F460787

General Info

Members Datasets Scaffolds Average Seq Length
536 420 237 172

Family's Representative Sequence

Representative Sequence 3300021320|Ga0214544_1000646|Ga0214544_100064662
Length 186
Sequence MGRVSGIPHASRSNSELTAPGEPMELWRAFVPRWAHMPLSGDGAARFGGRWNPVGTPTIYAARELSTAWAEYNQGFVQHPALIVRLELQDAKLADLTDAGVLADLGLEESIHRCEWRHELDHGKAPTTHKVQADLVARDFHGVIYPSCMSPGGTCVALWRWNGKNRPRLAVIDPEGRLPKSPASWL

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
5 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
6 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
7 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
8 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
9 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
10 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
11 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
12 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
13 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
14 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
15 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
16 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
17 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
18 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
19 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
20 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
21 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
22 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
23 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
24 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
25 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
26 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
27 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
28 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
29 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
30 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
31 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
32 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
33 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
34 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
35 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
36 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
37 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
38 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
39 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
40 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
41 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
42 2643221557 Ensifer sp. Root558 Isolate Unclassified
43 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
44 2643221607 Rhizobium sp. Root73 Isolate Unclassified
45 2643221610 Ensifer sp. Root74 Isolate Unclassified
46 2643221626 Ensifer sp. Root31 Isolate Unclassified
47 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
48 2643221668 Ensifer sp. Root423 Isolate Unclassified
49 2643221675 Ensifer sp. Root1298 Isolate Unclassified
50 2643221680 Ensifer sp. Root1312 Isolate Unclassified
51 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
52 2643221688 Rhizobium sp. Root482 Isolate Unclassified
53 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
54 2643221698 Ensifer sp. Root142 Isolate Unclassified
55 2643221723 Ensifer sp. Root278 Isolate Unclassified
56 2643221726 Ensifer sp. Root954 Isolate Unclassified
57 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
58 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
59 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
60 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
61 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
62 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
63 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
64 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
65 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
66 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
67 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
68 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
69 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
70 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
71 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
72 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
73 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
74 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
75 2844163670 Ensifer sp. 1H6 Isolate Unclassified
76 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
77 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
78 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
79 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
80 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
81 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
82 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
83 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
84 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
85 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
86 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
87 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
88 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
89 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
90 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
91 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
92 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
93 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
94 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
95 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
96 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
97 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
98 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
99 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
100 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
101 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
102 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
103 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
104 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
105 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
106 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
107 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
108 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
109 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
110 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
111 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
112 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
113 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
114 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
115 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
116 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
117 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
118 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
119 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
120 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
121 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
122 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
123 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
124 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
125 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
126 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
127 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
128 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
129 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
130 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
131 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
132 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
133 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
134 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
135 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
136 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
137 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
138 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
139 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
140 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
141 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
142 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
143 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
144 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
145 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
146 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
147 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
148 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
149 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
150 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
151 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
152 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
153 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
154 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
155 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
156 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
157 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
158 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
159 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
160 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
161 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
162 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
163 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
164 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
165 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
166 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
167 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
168 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
169 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
170 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
171 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
172 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
173 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
174 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
175 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
176 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
177 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
178 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
179 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
180 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
181 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
182 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
183 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
184 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
185 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
186 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
187 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
188 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
189 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
190 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
191 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
192 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
193 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
194 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
195 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
196 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
197 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
198 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
199 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
200 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
201 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
202 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
203 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
204 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
205 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
206 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
207 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
208 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
209 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
210 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
211 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
212 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
213 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
214 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
215 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
216 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
217 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
218 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
219 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
220 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
221 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
222 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
223 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
224 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
225 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
226 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
227 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
228 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
229 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
230 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
231 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
232 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
233 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
234 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
235 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
236 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
237 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
238 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
239 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
240 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
241 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
242 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
243 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
244 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
245 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
246 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
247 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
248 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
249 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
250 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
251 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
252 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
253 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
254 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
255 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
256 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
257 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
258 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
259 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
260 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
261 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
262 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
263 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
264 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
265 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
266 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
267 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
268 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
269 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
270 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
271 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
272 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
273 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
274 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
275 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
276 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
277 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
278 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
279 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
280 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
281 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
282 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
283 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
284 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
285 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
286 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
287 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
288 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
289 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
290 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
291 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
292 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
293 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
294 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
295 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
296 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
297 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
298 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
299 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
300 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
301 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
302 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
303 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
304 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
305 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
306 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
307 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
308 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
309 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
310 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
311 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
312 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
313 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
314 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
315 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
316 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
317 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
318 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
319 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
320 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
321 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
322 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
323 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
324 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
325 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
326 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
327 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
328 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
329 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
330 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
331 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
332 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
334 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
335 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
337 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
339 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
340 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
341 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
342 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
343 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
344 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
345 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
346 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
347 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
348 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
349 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
350 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
351 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
352 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
353 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
354 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
355 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
356 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
357 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
358 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
359 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
360 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
361 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
362 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
363 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
364 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
365 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
366 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
367 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
368 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
369 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
370 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
371 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
372 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
373 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
374 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
375 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
376 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
389 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
390 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
391 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
392 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
393 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
394 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
395 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
396 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
397 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
398 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
399 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
400 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
401 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
403 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
404 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
405 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
406 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
407 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
408 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
409 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
410 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
411 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
412 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
413 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
414 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
415 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
416 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
417 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
418 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
419 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
420 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.22
Metatranscriptomes 0
Isolates 55.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.19
Nodule 49.44
Rhizoplane 1.12
Rhizosphere 29.1
Stem 0
Stem Tuber 0
Unclassified 9.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1009524 3300002773 Bacteria 2301
2 JGI25159J45721_1000075 3300002987 Bacteria 47795
3 JGI25151J46595_10006663 3300003187 Bacteria 5761
4 JGI25406J46586_10008156 3300003203 Bacteria 4756
5 JGI25153J46596_10063159 3300003215 Bacteria 994
6 rootL2_10079779 3300003322 Bacteria 1723
7 rootH1_10149305 3300003323 Bacteria 2873
8 JGI25160J50197_1000073 3300003354 Bacteria 104247
9 JGI25161J50226_1011597 3300003374 Bacteria 1098
10 Ga0055526_1008792 3300003771 Bacteria 4971
11 Ga0055526_1031310 3300003771 Bacteria 1528
12 Ga0055524_1025043 3300003775 Bacteria 1877
13 Ga0055536_1000700 3300003781 Bacteria 22454
14 Ga0055536_1002937 3300003781 Bacteria 9363
15 Ga0055528_1000236 3300003790 Bacteria 46467
16 Ga0055530_10004287 3300003791 Bacteria 7442
17 Ga0055540_1015246 3300003792 Bacteria 2248
18 Ga0055531_10000635 3300003794 Bacteria 30252
19 Ga0055531_10019071 3300003794 Bacteria 2797
20 Ga0055543_1005815 3300004625 Bacteria 3089
21 Ga0065165_1000198 3300005262 Bacteria 104285
22 Ga0065165_1006556 3300005262 Bacteria 6064
23 Ga0068868_101060856 3300005338 Bacteria 744
24 Ga0081540_1042239 3300005983 Bacteria 2353
25 Ga0081539_10001043 3300005985 Bacteria 50701
26 Ga0075365_10272293 3300006038 Bacteria 1191
27 Ga0075363_100435368 3300006048 Bacteria 773
28 Ga0079104_1021120 3300006946 Bacteria 1778
29 Ga0105033_102706 3300009986 Bacteria 1470
30 Ga0171463_1002 3300013249 Bacteria 1274851
31 Ga0163162_11105420 3300013306 Bacteria 898
32 Ga0183363_1056 3300015690 Bacteria 35540
33 Ga0214544_1000646 3300021320 Bacteria 66087
34 Ga0214542_1000027 3300021321 Bacteria 175107
35 Ga0214542_1016821 3300021321 Bacteria 6905
36 Ga0214543_1000025 3300021327 Bacteria 225351
37 Ga0214543_1000047 3300021327 Bacteria 150894
38 Ga0228711_1015241 3300022739 Bacteria 8428
39 Ga0228710_1006811 3300022740 Bacteria 17155
40 Ga0209436_102796 3300025208 Bacteria 4967
41 Ga0209129_1000016 3300025258 Bacteria 485491
42 Ga0209565_1010300 3300025263 Bacteria 2324
43 Ga0209673_1000005 3300025273 Bacteria 692788
44 Ga0209673_1037725 3300025273 Bacteria 1416
45 Ga0209130_1000153 3300025284 Bacteria 104299
46 Ga0209675_1057259 3300025291 Bacteria 781
47 Ga0209676_1000580 3300025292 Bacteria 55127
48 Ga0209676_1000666 3300025292 Bacteria 49043
49 Ga0209676_1021102 3300025292 Bacteria 2196
50 Ga0209025_1000333 3300025294 Bacteria 104266
51 Ga0209025_1000502 3300025294 Bacteria 75139
52 Ga0209025_1004799 3300025294 Bacteria 11467
53 Ga0209025_1027499 3300025294 Bacteria 2819
54 Ga0209025_1128660 3300025294 Bacteria 741
55 Ga0209564_1000280 3300025295 Bacteria 104429
56 Ga0209564_1007471 3300025295 Bacteria 5639
57 Ga0209564_1069805 3300025295 Bacteria 737
58 Ga0209758_1000115 3300025297 Bacteria 199268
59 Ga0209758_1014450 3300025297 Bacteria 4197
60 Ga0209758_1048867 3300025297 Bacteria 1499
61 Ga0209050_1000852 3300025298 Bacteria 41567
62 Ga0209256_1000064 3300025299 Bacteria 250853
63 Ga0209256_1001123 3300025299 Bacteria 30560
64 Ga0207426_1000280 3300025302 Bacteria 104299
65 Ga0209051_1002455 3300025303 Bacteria 13275
66 Ga0209051_1010996 3300025303 Bacteria 4513
67 Ga0209051_1022900 3300025303 Bacteria 2614
68 Ga0209257_1002180 3300025304 Bacteria 20273
69 Ga0209257_1004493 3300025304 Bacteria 10753
70 Ga0209257_1012373 3300025304 Bacteria 3956
71 Ga0209257_1084334 3300025304 Bacteria 807
72 Ga0207668_10554625 3300025972 Bacteria 996
73 Ga0209281_1000314 3300027111 Bacteria 86424
74 Ga0209281_1000463 3300027111 Bacteria 57136
75 Ga0209282_1000068 3300027666 Bacteria 85817
76 Ga0307515_10011471 3300028794 Bacteria 16819
77 Ga0307408_100548344 3300031548 Bacteria 1020
78 Ga0307413_10121619 3300031824 Bacteria 1770
79 Ga0307412_10435747 3300031911 Bacteria 1076
80 Ga0315914_1014431 3300031967 Bacteria 8428
81 Ga0307416_102550867 3300032002 Bacteria 609
82 Ga0307414_10503464 3300032004 Bacteria 1072
83 Ga0315913_1002536 3300033430 Bacteria 21509
84 Ga0315915_1000007 3300033464 Bacteria 319225
85 Ga0395899_0000030 3300037312 Bacteria 329063
86 Ga0395899_0104638 3300037312 Bacteria 2040
87 Ga0395900_0000023 3300037418 Bacteria 336048
88 Ga0395898_0000038 3300037466 Bacteria 329063
89 Ga0395898_0249451 3300037466 Bacteria 1693
90 Ga0395905_0000021 3300037471 Bacteria 329054
91 Ga0395901_0000018 3300038443 Bacteria 336048
92 Ga0439436_0047510 3300041404 Bacteria 1218
93 Ga0439438_064822 3300041405 Bacteria 910
94 Ga0439465_0028583 3300041413 Bacteria 1769
95 Ga0439465_0040692 3300041413 Bacteria 1503
96 Ga0439465_0168575 3300041413 Bacteria 788
97 Ga0439449_0050325 3300042007 Bacteria 1541
98 Ga0439462_0021790 3300042015 Bacteria 1676
99 Ga0439462_0048460 3300042015 Bacteria 1139
100 Ga0450907_006198 3300042146 Bacteria 2002
101 Ga0450918_039569 3300042531 Bacteria 844
102 Ga0466965_0270737 3300044683 Bacteria 915
103 Ga0495638_0012524 3300046460 Bacteria 5807
104 Ga0495606_0004073 3300046507 Bacteria 14872
105 Ga0495606_0044036 3300046507 Bacteria 2971
106 Ga0495606_0184734 3300046507 Bacteria 1199
107 Ga0495606_0349070 3300046507 Bacteria 786
108 Ga0495686_0000090 3300047472 Bacteria 193179
109 Ga0495686_0023716 3300047472 Bacteria 4041
110 Ga0496100_0388694 3300048903 Bacteria 1061
111 Ga0496106_0028852 3300048909 Bacteria 4135
112 Ga0496106_0954440 3300048909 Bacteria 676
113 Ga0496107_0340826 3300048910 Bacteria 1115
114 Ga0496114_0091036 3300048917 Bacteria 2590
115 Ga0496117_0209798 3300048920 Bacteria 1093
116 Ga0496118_0241928 3300048921 Bacteria 1032
117 Ga0496119_0330409 3300048922 Bacteria 744
118 Ga0496121_0137551 3300048924 Bacteria 1817
119 Ga0496121_0592596 3300048924 Bacteria 685
120 Ga0496124_0449345 3300048927 Bacteria 879
121 Ga0496125_0217894 3300048928 Bacteria 1233
122 Ga0496126_0248677 3300048929 Bacteria 1482
123 Ga0501031_0024061 3300049568 Bacteria 3971
124 Ga0501031_0028380 3300049568 Bacteria 3648
125 Ga0501031_0075108 3300049568 Bacteria 2200
126 Ga0501031_0175824 3300049568 Bacteria 1398
127 Ga0501031_0421411 3300049568 Bacteria 863
128 Ga0501031_0553369 3300049568 Bacteria 741
129 Ga0501032_0018665 3300049569 Bacteria 4856
130 Ga0501032_0219204 3300049569 Bacteria 1238
131 Ga0501033_0019061 3300049570 Bacteria 5187
132 Ga0501033_0021942 3300049570 Bacteria 4817
133 Ga0501033_0073152 3300049570 Bacteria 2516
134 Ga0501033_0076144 3300049570 Bacteria 2463
135 Ga0501033_0093360 3300049570 Bacteria 2200
136 Ga0501033_0151109 3300049570 Bacteria 1675
137 Ga0501033_0251725 3300049570 Bacteria 1251
138 Ga0501033_0694768 3300049570 Bacteria 692
139 Ga0501034_0066604 3300049571 Bacteria 3615
140 Ga0501034_0162878 3300049571 Bacteria 2200
141 Ga0501034_0460651 3300049571 Bacteria 1188
142 Ga0501034_0480344 3300049571 Bacteria 1158
143 Ga0501034_0584110 3300049571 Bacteria 1024
144 Ga0501034_1028801 3300049571 Bacteria 707
145 Ga0501036_0019982 3300049572 Bacteria 5622
146 Ga0501036_0157050 3300049572 Bacteria 1918
147 Ga0501036_0273300 3300049572 Bacteria 1415
148 Ga0501036_0530539 3300049572 Bacteria 979
149 Ga0501037_0000076 3300049573 Bacteria 92049
150 Ga0501037_0091436 3300049573 Bacteria 2200
151 Ga0501037_0141047 3300049573 Bacteria 1725
152 Ga0501038_0073622 3300049574 Bacteria 2892
153 Ga0501038_0117141 3300049574 Bacteria 2200
154 Ga0501038_0258554 3300049574 Bacteria 1377
155 Ga0501038_0339178 3300049574 Bacteria 1172
156 Ga0501038_0440485 3300049574 Bacteria 1003
157 Ga0501038_0656197 3300049574 Bacteria 789
158 Ga0501039_0272031 3300049575 Bacteria 1331
159 Ga0501043_0000039 3300049579 Bacteria 119155
160 Ga0501043_0064479 3300049579 Bacteria 2877
161 Ga0501043_0081435 3300049579 Bacteria 2543
162 Ga0501043_0153625 3300049579 Bacteria 1800
163 Ga0501043_0432820 3300049579 Bacteria 991
164 Ga0501043_0680365 3300049579 Bacteria 753
165 Ga0501043_1025259 3300049579 Bacteria 586
166 Ga0501046_0032902 3300049580 Bacteria 4195
167 Ga0501046_0054919 3300049580 Bacteria 3131
168 Ga0501046_0359062 3300049580 Bacteria 1057
169 Ga0501046_0570396 3300049580 Bacteria 805
170 Ga0501047_0104986 3300049581 Bacteria 2706
171 Ga0501047_0107542 3300049581 Bacteria 2670
172 Ga0501047_0128670 3300049581 Bacteria 2412
173 Ga0501047_0300898 3300049581 Bacteria 1446
174 Ga0501047_0619191 3300049581 Bacteria 903
175 Ga0501048_1046549 3300049582 Bacteria 587
176 Ga0501067_0124849 3300049583 Bacteria 1433
177 Ga0501068_0046401 3300049584 Bacteria 2620
178 Ga0501068_0315535 3300049584 Bacteria 1002
179 Ga0501069_0000022 3300049585 Bacteria 119155
180 Ga0501069_0084597 3300049585 Bacteria 1789
181 Ga0501069_0113825 3300049585 Bacteria 1542
182 Ga0501069_0202815 3300049585 Bacteria 1150
183 Ga0501070_0000080 3300049586 Bacteria 81734
184 Ga0501070_0000959 3300049586 Bacteria 26022
185 Ga0501070_0043140 3300049586 Bacteria 3754
186 Ga0501070_0050828 3300049586 Bacteria 3440
187 Ga0501070_0249695 3300049586 Bacteria 1451
188 Ga0501070_1179575 3300049586 Bacteria 588
189 Ga0501071_0076256 3300049587 Bacteria 2448
190 Ga0501071_0116632 3300049587 Bacteria 1977
191 Ga0501072_0087265 3300049588 Bacteria 2476
192 Ga0501072_0365843 3300049588 Bacteria 1145
193 Ga0501073_0131988 3300049589 Bacteria 1731
194 Ga0501073_0231531 3300049589 Bacteria 1276
195 Ga0501074_0000046 3300049590 Bacteria 57165
196 Ga0501074_0043359 3300049590 Bacteria 3256
197 Ga0501074_0491753 3300049590 Bacteria 869
198 Ga0501238_003526 3300049671 Bacteria 1926
199 Ga0501079_0683328 3300049741 Bacteria 808
200 Ga0501080_0001756 3300049742 Bacteria 18596
201 Ga0501080_0002310 3300049742 Bacteria 16621
202 Ga0501080_0070387 3300049742 Bacteria 3253
203 Ga0501080_0098204 3300049742 Bacteria 2718
204 Ga0501080_0376057 3300049742 Bacteria 1280
205 Ga0501080_0673562 3300049742 Bacteria 914
206 Ga0501083_0000050 3300049744 Bacteria 86199
207 Ga0501083_0137415 3300049744 Bacteria 1601
208 Ga0501083_0667116 3300049744 Bacteria 676
209 Ga0501241_003418 3300049758 Bacteria 2996
210 Ga0501035_0000318 3300049822 Bacteria 55751
211 Ga0501035_0002532 3300049822 Bacteria 17865
212 Ga0501035_0002603 3300049822 Bacteria 17619
213 Ga0501035_0012226 3300049822 Bacteria 7936
214 Ga0501035_0022338 3300049822 Bacteria 5809
215 Ga0501035_0168028 3300049822 Bacteria 1896
216 Ga0501035_0297480 3300049822 Bacteria 1360
217 Ga0501035_0502624 3300049822 Bacteria 998
218 Ga0501035_0766360 3300049822 Bacteria 773
219 Ga0501044_0000147 3300049823 Bacteria 86591
220 Ga0501044_0006413 3300049823 Bacteria 13000
221 Ga0501044_0016473 3300049823 Bacteria 7933
222 Ga0501044_0099577 3300049823 Bacteria 2925
223 Ga0501044_0163549 3300049823 Bacteria 2200
224 Ga0501044_0228929 3300049823 Bacteria 1807
225 Ga0501044_0316376 3300049823 Bacteria 1486
226 Ga0501044_0384822 3300049823 Bacteria 1317
227 Ga0501044_0749354 3300049823 Bacteria 859
228 Ga0501044_1059828 3300049823 Bacteria 681
229 nmdc:mga0yw44_179270_c1 3300050492 Bacteria 1394
230 nmdc:mga0sz30_372880_c1 3300050516 Bacteria 638
231 Ga0500654_070444 3300053099 Bacteria 1709
232 Ga0500568_0000347 3300053139 Bacteria 35988
233 Ga0500616_0000104 3300053153 Bacteria 159954
234 Ga0500627_0248662 3300053158 Bacteria 787
235 Ga0500611_121854 3300053727 Bacteria 695
236 Ga0501082_0064584 3300060353 Bacteria 3152
237 Ga0501082_0556631 3300060353 Bacteria 1003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021321 Ga0214542_1016821 Ga0214542_10168217 148
2 3300021327 Ga0214543_1000025 Ga0214543_1000025135 148
3 3300022739 Ga0228711_1015241 Ga0228711_10152415 148
4 3300022740 Ga0228710_1006811 Ga0228710_10068116 148
5 3300027111 Ga0209281_1000314 Ga0209281_100031462 148
6 3300027666 Ga0209282_1000068 Ga0209282_100006862 148
7 3300031967 Ga0315914_1014431 Ga0315914_10144315 148
8 3300033430 Ga0315913_1002536 Ga0315913_100253614 148
9 3300033464 Ga0315915_1000007 Ga0315915_1000007303 148
10 3300041404 Ga0439436_0047510 Ga0439436_0047510_18_470 148
11 iso_pu_bacteria 2850079185 2850084566 150
12 iso_pu_bacteria 2854896431 2854899823 150
13 iso_pu_bacteria 2854916844 2854920957 150
14 iso_pu_bacteria 2878788777 2878793819 150
15 iso_pu_bacteria 2885312484 2885315851 150
16 3300049570 Ga0501033_0076144 Ga0501033_0076144_1914_2384 154
17 iso_pu_bacteria 2869256925 2869261490 155
18 iso_pu_bacteria 2906401398 2906404190 155
19 iso_pu_bacteria 2924710171 2924716014 155
20 3300041413 Ga0439465_0028583 Ga0439465_0028583_677_1192 156
21 3300049574 Ga0501038_0440485 Ga0501038_0440485_339_869 156
22 iso_pu_bacteria 2913295892 2913296776 157
23 iso_pu_bacteria 643692032 643823025 157
24 3300049823 Ga0501044_0228929 Ga0501044_0228929_1253_1759 159
25 iso_pu_bacteria 2513237159 2513999004 159
26 iso_pu_bacteria 2842521101 2842524745 159
27 3300042146 Ga0450907_006198 Ga0450907_006198_550_1065 160
28 iso_pu_bacteria 2513237089 2513606246 160
29 iso_pu_bacteria 2513237156 2513985046 160
30 iso_pu_bacteria 2513237160 2514007961 160
31 iso_pu_bacteria 2517487022 2517565592 160
32 iso_pu_bacteria 2802428859 2802723016 160
33 iso_pu_bacteria 2802428861 2802735218 160
34 iso_pu_bacteria 2802428862 2802742178 160
35 iso_pu_bacteria 2802428863 2802748625 160
36 iso_pu_bacteria 2915980308 2915983625 160
37 iso_pu_bacteria 2916061851 2916065323 160
38 iso_pu_bacteria 2921250672 2921256864 160
39 iso_pu_bacteria 2937029754 2937034977 160
40 iso_pu_bacteria 2937036028 2937039208 160
41 iso_pu_bacteria 2937078374 2937084379 160
42 iso_pu_bacteria 2937084907 2937091400 160
43 iso_pu_bacteria 2941499720 2941504325 160
44 iso_pu_bacteria 2957375807 2957379108 160
45 iso_pu_bacteria 2957437181 2957442986 160
46 iso_pu_bacteria 2960591022 2960595255 160
47 iso_pu_bacteria 2960631154 2960634344 160
48 iso_pu_bacteria 2960680706 2960683427 160
49 iso_pu_bacteria 2960693952 2960695279 160
50 iso_pu_bacteria 2967686174 2967688000 160
51 iso_pu_bacteria 2967728569 2967734048 160
52 iso_pu_bacteria 2970026789 2970028922 160
53 iso_pu_bacteria 2970122695 2970128489 160
54 iso_pu_bacteria 2970143518 2970147820 160
55 iso_pu_bacteria 2977530762 2977533925 160
56 iso_pu_bacteria 2977544691 2977548013 160
57 iso_pu_bacteria 8003999396 8004004069 160
58 3300048909 Ga0496106_0028852 Ga0496106_0028852_2355_2846 161
59 3300049568 Ga0501031_0028380 Ga0501031_0028380_1943_2434 161
60 3300049571 Ga0501034_0480344 Ga0501034_0480344_198_689 161
61 3300049574 Ga0501038_0339178 Ga0501038_0339178_143_634 161
62 3300049580 Ga0501046_0570396 Ga0501046_0570396_84_575 161
63 3300049581 Ga0501047_0300898 Ga0501047_0300898_791_1282 161
64 3300049582 Ga0501048_1046549 Ga0501048_1046549_56_547 161
65 3300049584 Ga0501068_0315535 Ga0501068_0315535_356_847 161
66 3300049741 Ga0501079_0683328 Ga0501079_0683328_305_796 161
67 3300049742 Ga0501080_0376057 Ga0501080_0376057_778_1269 161
68 3300049823 Ga0501044_0316376 Ga0501044_0316376_442_933 161
69 iso_pu_bacteria 2510917026 2511174262 161
70 iso_pu_bacteria 2919171160 2919174138 161
71 iso_pu_bacteria 2508501127 2509141096 162
72 iso_pu_bacteria 2597489875 2597815799 162
73 iso_pu_bacteria 2643221626 2644148902 162
74 iso_pu_bacteria 2643221698 2644547197 162
75 iso_pu_bacteria 2693429783 2694632603 162
76 iso_pu_bacteria 2693429784 2694639668 162
77 iso_pu_bacteria 2844163670 2844168121 162
78 iso_pu_bacteria 2856342000 2856346924 162
79 iso_pu_bacteria 2869169390 2869170975 162
80 iso_pu_bacteria 2869234852 2869239983 162
81 iso_pu_bacteria 2871435913 2871440919 162
82 iso_pu_bacteria 2871474448 2871478071 162
83 iso_pu_bacteria 2871481445 2871488321 162
84 iso_pu_bacteria 2874109183 2874109403 162
85 iso_pu_bacteria 2874116593 2874119799 162
86 iso_pu_bacteria 2876377896 2876384730 162
87 iso_pu_bacteria 2876420981 2876421903 162
88 iso_pu_bacteria 2888343758 2888349106 162
89 iso_pu_bacteria 2924741084 2924743197 162
90 iso_pu_bacteria 2924754689 2924759283 162
91 iso_pu_bacteria 2937836603 2937838779 162
92 iso_pu_bacteria 2937861824 2937868077 162
93 iso_pu_bacteria 2937980651 2937986087 162
94 iso_pu_bacteria 2938014810 2938015906 162
95 iso_pu_bacteria 2958071322 2958074482 162
96 iso_pu_bacteria 2958108152 2958113703 162
97 iso_pu_bacteria 2961183825 2961188681 162
98 iso_pu_bacteria 2970510686 2970511719 162
99 iso_pu_bacteria 2970524798 2970529096 162
100 iso_pu_bacteria 2970540015 2970546924 162
101 iso_pu_bacteria 2970619444 2970624341 162
102 iso_pu_bacteria 2970627176 2970633406 162
103 iso_pu_bacteria 2977851361 2977856671 162
104 iso_pu_bacteria 2977898635 2977907323 162
105 iso_pu_bacteria 2979764755 2979767498 162
106 iso_pu_bacteria 2979772303 2979777909 162
107 iso_pu_bacteria 2996336353 2996340042 162
108 iso_pu_bacteria 2996386984 2996391844 162
109 iso_pu_bacteria 3004248173 3004255803 162
110 iso_pu_bacteria 8004395343 8004397552 162
111 iso_pu_bacteria 8004633249 8004633717 162
112 iso_pu_bacteria 8004727605 8004733110 162
113 iso_pu_bacteria 8055617313 8055623421 162
114 3300049568 Ga0501031_0024061 Ga0501031_0024061_1256_1753 163
115 3300049569 Ga0501032_0018665 Ga0501032_0018665_1539_2036 163
116 3300049570 Ga0501033_0019061 Ga0501033_0019061_4063_4560 163
117 3300049572 Ga0501036_0157050 Ga0501036_0157050_56_553 163
118 3300049573 Ga0501037_0000076 Ga0501037_0000076_39103_39600 163
119 3300049574 Ga0501038_0073622 Ga0501038_0073622_1297_1794 163
120 3300049579 Ga0501043_0000039 Ga0501043_0000039_79556_80053 163
121 3300049581 Ga0501047_0619191 Ga0501047_0619191_293_790 163
122 3300049583 Ga0501067_0124849 Ga0501067_0124849_785_1282 163
123 3300049584 Ga0501068_0046401 Ga0501068_0046401_561_1058 163
124 3300049585 Ga0501069_0000022 Ga0501069_0000022_39103_39600 163
125 3300049586 Ga0501070_0000080 Ga0501070_0000080_42135_42632 163
126 3300049587 Ga0501071_0076256 Ga0501071_0076256_319_816 163
127 3300049590 Ga0501074_0000046 Ga0501074_0000046_39488_39985 163
128 3300049742 Ga0501080_0002310 Ga0501080_0002310_9460_9957 163
129 3300049744 Ga0501083_0000050 Ga0501083_0000050_69258_69755 163
130 3300049822 Ga0501035_0000318 Ga0501035_0000318_9118_9615 163
131 3300049823 Ga0501044_0000147 Ga0501044_0000147_79556_80053 163
132 3300060353 Ga0501082_0064584 Ga0501082_0064584_1953_2450 163
133 iso_pu_bacteria 2599185352 2600197257 163
134 iso_pu_bacteria 2643221550 2643773945 163
135 iso_pu_bacteria 2643221557 2643804847 163
136 iso_pu_bacteria 2643221564 2643838506 163
137 iso_pu_bacteria 2643221610 2644065691 163
138 iso_pu_bacteria 2643221668 2644376797 163
139 iso_pu_bacteria 2643221675 2644417583 163
140 iso_pu_bacteria 2643221680 2644453687 163
141 iso_pu_bacteria 2643221723 2644677771 163
142 iso_pu_bacteria 2643221726 2644688322 163
143 iso_pu_bacteria 2657244999 2657683361 163
144 iso_pu_bacteria 2791355082 2792580474 163
145 iso_pu_bacteria 2791355091 2792619480 163
146 iso_pu_bacteria 2791355092 2792627251 163
147 iso_pu_bacteria 2802429268 2804754693 163
148 iso_pu_bacteria 2920822456 2920826787 163
149 iso_pu_bacteria 8049293176 8049298489 163
150 3300044683 Ga0466965_0270737 Ga0466965_0270737_104_604 164
151 iso_pu_bacteria 2643221551 2643774690 164
152 iso_pu_bacteria 2643221555 2643793135 164
153 iso_pu_bacteria 2841911363 2841914645 164
154 iso_pu_bacteria 2841917233 2841920190 164
155 3300003215 JGI25153J46596_10063159 JGI25153J46596_100631591 165
156 3300003323 rootH1_10149305 rootH1_101493052 165
157 3300003781 Ga0055536_1002937 Ga0055536_100293710 165
158 3300003792 Ga0055540_1015246 Ga0055540_10152462 165
159 3300003794 Ga0055531_10000635 Ga0055531_1000063524 165
160 3300025292 Ga0209676_1000580 Ga0209676_10005803 165
161 3300025297 Ga0209758_1000115 Ga0209758_1000115193 165
162 3300025297 Ga0209758_1014450 Ga0209758_10144503 165
163 3300025303 Ga0209051_1002455 Ga0209051_100245512 165
164 3300025304 Ga0209257_1004493 Ga0209257_10044933 165
165 3300031548 Ga0307408_100548344 Ga0307408_1005483442 165
166 3300032004 Ga0307414_10503464 Ga0307414_105034641 165
167 3300049671 Ga0501238_003526 Ga0501238_003526_585_1088 165
168 3300049758 Ga0501241_003418 Ga0501241_003418_1730_2233 165
169 3300050516 nmdc:mga0sz30_372880_c1 nmdc:mga0sz30_372880_c1_96_599 165
170 iso_pu_bacteria 2582581283 2585167060 165
171 iso_pu_bacteria 2582581306 2585269901 165
172 iso_pu_bacteria 2582581865 2585390701 165
173 iso_pu_bacteria 2582581866 2585397618 165
174 iso_pu_bacteria 2585427633 2585992515 165
175 iso_pu_bacteria 2585427634 2586003271 165
176 iso_pu_bacteria 2643221607 2644047723 165
177 iso_pu_bacteria 2643221636 2644205859 165
178 iso_pu_bacteria 2643221686 2644481885 165
179 iso_pu_bacteria 2643221689 2644497511 165
180 3300002987 JGI25159J45721_1000075 JGI25159J45721_100007545 166
181 3300003354 JGI25160J50197_1000073 JGI25160J50197_10000733 166
182 3300003374 JGI25161J50226_1011597 JGI25161J50226_10115972 166
183 3300003771 Ga0055526_1008792 Ga0055526_10087925 166
184 3300003775 Ga0055524_1025043 Ga0055524_10250432 166
185 3300003781 Ga0055536_1000700 Ga0055536_10007005 166
186 3300003791 Ga0055530_10004287 Ga0055530_100042874 166
187 3300003794 Ga0055531_10019071 Ga0055531_100190713 166
188 3300004625 Ga0055543_1005815 Ga0055543_10058153 166
189 3300005262 Ga0065165_1000198 Ga0065165_10001983 166
190 3300009986 Ga0105033_102706 Ga0105033_1027063 166
191 3300013249 Ga0171463_1002 Ga0171463_10023 166
192 3300015690 Ga0183363_1056 Ga0183363_105630 166
193 3300025208 Ga0209436_102796 Ga0209436_1027963 166
194 3300025263 Ga0209565_1010300 Ga0209565_10103002 166
195 3300025284 Ga0209130_1000153 Ga0209130_10001533 166
196 3300025291 Ga0209675_1057259 Ga0209675_10572592 166
197 3300025292 Ga0209676_1000666 Ga0209676_100066616 166
198 3300025294 Ga0209025_1000333 Ga0209025_10003333 166
199 3300025294 Ga0209025_1027499 Ga0209025_10274994 166
200 3300025294 Ga0209025_1128660 Ga0209025_11286602 166
201 3300025295 Ga0209564_1000280 Ga0209564_10002803 166
202 3300025297 Ga0209758_1048867 Ga0209758_10488672 166
203 3300025298 Ga0209050_1000852 Ga0209050_100085229 166
204 3300025299 Ga0209256_1000064 Ga0209256_10000643 166
205 3300025299 Ga0209256_1001123 Ga0209256_10011233 166
206 3300025302 Ga0207426_1000280 Ga0207426_10002803 166
207 3300025303 Ga0209051_1010996 Ga0209051_10109963 166
208 3300025304 Ga0209257_1002180 Ga0209257_10021803 166
209 3300025304 Ga0209257_1012373 Ga0209257_10123733 166
210 3300037312 Ga0395899_0000030 Ga0395899_0000030_287566_288075 166
211 3300037418 Ga0395900_0000023 Ga0395900_0000023_293972_294481 166
212 3300037466 Ga0395898_0000038 Ga0395898_0000038_287566_288075 166
213 3300037471 Ga0395905_0000021 Ga0395905_0000021_287566_288075 166
214 3300038443 Ga0395901_0000018 Ga0395901_0000018_293972_294481 166
215 3300041405 Ga0439438_064822 Ga0439438_064822_351_863 166
216 3300041413 Ga0439465_0168575 Ga0439465_0168575_219_731 166
217 3300042015 Ga0439462_0048460 Ga0439462_0048460_507_1019 166
218 3300049568 Ga0501031_0421411 Ga0501031_0421411_280_810 166
219 3300049568 Ga0501031_0553369 Ga0501031_0553369_36_554 166
220 3300049570 Ga0501033_0021942 Ga0501033_0021942_789_1307 166
221 3300049570 Ga0501033_0073152 Ga0501033_0073152_1944_2450 166
222 3300049573 Ga0501037_0141047 Ga0501037_0141047_749_1267 166
223 3300049574 Ga0501038_0258554 Ga0501038_0258554_361_879 166
224 3300049574 Ga0501038_0656197 Ga0501038_0656197_67_573 166
225 3300049579 Ga0501043_0680365 Ga0501043_0680365_180_686 166
226 3300049579 Ga0501043_1025259 Ga0501043_1025259_26_556 166
227 3300049586 Ga0501070_0000959 Ga0501070_0000959_2868_3386 166
228 3300049586 Ga0501070_0050828 Ga0501070_0050828_1187_1717 166
229 3300049742 Ga0501080_0001756 Ga0501080_0001756_825_1343 166
230 3300049742 Ga0501080_0673562 Ga0501080_0673562_284_814 166
231 3300049822 Ga0501035_0002532 Ga0501035_0002532_106_624 166
232 3300049822 Ga0501035_0012226 Ga0501035_0012226_5483_6013 166
233 3300049822 Ga0501035_0022338 Ga0501035_0022338_360_866 166
234 3300049823 Ga0501044_0006413 Ga0501044_0006413_2497_3015 166
235 3300049823 Ga0501044_0016473 Ga0501044_0016473_7164_7670 166
236 3300049823 Ga0501044_0099577 Ga0501044_0099577_29_559 166
237 iso_pu_bacteria 2513237144 2513912263 166
238 iso_pu_bacteria 2513237351 2514591498 166
239 iso_pu_bacteria 2791355094 2792639852 166
240 iso_pu_bacteria 3005409236 3005413577 166
241 iso_pu_bacteria 8002285264 8002289591 166
242 3300005338 Ga0068868_101060856 Ga0068868_1010608561 167
243 3300013306 Ga0163162_11105420 Ga0163162_111054202 167
244 3300037312 Ga0395899_0104638 Ga0395899_0104638_1267_1779 167
245 3300037466 Ga0395898_0249451 Ga0395898_0249451_1085_1597 167
246 3300046460 Ga0495638_0012524 Ga0495638_0012524_3014_3523 167
247 3300046507 Ga0495606_0184734 Ga0495606_0184734_80_589 167
248 3300049571 Ga0501034_0460651 Ga0501034_0460651_333_848 167
249 3300049822 Ga0501035_0502624 Ga0501035_0502624_112_621 167
250 3300053139 Ga0500568_0000347 Ga0500568_0000347_7033_7548 167
251 3300053727 Ga0500611_121854 Ga0500611_121854_112_627 167
252 iso_pu_bacteria 2643221688 2644495303 167
253 iso_pu_bacteria 2848992105 2848997529 167
254 3300003322 rootL2_10079779 rootL2_100797792 169
255 3300028794 Ga0307515_10011471 Ga0307515_1001147110 169
256 3300042015 Ga0439462_0021790 Ga0439462_0021790_255_770 169
257 3300042531 Ga0450918_039569 Ga0450918_039569_223_738 169
258 3300046507 Ga0495606_0044036 Ga0495606_0044036_796_1311 169
259 3300048909 Ga0496106_0954440 Ga0496106_0954440_22_537 169
260 3300048917 Ga0496114_0091036 Ga0496114_0091036_933_1448 169
261 3300048922 Ga0496119_0330409 Ga0496119_0330409_93_608 169
262 3300049571 Ga0501034_1028801 Ga0501034_1028801_161_679 169
263 3300049586 Ga0501070_1179575 Ga0501070_1179575_25_549 169
264 3300049823 Ga0501044_0749354 Ga0501044_0749354_231_749 169
265 3300053099 Ga0500654_070444 Ga0500654_070444_1008_1523 169
266 3300053153 Ga0500616_0000104 Ga0500616_0000104_6343_6858 169
267 iso_pu_bacteria 2690316117 2692318419 169
268 iso_pu_bacteria 2751185821 2753459464 169
269 iso_pu_bacteria 2838074704 2838077739 169
270 iso_pu_bacteria 2847417321 2847423078 169
271 iso_pu_bacteria 2855872281 2855874065 169
272 iso_pu_bacteria 2896384573 2896391852 169
273 iso_pu_bacteria 2920760137 2920765007 169
274 3300003203 JGI25406J46586_10008156 JGI25406J46586_100081564 170
275 3300003771 Ga0055526_1031310 Ga0055526_10313102 170
276 3300003790 Ga0055528_1000236 Ga0055528_100023621 170
277 3300005262 Ga0065165_1006556 Ga0065165_10065566 170
278 3300005983 Ga0081540_1042239 Ga0081540_10422392 170
279 3300005985 Ga0081539_10001043 Ga0081539_1000104338 170
280 3300006038 Ga0075365_10272293 Ga0075365_102722932 170
281 3300006048 Ga0075363_100435368 Ga0075363_1004353682 170
282 3300006946 Ga0079104_1021120 Ga0079104_10211202 170
283 3300021320 Ga0214544_1000646 Ga0214544_100064662 170
284 3300021321 Ga0214542_1000027 Ga0214542_100002767 170
285 3300021327 Ga0214543_1000047 Ga0214543_100004741 170
286 3300025273 Ga0209673_1000005 Ga0209673_1000005551 170
287 3300025273 Ga0209673_1037725 Ga0209673_10377252 170
288 3300025292 Ga0209676_1021102 Ga0209676_10211023 170
289 3300025294 Ga0209025_1004799 Ga0209025_10047998 170
290 3300025295 Ga0209564_1007471 Ga0209564_10074716 170
291 3300025295 Ga0209564_1069805 Ga0209564_10698051 170
292 3300025304 Ga0209257_1084334 Ga0209257_10843342 170
293 3300025972 Ga0207668_10554625 Ga0207668_105546252 170
294 3300027111 Ga0209281_1000463 Ga0209281_100046339 170
295 3300031824 Ga0307413_10121619 Ga0307413_101216193 170
296 3300031911 Ga0307412_10435747 Ga0307412_104357472 170
297 3300032002 Ga0307416_102550867 Ga0307416_1025508671 170
298 3300041413 Ga0439465_0040692 Ga0439465_0040692_469_1023 170
299 3300042007 Ga0439449_0050325 Ga0439449_0050325_948_1502 170
300 3300046507 Ga0495606_0004073 Ga0495606_0004073_12806_13324 170
301 3300046507 Ga0495606_0349070 Ga0495606_0349070_120_638 170
302 3300047472 Ga0495686_0000090 Ga0495686_0000090_46776_47294 170
303 3300047472 Ga0495686_0023716 Ga0495686_0023716_1298_1816 170
304 3300048903 Ga0496100_0388694 Ga0496100_0388694_112_630 170
305 3300048910 Ga0496107_0340826 Ga0496107_0340826_221_739 170
306 3300048920 Ga0496117_0209798 Ga0496117_0209798_438_956 170
307 3300048921 Ga0496118_0241928 Ga0496118_0241928_240_758 170
308 3300048924 Ga0496121_0137551 Ga0496121_0137551_1137_1655 170
309 3300048924 Ga0496121_0592596 Ga0496121_0592596_95_613 170
310 3300048927 Ga0496124_0449345 Ga0496124_0449345_253_771 170
311 3300048928 Ga0496125_0217894 Ga0496125_0217894_109_627 170
312 3300048929 Ga0496126_0248677 Ga0496126_0248677_772_1290 170
313 3300049568 Ga0501031_0075108 Ga0501031_0075108_545_1075 170
314 3300049568 Ga0501031_0175824 Ga0501031_0175824_560_1087 170
315 3300049569 Ga0501032_0219204 Ga0501032_0219204_545_1075 170
316 3300049570 Ga0501033_0093360 Ga0501033_0093360_1126_1656 170
317 3300049570 Ga0501033_0151109 Ga0501033_0151109_1015_1542 170
318 3300049570 Ga0501033_0251725 Ga0501033_0251725_611_1138 170
319 3300049570 Ga0501033_0694768 Ga0501033_0694768_114_641 170
320 3300049571 Ga0501034_0066604 Ga0501034_0066604_2513_3031 170
321 3300049571 Ga0501034_0162878 Ga0501034_0162878_545_1075 170
322 3300049571 Ga0501034_0584110 Ga0501034_0584110_460_987 170
323 3300049572 Ga0501036_0019982 Ga0501036_0019982_560_1087 170
324 3300049572 Ga0501036_0273300 Ga0501036_0273300_341_871 170
325 3300049572 Ga0501036_0530539 Ga0501036_0530539_126_653 170
326 3300049573 Ga0501037_0091436 Ga0501037_0091436_545_1075 170
327 3300049574 Ga0501038_0117141 Ga0501038_0117141_1126_1656 170
328 3300049575 Ga0501039_0272031 Ga0501039_0272031_545_1075 170
329 3300049579 Ga0501043_0064479 Ga0501043_0064479_2299_2832 170
330 3300049579 Ga0501043_0081435 Ga0501043_0081435_429_956 170
331 3300049579 Ga0501043_0153625 Ga0501043_0153625_276_803 170
332 3300049579 Ga0501043_0432820 Ga0501043_0432820_102_629 170
333 3300049580 Ga0501046_0032902 Ga0501046_0032902_367_894 170
334 3300049580 Ga0501046_0054919 Ga0501046_0054919_2058_2588 170
335 3300049580 Ga0501046_0359062 Ga0501046_0359062_354_887 170
336 3300049581 Ga0501047_0104986 Ga0501047_0104986_122_655 170
337 3300049581 Ga0501047_0107542 Ga0501047_0107542_1015_1545 170
338 3300049581 Ga0501047_0128670 Ga0501047_0128670_1405_1932 170
339 3300049585 Ga0501069_0084597 Ga0501069_0084597_739_1272 170
340 3300049585 Ga0501069_0113825 Ga0501069_0113825_317_850 170
341 3300049585 Ga0501069_0202815 Ga0501069_0202815_527_1054 170
342 3300049586 Ga0501070_0043140 Ga0501070_0043140_1411_1938 170
343 3300049586 Ga0501070_0249695 Ga0501070_0249695_576_1103 170
344 3300049587 Ga0501071_0116632 Ga0501071_0116632_1382_1915 170
345 3300049588 Ga0501072_0087265 Ga0501072_0087265_412_942 170
346 3300049588 Ga0501072_0365843 Ga0501072_0365843_590_1123 170
347 3300049589 Ga0501073_0131988 Ga0501073_0131988_124_651 170
348 3300049589 Ga0501073_0231531 Ga0501073_0231531_663_1196 170
349 3300049590 Ga0501074_0043359 Ga0501074_0043359_2579_3106 170
350 3300049590 Ga0501074_0491753 Ga0501074_0491753_31_564 170
351 3300049742 Ga0501080_0070387 Ga0501080_0070387_214_741 170
352 3300049742 Ga0501080_0098204 Ga0501080_0098204_1338_1871 170
353 3300049744 Ga0501083_0137415 Ga0501083_0137415_1015_1548 170
354 3300049744 Ga0501083_0667116 Ga0501083_0667116_86_613 170
355 3300049822 Ga0501035_0002603 Ga0501035_0002603_3017_3550 170
356 3300049822 Ga0501035_0168028 Ga0501035_0168028_684_1217 170
357 3300049822 Ga0501035_0297480 Ga0501035_0297480_286_816 170
358 3300049822 Ga0501035_0766360 Ga0501035_0766360_222_749 170
359 3300049823 Ga0501044_0163549 Ga0501044_0163549_1126_1656 170
360 3300049823 Ga0501044_0384822 Ga0501044_0384822_669_1202 170
361 3300049823 Ga0501044_1059828 Ga0501044_1059828_16_534 170
362 3300050492 nmdc:mga0yw44_179270_c1 nmdc:mga0yw44_179270_c1_840_1358 170
363 3300053158 Ga0500627_0248662 Ga0500627_0248662_133_651 170
364 3300060353 Ga0501082_0556631 Ga0501082_0556631_31_564 170
365 iso_pu_bacteria 2508501122 2509111075 170
366 iso_pu_bacteria 2509276019 2509379405 170
367 iso_pu_bacteria 2510065057 2510307909 170
368 iso_pu_bacteria 2511231052 2511498217 170
369 iso_pu_bacteria 2512047086 2512529373 170
370 iso_pu_bacteria 2513237086 2513586863 170
371 iso_pu_bacteria 2513237091 2513619668 170
372 iso_pu_bacteria 2513237140 2513885162 170
373 iso_pu_bacteria 2513237143 2513906249 170
374 iso_pu_bacteria 2515154107 2515610790 170
375 iso_pu_bacteria 2516653046 2516896140 170
376 iso_pu_bacteria 2524023207 2524449574 170
377 iso_pu_bacteria 2551306084 2551674959 170
378 iso_pu_bacteria 2551306085 2551687275 170
379 iso_pu_bacteria 2551306086 2551692451 170
380 iso_pu_bacteria 2551306087 2551697829 170
381 iso_pu_bacteria 2551306089 2551708271 170
382 iso_pu_bacteria 2551306090 2551721592 170
383 iso_pu_bacteria 2551306091 2551728189 170
384 iso_pu_bacteria 2551306092 2551734452 170
385 iso_pu_bacteria 2551306093 2551743246 170
386 iso_pu_bacteria 2855825444 2855829035 170
387 iso_pu_bacteria 2855839649 2855844153 170
388 iso_pu_bacteria 2858800743 2858806597 170
389 iso_pu_bacteria 2915986958 2915992201 170
390 iso_pu_bacteria 2915993759 2915999275 170
391 iso_pu_bacteria 2916000859 2916001344 170
392 iso_pu_bacteria 2916007675 2916011604 170
393 iso_pu_bacteria 2916014648 2916018863 170
394 iso_pu_bacteria 2916021584 2916026070 170
395 iso_pu_bacteria 2916028427 2916032103 170
396 iso_pu_bacteria 2916035215 2916039049 170
397 iso_pu_bacteria 2916041962 2916046160 170
398 iso_pu_bacteria 2916048683 2916051895 170
399 iso_pu_bacteria 2916055098 2916060884 170
400 iso_pu_bacteria 2916076590 2916077367 170
401 iso_pu_bacteria 2921201388 2921203580 170
402 iso_pu_bacteria 2921208531 2921209484 170
403 iso_pu_bacteria 2921237296 2921237923 170
404 iso_pu_bacteria 2921244191 2921248297 170
405 iso_pu_bacteria 2921257292 2921260988 170
406 iso_pu_bacteria 2921263974 2921267903 170
407 iso_pu_bacteria 2921282425 2921287075 170
408 iso_pu_bacteria 2921289301 2921289707 170
409 iso_pu_bacteria 2921296804 2921297441 170
410 iso_pu_bacteria 2921296804 2921303786 170
411 iso_pu_bacteria 2924144063 2924145720 170
412 iso_pu_bacteria 2924150972 2924155838 170
413 iso_pu_bacteria 2924158325 2924162439 170
414 iso_pu_bacteria 2924165586 2924171304 170
415 iso_pu_bacteria 2924172951 2924179573 170
416 iso_pu_bacteria 2924179722 2924183392 170
417 iso_pu_bacteria 2924186466 2924192009 170
418 iso_pu_bacteria 2924200457 2924204585 170
419 iso_pu_bacteria 2924214083 2924220840 170
420 iso_pu_bacteria 2924221636 2924223533 170
421 iso_pu_bacteria 2924228884 2924234620 170
422 iso_pu_bacteria 2936996657 2937002241 170
423 iso_pu_bacteria 2937002841 2937007233 170
424 iso_pu_bacteria 2937009748 2937015209 170
425 iso_pu_bacteria 2937016420 2937020754 170
426 iso_pu_bacteria 2937023124 2937026942 170
427 iso_pu_bacteria 2937042894 2937048054 170
428 iso_pu_bacteria 2937049772 2937054133 170
429 iso_pu_bacteria 2937056579 2937060588 170
430 iso_pu_bacteria 2937063883 2937068022 170
431 iso_pu_bacteria 2937071275 2937076992 170
432 iso_pu_bacteria 2937091812 2937095327 170
433 iso_pu_bacteria 2937098957 2937103592 170
434 iso_pu_bacteria 2937106411 2937110309 170
435 iso_pu_bacteria 2937113482 2937117184 170
436 iso_pu_bacteria 2937119839 2937123595 170
437 iso_pu_bacteria 2937126314 2937130530 170
438 iso_pu_bacteria 2957382221 2957386358 170
439 iso_pu_bacteria 2957388812 2957392779 170
440 iso_pu_bacteria 2957395598 2957401471 170
441 iso_pu_bacteria 2957402308 2957406654 170
442 iso_pu_bacteria 2957408893 2957413655 170
443 iso_pu_bacteria 2957415311 2957420931 170
444 iso_pu_bacteria 2957422303 2957427378 170
445 iso_pu_bacteria 2957443900 2957449187 170
446 iso_pu_bacteria 2957450854 2957452272 170
447 iso_pu_bacteria 2957457609 2957461451 170
448 iso_pu_bacteria 2957464669 2957468589 170
449 iso_pu_bacteria 2957471148 2957471578 170
450 iso_pu_bacteria 2957478035 2957484262 170
451 iso_pu_bacteria 2957484790 2957488629 170
452 iso_pu_bacteria 2957491536 2957497254 170
453 iso_pu_bacteria 2957498199 2957505321 170
454 iso_pu_bacteria 2957505466 2957509668 170
455 iso_pu_bacteria 2960584000 2960587154 170
456 iso_pu_bacteria 2960597568 2960601087 170
457 iso_pu_bacteria 2960603979 2960608837 170
458 iso_pu_bacteria 2960610863 2960615802 170
459 iso_pu_bacteria 2960617483 2960622064 170
460 iso_pu_bacteria 2960624210 2960625727 170
461 iso_pu_bacteria 2960637947 2960645325 170
462 iso_pu_bacteria 2960645483 2960649761 170
463 iso_pu_bacteria 2960652885 2960655382 170
464 iso_pu_bacteria 2960660292 2960665633 170
465 iso_pu_bacteria 2960667422 2960671618 170
466 iso_pu_bacteria 2960674078 2960679889 170
467 iso_pu_bacteria 2960687367 2960690034 170
468 iso_pu_bacteria 2964607997 2964611943 170
469 iso_pu_bacteria 2964615318 2964619650 170
470 iso_pu_bacteria 2964621998 2964626932 170
471 iso_pu_bacteria 2964628898 2964636015 170
472 iso_pu_bacteria 2964636051 2964640073 170
473 iso_pu_bacteria 2964643177 2964647452 170
474 iso_pu_bacteria 2964649959 2964653793 170
475 iso_pu_bacteria 2964656573 2964663405 170
476 iso_pu_bacteria 2964663802 2964669191 170
477 iso_pu_bacteria 2964670856 2964673149 170
478 iso_pu_bacteria 2964678106 2964682790 170
479 iso_pu_bacteria 2964685014 2964690176 170
480 iso_pu_bacteria 2964691889 2964695605 170
481 iso_pu_bacteria 2964698721 2964703755 170
482 iso_pu_bacteria 2964705432 2964711582 170
483 iso_pu_bacteria 2964712639 2964716259 170
484 iso_pu_bacteria 2964719344 2964724930 170
485 iso_pu_bacteria 2967664464 2967667586 170
486 iso_pu_bacteria 2967671571 2967677188 170
487 iso_pu_bacteria 2967678726 2967683347 170
488 iso_pu_bacteria 2967693043 2967697001 170
489 iso_pu_bacteria 2967699805 2967703950 170
490 iso_pu_bacteria 2967706974 2967711165 170
491 iso_pu_bacteria 2967714385 2967718410 170
492 iso_pu_bacteria 2967721400 2967726999 170
493 iso_pu_bacteria 2967735183 2967738805 170
494 iso_pu_bacteria 2967742019 2967747970 170
495 iso_pu_bacteria 2967755722 2967759410 170
496 iso_pu_bacteria 2967762386 2967766269 170
497 iso_pu_bacteria 2967769361 2967773548 170
498 iso_pu_bacteria 2967775926 2967780789 170
499 iso_pu_bacteria 2970019648 2970020137 170
500 iso_pu_bacteria 2970033650 2970035653 170
501 iso_pu_bacteria 2970040964 2970046420 170
502 iso_pu_bacteria 2970047711 2970051664 170
503 iso_pu_bacteria 2970054988 2970059181 170
504 iso_pu_bacteria 2970061556 2970065414 170
505 iso_pu_bacteria 2970068827 2970074097 170
506 iso_pu_bacteria 2970076120 2970080740 170
507 iso_pu_bacteria 2970082768 2970087090 170
508 iso_pu_bacteria 2970088815 2970093146 170
509 iso_pu_bacteria 2970095765 2970099658 170
510 iso_pu_bacteria 2970102677 2970106499 170
511 iso_pu_bacteria 2970109326 2970113706 170
512 iso_pu_bacteria 2970116247 2970120074 170
513 iso_pu_bacteria 2970129317 2970135716 170
514 iso_pu_bacteria 2970136068 2970141910 170
515 iso_pu_bacteria 2970149975 2970154078 170
516 iso_pu_bacteria 2970156795 2970161908 170
517 iso_pu_bacteria 2970164137 2970168093 170
518 iso_pu_bacteria 2970170962 2970176147 170
519 iso_pu_bacteria 2970177841 2970184555 170
520 iso_pu_bacteria 2970184632 2970190224 170
521 iso_pu_bacteria 2970191845 2970195943 170
522 iso_pu_bacteria 2977516862 2977523663 170
523 iso_pu_bacteria 2977523885 2977529778 170
524 iso_pu_bacteria 2977537788 2977541604 170
525 iso_pu_bacteria 2977551784 2977556288 170
526 iso_pu_bacteria 2977558990 2977565772 170
527 iso_pu_bacteria 2977565890 2977570197 170
528 iso_pu_bacteria 2977572785 2977576936 170
529 iso_pu_bacteria 2977579622 2977583437 170
530 iso_pu_bacteria 648276728 648738321 170
531 iso_pu_bacteria 8003992118 8003996734 170
532 3300002773 JGI25152J39213_1009524 JGI25152J39213_10095242 180
533 3300003187 JGI25151J46595_10006663 JGI25151J46595_100066634 180
534 3300025258 Ga0209129_1000016 Ga0209129_10000164 180
535 3300025294 Ga0209025_1000502 Ga0209025_100050226 180
536 3300025303 Ga0209051_1022900 Ga0209051_10229003 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08808

RES

RES domain

25

181

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gug-assembly1.cif.gz_A-2 structure of vpa0770 toxin bound to vpa0769 antitoxin in vibrio parahaemolyticus 0.6797 11 151
6gw6-assembly1.cif.gz_D structure of the pseudomonas putida res-xre toxin-antitoxin complex 0.6442 11 159
6gw6-assembly1.cif.gz_D structure of the pseudomonas putida res-xre toxin-antitoxin complex 0.6078 11 159
6d0i-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars. l48m part, semet-substituted complex. 0.6048 8 144
8gug-assembly1.cif.gz_A-2 structure of vpa0770 toxin bound to vpa0769 antitoxin in vibrio parahaemolyticus 0.5932 11 151
ID Description Score Start End Superfamily
af_E7FFW9_16_115_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.5497 1 75 3.90.228.10
af_Q57805_1_214_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.547 8 158 3.90.228.10
2a5gB00 Alpha Beta;Alpha-Beta Complex;Heat-Labile Enterotoxin; Chain A;Heat-Labile Enterotoxin, subunit A 0.4896 8 77 3.90.210.10
af_Q9UK61_166_319_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.4882 8 81 3.90.228.10
2auaA01 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;ADP-ribosylation domain 0.4848 1 77 3.20.170.10
ID Description Score Start End GO Terms
AF-A0A527FXA8-F1-model_v4 RES domain-containing protein 0.964 74 149
AF-A0A530M2J5-F1-model_v4 RES domain-containing protein 0.9309 88 149
AF-A0A559TF01-F1-model_v4 RES domain-containing protein 0.9204 11 155
AF-A0A436HA58-F1-model_v4 RES domain-containing protein 0.9187 45 162
AF-A0A1S1T7E3-F1-model_v4 RES domain-containing protein 0.9132 5 157

Feature Viewer

pLDDT pTM Quality
74.94 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map