068857_100001981 Ga0068857_1000019815 351
250 3300005577 Ga0068857_100112753 Ga0068857_1001127532 351
251 3300005578 Ga0068854_100000081 Ga0068854_10000008124 351
252 3300005616 Ga0068852_100023381 Ga0068852_1000233813 351
253 3300005617 Ga0068859_100146451 Ga0068859_1001464513 351
254 3300005842 Ga0068858_100005594 Ga0068858_1000055946 351
255 3300006028 Ga0070717_10000194 Ga0070717_1000019421 351
256 3300006028 Ga0070717_10010237 Ga0070717_100102375 351
257 3300006844 Ga0075428_100013256 Ga0075428_1000132563 351
258 3300006844 Ga0075428_100032244 Ga0075428_1000322442 351
259 3300006847 Ga0075431_100005811 Ga0075431_1000058114 351
260 3300006847 Ga0075431_100095378 Ga0075431_1000953783 351
261 3300006852 Ga0075433_10072176 Ga0075433_100721764 351
262 3300006880 Ga0075429_100002325 Ga0075429_1000023254 351
263 3300006931 Ga0097620_100146445 Ga0097620_1001464453 351
264 3300009093 Ga0105240_10006804 Ga0105240_100068047 351
265 3300009093 Ga0105240_10008376 Ga0105240_1000837610 351
266 3300009093 Ga0105240_10012369 Ga0105240_100123694 351
267 3300009094 Ga0111539_10290463 Ga0111539_102904632 351
268 3300009147 Ga0114129_10037159 Ga0114129_100371593 351
269 3300009174 Ga0105241_10002200 Ga0105241_1000220010 351
270 3300009177 Ga0105248_10003617 Ga0105248_100036176 351
271 3300009545 Ga0105237_10004257 Ga0105237_1000425711 351
272 3300009551 Ga0105238_10003016 Ga0105238_100030165 351
273 3300009551 Ga0105238_10070087 Ga0105238_100700874 351
274 3300010375 Ga0105239_10001126 Ga0105239_100011269 351
275 3300013104 Ga0157370_10008156 Ga0157370_100081565 351
276 3300013104 Ga0157370_10018606 Ga0157370_100186067 351
277 3300013105 Ga0157369_10002662 Ga0157369_1000266215 351
278 3300013105 Ga0157369_10049641 Ga0157369_100496413 351
279 3300013105 Ga0157369_10088717 Ga0157369_100887173 351
280 3300013307 Ga0157372_10000871 Ga0157372_100008715 351
281 3300013307 Ga0157372_10063957 Ga0157372_100639574 351
282 3300013307 Ga0157372_10166847 Ga0157372_101668473 351
283 3300017792 Ga0163161_10104621 Ga0163161_101046213 351
284 3300017792 Ga0163161_10107883 Ga0163161_101078833 351
285 3300020069 Ga0197907_10291974 Ga0197907_102919741 351
286 3300020078 Ga0206352_10240072 Ga0206352_102400725 351
287 3300020080 Ga0206350_10169733 Ga0206350_101697334 351
288 3300020081 Ga0206354_10022903 Ga0206354_100229031 351
289 3300021388 Ga0213875_10057493 Ga0213875_100574932 351
290 3300022467 Ga0224712_10000486 Ga0224712_100004868 351
291 3300022467 Ga0224712_10039947 Ga0224712_100399471 351
292 3300025908 Ga0207643_10012368 Ga0207643_100123683 351
293 3300025910 Ga0207684_10000281 Ga0207684_1000028156 351
294 3300025910 Ga0207684_10003088 Ga0207684_100030889 351
295 3300025911 Ga0207654_10007780 Ga0207654_100077805 351
296 3300025912 Ga0207707_10000774 Ga0207707_1000077424 351
297 3300025912 Ga0207707_10003775 Ga0207707_100037759 351
298 3300025913 Ga0207695_10001737 Ga0207695_1000173723 351
299 3300025913 Ga0207695_10148659 Ga0207695_101486593 351
300 3300025913 Ga0207695_10255433 Ga0207695_102554332 351
301 3300025914 Ga0207671_10009523 Ga0207671_100095234 351
302 3300025917 Ga0207660_10001846 Ga0207660_100018466 351
303 3300025917 Ga0207660_10134637 Ga0207660_101346371 351
304 3300025919 Ga0207657_10005473 Ga0207657_100054735 351
305 3300025919 Ga0207657_10077123 Ga0207657_100771232 351
306 3300025920 Ga0207649_10109125 Ga0207649_101091252 351
307 3300025921 Ga0207652_10000566 Ga0207652_1000056612 351
308 3300025921 Ga0207652_10220754 Ga0207652_102207542 351
309 3300025922 Ga0207646_10000043 Ga0207646_1000004311 351
310 3300025922 Ga0207646_10000096 Ga0207646_1000009672 351
311 3300025922 Ga0207646_10000954 Ga0207646_1000095426 351
312 3300025922 Ga0207646_10005468 Ga0207646_100054689 351
313 3300025922 Ga0207646_10169065 Ga0207646_101690652 351
314 3300025924 Ga0207694_10002225 Ga0207694_100022257 351
315 3300025926 Ga0207659_10166158 Ga0207659_101661582 351
316 3300025928 Ga0207700_10003895 Ga0207700_100038953 351
317 3300025928 Ga0207700_10089634 Ga0207700_100896342 351
318 3300025929 Ga0207664_10002658 Ga0207664_1000265811 351
319 3300025929 Ga0207664_10123351 Ga0207664_101233512 351
320 3300025931 Ga0207644_10003541 Ga0207644_100035413 351
321 3300025931 Ga0207644_10194540 Ga0207644_101945402 351
322 3300025932 Ga0207690_10000312 Ga0207690_1000031219 351
323 3300025937 Ga0207669_10080589 Ga0207669_100805892 351
324 3300025938 Ga0207704_10092975 Ga0207704_100929753 351
325 3300025939 Ga0207665_10125188 Ga0207665_101251882 351
326 3300025940 Ga0207691_10001347 Ga0207691_1000134724 351
327 3300025941 Ga0207711_10320864 Ga0207711_103208642 351
328 3300025942 Ga0207689_10056751 Ga0207689_100567513 351
329 3300025944 Ga0207661_10013348 Ga0207661_100133483 351
330 3300025944 Ga0207661_10077520 Ga0207661_100775202 351
331 3300025944 Ga0207661_10214746 Ga0207661_102147462 351
332 3300025949 Ga0207667_10000797 Ga0207667_100007976 351
333 3300025949 Ga0207667_10060293 Ga0207667_100602934 351
334 3300025981 Ga0207640_10000019 Ga0207640_10000019141 351
335 3300025981 Ga0207640_10123544 Ga0207640_101235442 351
336 3300026035 Ga0207703_10003930 Ga0207703_100039306 351
337 3300026041 Ga0207639_10000120 Ga0207639_100001209 351
338 3300026041 Ga0207639_10007749 Ga0207639_100077495 351
339 3300026041 Ga0207639_10024662 Ga0207639_100246626 351
340 3300026067 Ga0207678_10004212 Ga0207678_100042126 351
341 3300026089 Ga0207648_10392760 Ga0207648_103927601 351
342 3300026116 Ga0207674_10000995 Ga0207674_1000099510 351
343 3300026116 Ga0207674_10118480 Ga0207674_101184803 351
344 3300026118 Ga0207675_100022020 Ga0207675_1000220207 351
345 3300026118 Ga0207675_100071116 Ga0207675_1000711164 351
346 3300026121 Ga0207683_10008581 Ga0207683_100085813 351
347 3300026121 Ga0207683_10215252 Ga0207683_102152521 351
348 3300026142 Ga0207698_10009002 Ga0207698_100090025 351
349 3300026142 Ga0207698_10064505 Ga0207698_100645053 351
350 3300027907 Ga0207428_10000144 Ga0207428_1000014447 351
351 3300027907 Ga0207428_10144972 Ga0207428_101449723 351
352 3300028800 Ga0265338_10129377 Ga0265338_101293772 351
353 3300028800 Ga0265338_10136743 Ga0265338_101367433 351
354 3300031241 Ga0265325_10067336 Ga0265325_100673363 351
355 3300031247 Ga0265340_10051722 Ga0265340_100517223 351
356 3300031251 Ga0265327_10005424 Ga0265327_1000542410 351
357 3300031712 Ga0265342_10040407 Ga0265342_100404072 351
358 3300031712 Ga0265342_10157057 Ga0265342_101570571 351
359 3300032002 Ga0307416_100094864 Ga0307416_1000948642 351
360 3300032004 Ga0307414_10113899 Ga0307414_101138992 351
361 3300033180 Ga0307510_10069741 Ga0307510_100697415 351
362 3300035083 Ga0373926_0004836 Ga0373926_0004836_2915_4030 351
363 3300035086 Ga0373934_0000873 Ga0373934_0000873_5706_6821 351
364 3300035111 Ga0373923_0062679 Ga0373923_0062679_259_1377 351
365 3300035116 Ga0373945_0074926 Ga0373945_0074926_28_1143 351
366 3300035119 Ga0373956_0002520 Ga0373956_0002520_54_1169 351
367 3300035119 Ga0373956_0029434 Ga0373956_0029434_148_1263 351
368 3300035119 Ga0373956_0035423 Ga0373956_0035423_835_1950 351
369 3300035170 Ga0373943_0005403 Ga0373943_0005403_961_2076 351
370 3300035692 Ga0373935_0000437 Ga0373935_0000437_14823_15938 351
371 3300035692 Ga0373935_0001066 Ga0373935_0001066_5365_6480 351
372 3300035695 Ga0373927_0001407 Ga0373927_0001407_16642_17757 351
373 3300035724 Ga0373933_0012242 Ga0373933_0012242_3085_4200 351
374 3300035724 Ga0373933_0032261 Ga0373933_0032261_419_1534 351
375 3300035724 Ga0373933_0038769 Ga0373933_0038769_696_1811 351
376 3300036401 Ga0373937_0015324 Ga0373937_0015324_4803_5918 351
377 3300036401 Ga0373937_0018872 Ga0373937_0018872_382_1497 351
378 3300037068 Ga0373925_0003908 Ga0373925_0003908_2977_4092 351
379 3300037068 Ga0373925_0010852 Ga0373925_0010852_730_1851 351
380 3300037312 Ga0395899_0000734 Ga0395899_0000734_61_1176 351
381 3300037312 Ga0395899_0003022 Ga0395899_0003022_12047_13162 351
382 3300037418 Ga0395900_0004531 Ga0395900_0004531_11119_12234 351
383 3300037418 Ga0395900_0036668 Ga0395900_0036668_1700_2815 351
384 3300037418 Ga0395900_0170740 Ga0395900_0170740_51_1166 351
385 3300037466 Ga0395898_0032668 Ga0395898_0032668_143_1258 351
386 3300037853 Ga0436364_0319228 Ga0436364_0319228_1521_2636 351
387 3300037853 Ga0436364_1022225 Ga0436364_1022225_269_1405 351
388 3300037853 Ga0436364_1214168 Ga0436364_1214168_1922_3037 351
389 3300038443 Ga0395901_0000376 Ga0395901_0000376_32164_33279 351
390 3300038443 Ga0395901_0005500 Ga0395901_0005500_10524_11639 351
391 3300039437 Ga0436365_0592662 Ga0436365_0592662_1497_2612 351
392 3300039437 Ga0436365_0682928 Ga0436365_0682928_5011_6216 351
393 3300039437 Ga0436365_1483147 Ga0436365_1483147_189_1304 351
394 3300039447 Ga0436361_1032002 Ga0436361_1032002_108_1223 351
395 3300039447 Ga0436361_1111202 Ga0436361_1111202_82_1197 351
396 3300039450 Ga0436363_0157307 Ga0436363_0157307_1925_3103 351
397 3300044684 Ga0466966_0003787 Ga0466966_0003787_6128_7243 351
398 3300044694 Ga0466963_0271619 Ga0466963_0271619_27_1142 351
399 3300045049 Ga0466959_0109125 Ga0466959_0109125_469_1584 351
400 3300045976 Ga0466967_0522613 Ga0466967_0522613_16_1131 351
401 3300046462 Ga0495651_0005897 Ga0495651_0005897_7639_8754 351
402 3300046472 Ga0495580_0155157 Ga0495580_0155157_93_1208 351
403 3300046473 Ga0495582_0016388 Ga0495582_0016388_2287_3402 351
404 3300046475 Ga0495639_0002384 Ga0495639_0002384_4108_5223 351
405 3300046506 Ga0495583_0063970 Ga0495583_0063970_24_1178 351
406 3300046511 Ga0495608_0090523 Ga0495608_0090523_614_1729 351
407 3300046517 Ga0495630_0012714 Ga0495630_0012714_4977_6092 351
408 3300046517 Ga0495630_0119925 Ga0495630_0119925_86_1201 351
409 3300046529 Ga0495652_0150611 Ga0495652_0150611_235_1350 351
410 3300046531 Ga0495665_0000700 Ga0495665_0000700_15757_16872 351
411 3300046536 Ga0495587_0000289 Ga0495587_0000289_17468_18583 351
412 3300046536 Ga0495587_0065305 Ga0495587_0065305_604_1719 351
413 3300046538 Ga0495609_0036538 Ga0495609_0036538_431_1546 351
414 3300046559 Ga0495667_0011555 Ga0495667_0011555_1665_2780 351
415 3300046674 Ga0495588_0001897 Ga0495588_0001897_2970_4085 351
416 3300046679 Ga0495623_0052130 Ga0495623_0052130_392_1507 351
417 3300046680 Ga0495646_0098447 Ga0495646_0098447_492_1607 351
418 3300046683 Ga0495658_0001571 Ga0495658_0001571_10425_11540 351
419 3300046689 Ga0495613_0003274 Ga0495613_0003274_7535_8650 351
420 3300046689 Ga0495613_0175172 Ga0495613_0175172_87_1202 351
421 3300047315 Ga0495581_0009887 Ga0495581_0009887_2180_3295 351
422 3300047317 Ga0495604_0020529 Ga0495604_0020529_2631_3746 351
423 3300047322 Ga0495680_0033646 Ga0495680_0033646_1197_2312 351
424 3300047444 Ga0495675_0073571 Ga0495675_0073571_341_1456 351
425 3300047471 Ga0495684_0027510 Ga0495684_0027510_1824_2939 351
426 3300048088 Ga0495602_0008192 Ga0495602_0008192_145_1260 351
427 3300048088 Ga0495602_0032220 Ga0495602_0032220_3438_4553 351
428 3300048089 Ga0495614_0000914 Ga0495614_0000914_9785_10900 351
429 3300048907 Ga0496104_0016151 Ga0496104_0016151_5562_6677 351
430 3300048911 Ga0496108_0036508 Ga0496108_0036508_1549_2664 351
431 3300048912 Ga0496109_0003051 Ga0496109_0003051_7721_8836 351
432 3300048913 Ga0496110_0036628 Ga0496110_0036628_2754_3869 351
433 3300048913 Ga0496110_0037020 Ga0496110_0037020_427_1542 351
434 3300048913 Ga0496110_0124198 Ga0496110_0124198_1147_2262 351
435 3300048913 Ga0496110_0450383 Ga0496110_0450383_26_1141 351
436 3300048914 Ga0496111_0239216 Ga0496111_0239216_179_1294 351
437 3300048915 Ga0496112_0007149 Ga0496112_0007149_8657_9772 351
438 3300048915 Ga0496112_0206794 Ga0496112_0206794_193_1308 351
439 3300048916 Ga0496113_0075926 Ga0496113_0075926_688_1803 351
440 3300048917 Ga0496114_0195605 Ga0496114_0195605_595_1710 351
441 3300048918 Ga0496115_0259464 Ga0496115_0259464_272_1387 351
442 3300048929 Ga0496126_0000020 Ga0496126_0000020_211349_212464 351
443 3300049568 Ga0501031_0008717 Ga0501031_0008717_1713_2828 351
444 3300049569 Ga0501032_0000463 Ga0501032_0000463_4520_5635 351
445 3300049570 Ga0501033_0019994 Ga0501033_0019994_1976_3091 351
446 3300049571 Ga0501034_0005208 Ga0501034_0005208_1146_2261 351
447 3300049571 Ga0501034_0006548 Ga0501034_0006548_7955_9070 351
448 3300049572 Ga0501036_0003645 Ga0501036_0003645_10884_11999 351
449 3300049572 Ga0501036_0004808 Ga0501036_0004808_8033_9148 351
450 3300049573 Ga0501037_0016891 Ga0501037_0016891_1795_2910 351
451 3300049574 Ga0501038_0008187 Ga0501038_0008187_1328_2443 351
452 3300049575 Ga0501039_0044212 Ga0501039_0044212_480_1595 351
453 3300049578 Ga0501042_0012676 Ga0501042_0012676_1626_2741 351
454 3300049578 Ga0501042_0139472 Ga0501042_0139472_430_1545 351
455 3300049579 Ga0501043_0002327 Ga0501043_0002327_576_1691 351
456 3300049579 Ga0501043_0072027 Ga0501043_0072027_483_1598 351
457 3300049580 Ga0501046_0000091 Ga0501046_0000091_94242_95357 351
458 3300049581 Ga0501047_0000929 Ga0501047_0000929_1883_2998 351
459 3300049581 Ga0501047_0001874 Ga0501047_0001874_8998_10113 351
460 3300049582 Ga0501048_0008299 Ga0501048_0008299_2766_3881 351
461 3300049583 Ga0501067_0019729 Ga0501067_0019729_2350_3465 351
462 3300049584 Ga0501068_0046929 Ga0501068_0046929_391_1506 351
463 3300049585 Ga0501069_0029958 Ga0501069_0029958_1386_2501 351
464 3300049589 Ga0501073_0007003 Ga0501073_0007003_5585_6700 351
465 3300049589 Ga0501073_0077052 Ga0501073_0077052_915_2030 351
466 3300049590 Ga0501074_0006347 Ga0501074_0006347_1505_2620 351
467 3300049822 Ga0501035_0006266 Ga0501035_0006266_9033_10148 351
468 3300049823 Ga0501044_0066566 Ga0501044_0066566_2195_3310 351
469 3300050507 nmdc:mga05p37_20365_c1 nmdc:mga05p37_20365_c1_5818_6933 351
470 3300050507 nmdc:mga05p37_26722_c1 nmdc:mga05p37_26722_c1_965_2098 351
471 3300050510 nmdc:mga06r32_10909_c1 nmdc:mga06r32_10909_c1_291_1406 351
472 3300050511 nmdc:mga08y16_128717_c1 nmdc:mga08y16_128717_c1_193_1308 351
473 3300050511 nmdc:mga08y16_421677_c1 nmdc:mga08y16_421677_c1_38_1153 351
474 3300050511 nmdc:mga08y16_89775_c1 nmdc:mga08y16_89775_c1_410_1525 351
475 3300050512 nmdc:mga0n895_179969_c1 nmdc:mga0n895_179969_c1_864_1979 351
476 3300050512 nmdc:mga0n895_86181_c1 nmdc:mga0n895_86181_c1_457_1572 351
477 3300050514 nmdc:mga08x19_96718_c1 nmdc:mga08x19_96718_c1_452_1567 351
478 3300050515 nmdc:mga0a205_16929_c1 nmdc:mga0a205_16929_c1_4956_6071 351
479 3300050515 nmdc:mga0a205_6577_c1 nmdc:mga0a205_6577_c1_1449_2564 351
480 3300053119 Ga0500595_033209 Ga0500595_033209_112_1227 351
481 3300059421 Ga0590071_001719 Ga0590071_001719_2878_3993 351
482 3300061734 Ga0530510_0044435 Ga0530510_0044435_2016_3131 351
483 3300005985 Ga0081539_10014701 Ga0081539_100147016 353
484 3300028800 Ga0265338_10122182 Ga0265338_101221821 355
485 3300036401 Ga0373937_0081661 Ga0373937_0081661_292_1449 355
486 3300046663 Ga0495635_0191159 Ga0495635_0191159_78_1253 355
487 3300046689 Ga0495613_0002408 Ga0495613_0002408_1999_3156 355
488 3300047471 Ga0495684_0008447 Ga0495684_0008447_366_1523 355
489 3300049573 Ga0501037_0000073 Ga0501037_0000073_39615_40772 355
490 3300049823 Ga0501044_0000946 Ga0501044_0000946_22053_23210 355
491 3300009177 Ga0105248_10310836 Ga0105248_103108363 356
492 3300049571 Ga0501034_0008653 Ga0501034_0008653_2413_3579 356
493 3300006028 Ga0070717_10082230 Ga0070717_100822304 359
494 3300025928 Ga0207700_10025491 Ga0207700_100254913 359
495 3300046536 Ga0495587_0138060 Ga0495587_0138060_60_1235 359
496 3300053077 Ga0495601_0000713 Ga0495601_0000713_1230_2405 359
497 3300053085 Ga0495619_0093101 Ga0495619_0093101_569_1744 359
498 3300013307 Ga0157372_10020715 Ga0157372_100207152 360
499 3300003203 JGI25406J46586_10000459 JGI25406J46586_1000045916 362
500 3300005518 Ga0070699_100031616 Ga0070699_1000316163 362
501 3300006846 Ga0075430_100014515 Ga0075430_1000145154 362
502 3300006847 Ga0075431_100027132 Ga0075431_1000271326 362
503 3300009094 Ga0111539_10060682 Ga0111539_100606822 362
504 3300049592 Ga0501076_0272211 Ga0501076_0272211_171_1355 362
505 3300050509 nmdc:mga0qj67_37712_c1 nmdc:mga0qj67_37712_c1_2282_3457 362
506 3300005536 Ga0070697_100010685 Ga0070697_1000106857 363
507 3300003203 JGI25406J46586_10007505 JGI25406J46586_100075055 370
508 3300005444 Ga0070694_100163079 Ga0070694_1001630792 370
509 3300005577 Ga0068857_100161268 Ga0068857_1001612683 370
510 3300005617 Ga0068859_100564957 Ga0068859_1005649571 370
511 3300005719 Ga0068861_100059001 Ga0068861_1000590012 370
512 3300005844 Ga0068862_100013791 Ga0068862_1000137915 370
513 3300005985 Ga0081539_10000605 Ga0081539_1000060513 370
514 3300006931 Ga0097620_100564976 Ga0097620_1005649761 370
515 3300014326 Ga0157380_10000337 Ga0157380_100003378 370
516 3300021384 Ga0213876_10000119 Ga0213876_1000011933 370
517 3300026118 Ga0207675_100082853 Ga0207675_1000828532 370
518 3300005458 Ga0070681_10102309 Ga0070681_101023093 372
519 3300000546 LJNas_1000658 LJNas_10006586 373
520 3300005345 Ga0070692_10003160 Ga0070692_100031606 373
521 3300005406 Ga0070703_10010129 Ga0070703_100101294 373
522 3300005444 Ga0070694_100004994 Ga0070694_1000049946 373
523 3300005545 Ga0070695_100037493 Ga0070695_1000374933 373
524 3300005616 Ga0068852_100051861 Ga0068852_1000518613 373
525 3300005617 Ga0068859_100073611 Ga0068859_1000736113 373
526 3300005834 Ga0068851_10003914 Ga0068851_100039146 373
527 3300006358 Ga0068871_100195163 Ga0068871_1001951633 373
528 3300006844 Ga0075428_100004203 Ga0075428_1000042034 373
529 3300006852 Ga0075433_10081503 Ga0075433_100815034 373
530 3300006871 Ga0075434_100092930 Ga0075434_1000929302 373
531 3300006931 Ga0097620_100073606 Ga0097620_1000736063 373
532 3300009147 Ga0114129_10043369 Ga0114129_100433699 373
533 3300009545 Ga0105237_10004306 Ga0105237_1000430615 373
534 3300047471 Ga0495684_0126427 Ga0495684_0126427_247_1434 373
535 3300050508 nmdc:mga09592_104155_c1 nmdc:mga09592_104155_c1_1110_2297 373
536 3300050515 nmdc:mga0a205_222245_c1 nmdc:mga0a205_222245_c1_77_1264 373

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02012

BNR

BNR/Asp-box repeat

228

239

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bne-assembly3.cif.gz_C barnase a43c/s80c disulfide mutant 0.8804 138 161
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.8289 2 373
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.8137 2 373
6qfb-assembly2.cif.gz_C-3 structure of the human atp citrate lyase holoenzyme in complex with citrate, coenzyme a and mg.adp 0.7833 2 19
7s0u-assembly1.cif.gz_B prmt5/mep50 crystal structure with mta and phthalazinone fragment bound 0.7768 5 298
ID Description Score Start End Superfamily
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8211 1 373 2.130.10.10
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8102 1 373 2.130.10.10
1noyB01 Alpha Beta;2-Layer Sandwich;DNA Polymerase; Chain A, domain 1;DNA Polymerase, chain B, domain 1 0.7547 36 68 3.30.342.10
af_A0A0P0X1D1_62_249_2.130.10.30 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 0.7532 183 329 2.130.10.30
af_Q54CB5_1782_1989_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7435 36 320 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A535EHK9-F1-model_v4 Exo-alpha-sialidase 0.9855 1 323 GO:0000272
GO:0010411
GO:0016798
AF-A0A535EHK9-F1-model_v4 Exo-alpha-sialidase 0.9822 1 323 GO:0000272
GO:0010411
GO:0016798
AF-A0A2V8B9L8-F1-model_v4 Exo-alpha-sialidase 0.9768 1 253 GO:0000272
GO:0010411
GO:0016798
AF-A0A838S5Q7-F1-model_v4 Exo-alpha-sialidase 0.9734 1 270 GO:0000272
GO:0010411
GO:0016798
AF-A0A2V8B9L8-F1-model_v4 Exo-alpha-sialidase 0.9727 1 253 GO:0000272
GO:0010411
GO:0016798

Feature Viewer

pLDDT pTM Quality
89.58 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map