F460901

General Info

Members Datasets Scaffolds Average Seq Length
537 316 1074 559

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10004451|Ga0105240_1000445113
Length 621
Sequence LLFDTFQSFINIFNQTVDRILFFFKCIYWNICIFKKISVVLTRIIKPIMDKNQFVIGVDYGSDSVRSVLINAVNGEEIASSVFNYPRWRDGLYCNAAENQFRQHPLDYIEGLEFTIKECIEKAGGKSIVHAIKGLSVDTTGSTPVAVNESGIPLALTPGFERNPNAMFILWKDHTSVVEAAQINEHATKFDINYLKYVGGIYSSEWFWAKLLHILRTDEQVHQACHSWVEHCDWIPFLLTGGKKANEIKRGRCSAGHKALWAEEFGGLPPDEFFSSLDPLLKGFTFKLFNETFTSDQKAGYLSKEWAERLGLTTEVAVGVGAFDAHMGAVGGQIEPYHLSKVMGTSTCDILVAPADEMKGKLVKGICGQVNGSVIPGMIGLEAGQSAFGDTYAWFKKVLSWPLDNLLKDSKVIDAVTAEALRNDFSERIIPELSRQAQLLPFDQETELAIDWFNGRRTPDADQTLKGAITGLNLGSDAPKIFRSLAEATCFGAKAIVDRFSKEGIPVKGIIGIGGVAKKSPFVMQMMADVLGMPIRIHQFEHTCALGAAMFAAVVADIYPTVEDAMVAMGRGFDVEYYPNAELRDIYAKRYKQYHDLGNFVAWQTGLHSAVNVQQTDPILL

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
138 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
139 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
149 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
161 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
171 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
190 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
194 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
224 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
227 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
233 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
234 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
235 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
236 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
237 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
238 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
239 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
240 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
241 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
242 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
243 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
244 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
245 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
246 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
247 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
248 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
249 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
250 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
251 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
252 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
253 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
254 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
255 2738541283 Pedobacter sp. OK701 Isolate Unclassified
256 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
257 2738541302 Pedobacter sp. CF074 Isolate Unclassified
258 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
259 2738543023 Pedobacter sp. OK628 Isolate Unclassified
260 2739367651 Pedobacter sp. OK291 Isolate Unclassified
261 2739367656 Pedobacter sp. CF523 Isolate Unclassified
262 2739367663 Pedobacter sp. YR510 Isolate Unclassified
263 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
264 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
265 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
266 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
267 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
268 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
269 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
270 2818991437 Pedobacter terrae 518 Isolate Unclassified
271 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
272 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
273 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
274 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
275 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
276 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
277 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
278 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
279 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
280 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
281 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
282 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
283 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
284 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
285 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
286 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
287 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
288 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
289 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
290 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
291 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
292 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
293 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
294 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
295 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
296 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
297 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
298 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
299 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
300 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
301 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
302 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
303 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
304 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
305 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
306 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
307 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
308 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
309 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
310 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
311 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
312 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
313 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
314 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
315 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
316 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.66
Metatranscriptomes 0
Isolates 14.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 6.33
Nodule 1.12
Rhizoplane 0.56
Rhizosphere 78.03
Stem 0
Stem Tuber 0
Unclassified 1.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10004451 3300009093 Bacteria 21371
2 MRS2a_Contig_373 2124908027 Bacteria 2059
3 SwRhRL2b_contig_1128713 2162886007 Bacteria 40208
4 SwRhRL2b_contig_904052 2162886007 Bacteria 14886
5 JGI24739J22299_10017457 3300001989 Bacteria 2589
6 JGI24737J22298_10000722 3300001990 Bacteria 11635
7 JGI24737J22298_10002911 3300001990 Bacteria 6069
8 JGI24735J21928_10000009 3300002067 Bacteria 247425
9 JGI25162J39368_1000292 3300002737 Bacteria 46381
10 JGI25164J39214_1002075 3300002772 Bacteria 3455
11 JGI25152J39213_1000168 3300002773 Bacteria 44576
12 JGI25150J39212_1000019 3300002774 Bacteria 135244
13 JGI25151J46595_10000074 3300003187 Bacteria 135244
14 JGI25165J46597_1000899 3300003214 Bacteria 20681
15 JGI25153J46596_10000056 3300003215 Bacteria 135244
16 rootH1_10063162 3300003316 Bacteria 17351
17 rootH2_10004828 3300003320 Bacteria 9895
18 rootH2_10011163 3300003320 Bacteria 5638
19 rootH2_10016199 3300003320 Bacteria 99895
20 rootL2_10098561 3300003322 Bacteria 2815
21 rootH1_10004761 3300003323 Bacteria 43462
22 rootH1_10017992 3300003323 Bacteria 3825
23 rootH1_10020752 3300003323 Bacteria 10143
24 rootH1_10173249 3300003323 Bacteria 3923
25 JGI25160J50197_1000262 3300003354 Bacteria 39642
26 Ga0055536_1000011 3300003781 Bacteria 275969
27 Ga0055531_10000327 3300003794 Bacteria 46934
28 Ga0065714_10001936 3300005288 Bacteria 75145
29 Ga0065714_10004920 3300005288 Bacteria 8261
30 Ga0065714_10021939 3300005288 Bacteria 1905
31 Ga0065714_10064466 3300005288 Bacteria 64823
32 Ga0065714_10064574 3300005288 Bacteria 33091
33 Ga0065714_10065077 3300005288 Bacteria 13190
34 Ga0065714_10070011 3300005288 Bacteria 4000
35 Ga0065704_10000199 3300005289 Bacteria 297176
36 Ga0065704_10000219 3300005289 Bacteria 83241
37 Ga0065704_10002606 3300005289 Bacteria 5648
38 Ga0065704_10075970 3300005289 Bacteria 5324
39 Ga0065704_10088246 3300005289 Bacteria 2955
40 Ga0070658_10000019 3300005327 Bacteria 194742
41 Ga0070658_10003094 3300005327 Bacteria 13730
42 Ga0070658_10080530 3300005327 Bacteria 2675
43 Ga0070676_10000907 3300005328 Bacteria 14668
44 Ga0070683_100005004 3300005329 Bacteria 10998
45 Ga0070683_100010840 3300005329 Bacteria 7847
46 Ga0070670_100167370 3300005331 Bacteria 1906
47 Ga0070666_10002042 3300005335 Bacteria 12260
48 Ga0070666_10022706 3300005335 Bacteria 4077
49 Ga0070682_100000964 3300005337 Bacteria 16750
50 Ga0068868_100002007 3300005338 Bacteria 14002
51 Ga0068868_100004013 3300005338 Bacteria 10275
52 Ga0068868_100029572 3300005338 Bacteria 4196
53 Ga0070660_100000583 3300005339 Bacteria 24522
54 Ga0070660_100015409 3300005339 Bacteria 5520
55 Ga0070691_10007713 3300005341 Bacteria 4930
56 Ga0070668_100000379 3300005347 Bacteria 29313
57 Ga0070671_100001609 3300005355 Bacteria 17019
58 Ga0070673_100001339 3300005364 Bacteria 14360
59 Ga0070659_100000417 3300005366 Bacteria 32306
60 Ga0070667_100000907 3300005367 Bacteria 27358
61 Ga0070663_100015107 3300005455 Bacteria 4972
62 Ga0070678_100001445 3300005456 Bacteria 12657
63 Ga0070662_100000011 3300005457 Bacteria 133652
64 Ga0070662_100000020 3300005457 Bacteria 99425
65 Ga0070662_100008497 3300005457 Bacteria 6703
66 Ga0070681_10014621 3300005458 Bacteria 7811
67 Ga0068867_100000136 3300005459 Bacteria 47486
68 Ga0070679_100000364 3300005530 Bacteria 38564
69 Ga0070679_100001518 3300005530 Bacteria 20674
70 Ga0070679_100001706 3300005530 Bacteria 19793
71 Ga0070684_100015944 3300005535 Bacteria 6136
72 Ga0070684_100061390 3300005535 Bacteria 3290
73 Ga0070684_100061646 3300005535 Bacteria 3283
74 Ga0068853_100001721 3300005539 Bacteria 16030
75 Ga0068853_100004820 3300005539 Bacteria 10489
76 Ga0068853_100017751 3300005539 Bacteria 5874
77 Ga0068853_100021734 3300005539 Bacteria 5353
78 Ga0068853_100026331 3300005539 Bacteria 4883
79 Ga0070672_100002460 3300005543 Bacteria 11759
80 Ga0070665_100001529 3300005548 Bacteria 26767
81 Ga0068855_100000009 3300005563 Bacteria 246035
82 Ga0068855_100001312 3300005563 Bacteria 30806
83 Ga0068855_100007477 3300005563 Bacteria 13227
84 Ga0068855_100020504 3300005563 Bacteria 7926
85 Ga0068855_100040412 3300005563 Bacteria 5536
86 Ga0068855_100137595 3300005563 Bacteria 2786
87 Ga0068855_100143854 3300005563 Bacteria 2716
88 Ga0068856_100000169 3300005614 Bacteria 67660
89 Ga0068856_100088818 3300005614 Bacteria 3073
90 Ga0068856_100096325 3300005614 Bacteria 2948
91 Ga0068852_100006093 3300005616 Bacteria 8690
92 Ga0068852_100044487 3300005616 Bacteria 3771
93 Ga0068852_100053963 3300005616 Bacteria 3463
94 Ga0068859_100095349 3300005617 Bacteria 3028
95 Ga0068866_10024252 3300005718 Bacteria 2833
96 Ga0068851_10001692 3300005834 Bacteria 9647
97 Ga0068851_10018687 3300005834 Bacteria 3342
98 Ga0068863_100004330 3300005841 Bacteria 13988
99 Ga0068858_100000469 3300005842 Bacteria 42105
100 Ga0068860_100009068 3300005843 Bacteria 9901
101 Ga0097621_100000178 3300006237 Bacteria 40367
102 Ga0068871_100000045 3300006358 Bacteria 67014
103 Ga0068865_100000067 3300006881 Bacteria 54449
104 Ga0068865_100010233 3300006881 Bacteria 5832
105 Ga0097620_100095348 3300006931 Bacteria 3028
106 Ga0099824_1022130 3300006942 Bacteria 4261
107 Ga0079104_1000079 3300006946 Bacteria 141480
108 Ga0099826_10000622 3300006948 Bacteria 18126
109 Ga0105244_10000054 3300009036 Bacteria 133715
110 Ga0105244_10000732 3300009036 Bacteria 28194
111 Ga0105240_10000008 3300009093 Bacteria 618862
112 Ga0105240_10000193 3300009093 Bacteria 124087
113 Ga0105240_10001190 3300009093 Bacteria 45471
114 Ga0105240_10027445 3300009093 Bacteria 7451
115 Ga0105240_10071565 3300009093 Bacteria 4288
116 Ga0105240_10145417 3300009093 Bacteria 2829
117 Ga0105240_10253004 3300009093 Bacteria 2036
118 Ga0105240_10274420 3300009093 Bacteria 1940
119 Ga0111539_10038921 3300009094 Bacteria 5735
120 Ga0105243_10000057 3300009148 Bacteria 132877
121 Ga0105241_10000134 3300009174 Bacteria 53667
122 Ga0105241_10002510 3300009174 Bacteria 13785
123 Ga0105241_10003725 3300009174 Bacteria 11322
124 Ga0105241_10037280 3300009174 Bacteria 3662
125 Ga0105237_10000343 3300009545 Bacteria 65610
126 Ga0105237_10000417 3300009545 Bacteria 60658
127 Ga0105237_10000943 3300009545 Bacteria 39090
128 Ga0105237_10001192 3300009545 Bacteria 34799
129 Ga0105237_10001556 3300009545 Bacteria 29902
130 Ga0105237_10181438 3300009545 Bacteria 2105
131 Ga0105238_10005014 3300009551 Bacteria 13086
132 Ga0105238_10067868 3300009551 Unclassified 3567
133 Ga0105239_10000006 3300010375 Bacteria 442319
134 Ga0105239_10000305 3300010375 Bacteria 72644
135 Ga0105239_10000482 3300010375 Bacteria 58131
136 Ga0105239_10000996 3300010375 Bacteria 39663
137 Ga0105239_10001766 3300010375 Bacteria 28448
138 Ga0157373_10000015 3300013100 Bacteria 183381
139 Ga0157373_10000035 3300013100 Bacteria 123284
140 Ga0157373_10000097 3300013100 Bacteria 71713
141 Ga0157373_10000310 3300013100 Bacteria 39441
142 Ga0157373_10010465 3300013100 Bacteria 6822
143 Ga0157371_10000037 3300013102 Bacteria 214866
144 Ga0157371_10000139 3300013102 Bacteria 104697
145 Ga0157371_10000684 3300013102 Bacteria 40124
146 Ga0157371_10000708 3300013102 Bacteria 39139
147 Ga0157371_10002855 3300013102 Bacteria 16144
148 Ga0157371_10004254 3300013102 Bacteria 12590
149 Ga0157371_10034328 3300013102 Bacteria 3639
150 Ga0157371_10041266 3300013102 Bacteria 3294
151 Ga0157370_10001800 3300013104 Bacteria 26427
152 Ga0157370_10002522 3300013104 Bacteria 22020
153 Ga0157370_10003225 3300013104 Bacteria 19260
154 Ga0157370_10003712 3300013104 Bacteria 17841
155 Ga0157370_10003823 3300013104 Bacteria 17554
156 Ga0157370_10006984 3300013104 Bacteria 12335
157 Ga0157370_10009368 3300013104 Bacteria 10474
158 Ga0157370_10015791 3300013104 Bacteria 7662
159 Ga0157370_10092243 3300013104 Bacteria 2843
160 Ga0157370_10144327 3300013104 Bacteria 2217
161 Ga0157369_10000002 3300013105 Bacteria 524510
162 Ga0157369_10000235 3300013105 Bacteria 76779
163 Ga0157369_10001134 3300013105 Bacteria 33314
164 Ga0157369_10012614 3300013105 Bacteria 9584
165 Ga0157369_10014069 3300013105 Bacteria 9040
166 Ga0157369_10023316 3300013105 Bacteria 6894
167 Ga0157374_10000001 3300013296 Bacteria 1077351
168 Ga0157374_10000079 3300013296 Bacteria 95883
169 Ga0157374_10002137 3300013296 Bacteria 16657
170 Ga0157374_10002296 3300013296 Bacteria 16108
171 Ga0157378_10018206 3300013297 Bacteria 6167
172 Ga0163162_10000024 3300013306 Bacteria 188515
173 Ga0163162_10001849 3300013306 Bacteria 19921
174 Ga0163162_10006294 3300013306 Bacteria 11497
175 Ga0163162_10007797 3300013306 Bacteria 10436
176 Ga0163162_10074046 3300013306 Bacteria 3463
177 Ga0157372_10000099 3300013307 Bacteria 89946
178 Ga0157372_10001590 3300013307 Bacteria 24713
179 Ga0157372_10002607 3300013307 Bacteria 19503
180 Ga0157372_10009327 3300013307 Bacteria 10440
181 Ga0157372_10187660 3300013307 Unclassified 2394
182 Ga0157375_10000052 3300013308 Bacteria 130032
183 Ga0157375_10000801 3300013308 Bacteria 27588
184 Ga0157375_10097942 3300013308 Bacteria 3008
185 Ga0157375_10136916 3300013308 Bacteria 2574
186 Ga0163163_10000428 3300014325 Bacteria 38722
187 Ga0182008_10000319 3300014497 Bacteria 37848
188 Ga0182008_10000471 3300014497 Bacteria 30819
189 Ga0157379_10085353 3300014968 Unclassified 2829
190 Ga0157376_10000237 3300014969 Bacteria 38598
191 Ga0157376_10014295 3300014969 Bacteria 5953
192 Ga0157376_10016147 3300014969 Bacteria 5662
193 Ga0182006_1000048 3300015261 Bacteria 184700
194 Ga0182006_1000134 3300015261 Bacteria 80259
195 Ga0182006_1001094 3300015261 Bacteria 17355
196 Ga0182006_1002117 3300015261 Bacteria 11070
197 Ga0182006_1004360 3300015261 Bacteria 6993
198 Ga0182006_1008696 3300015261 Bacteria 4596
199 Ga0182007_10000001 3300015262 Bacteria 1127301
200 Ga0183373_1006 3300015682 Bacteria 328276
201 Ga0163161_10000091 3300017792 Bacteria 90927
202 Ga0163161_10000940 3300017792 Bacteria 22413
203 Ga0163161_10001750 3300017792 Bacteria 15901
204 Ga0163161_10003517 3300017792 Bacteria 10968
205 Ga0163161_10013572 3300017792 Bacteria 5672
206 Ga0163161_10017421 3300017792 Bacteria 5027
207 Ga0213876_10006567 3300021384 Bacteria 6340
208 Ga0207427_100110 3300025231 Bacteria 113735
209 Ga0209437_100041 3300025233 Bacteria 444465
210 Ga0209437_100093 3300025233 Bacteria 239733
211 Ga0207425_1000007 3300025245 Bacteria 777411
212 Ga0209026_1000432 3300025250 Bacteria 34957
213 Ga0209129_1000006 3300025258 Bacteria 777761
214 Ga0209233_1000089 3300025261 Bacteria 316381
215 Ga0209675_1000032 3300025291 Bacteria 273013
216 Ga0209676_1000001 3300025292 Bacteria 1852142
217 Ga0209025_1000025 3300025294 Bacteria 524454
218 Ga0209758_1000016 3300025297 Bacteria 778557
219 Ga0209050_1000016 3300025298 Bacteria 729149
220 Ga0207426_1000059 3300025302 Bacteria 363842
221 Ga0209257_1000005 3300025304 Bacteria 1592528
222 Ga0207656_10006030 3300025321 Bacteria 4335
223 Ga0207655_1000003 3300025728 Bacteria 1081376
224 Ga0207647_10000051 3300025904 Bacteria 87826
225 Ga0207647_10000102 3300025904 Bacteria 66103
226 Ga0207647_10004404 3300025904 Bacteria 10444
227 Ga0207645_10000067 3300025907 Bacteria 75648
228 Ga0207645_10002131 3300025907 Bacteria 15827
229 Ga0207705_10000069 3300025909 Bacteria 133094
230 Ga0207705_10001436 3300025909 Bacteria 18996
231 Ga0207705_10035796 3300025909 Bacteria 3552
232 Ga0207654_10000999 3300025911 Bacteria 15500
233 Ga0207654_10003113 3300025911 Bacteria 8400
234 Ga0207654_10074504 3300025911 Bacteria 2026
235 Ga0207707_10022837 3300025912 Bacteria 5471
236 Ga0207695_10000013 3300025913 Bacteria 821265
237 Ga0207695_10000021 3300025913 Bacteria 679399
238 Ga0207695_10000039 3300025913 Bacteria 454801
239 Ga0207695_10000071 3300025913 Bacteria 315568
240 Ga0207695_10003832 3300025913 Bacteria 20820
241 Ga0207695_10011314 3300025913 Bacteria 10816
242 Ga0207695_10012580 3300025913 Bacteria 10142
243 Ga0207695_10151935 3300025913 Bacteria 2254
244 Ga0207671_10000584 3300025914 Bacteria 48796
245 Ga0207671_10000946 3300025914 Bacteria 36089
246 Ga0207671_10003128 3300025914 Bacteria 16810
247 Ga0207671_10009412 3300025914 Bacteria 8168
248 Ga0207671_10014789 3300025914 Bacteria 6148
249 Ga0207671_10016432 3300025914 Bacteria 5751
250 Ga0207660_10133746 3300025917 Bacteria 1890
251 Ga0207657_10001364 3300025919 Bacteria 26041
252 Ga0207652_10000027 3300025921 Bacteria 151000
253 Ga0207652_10000181 3300025921 Bacteria 66711
254 Ga0207652_10005338 3300025921 Bacteria 10420
255 Ga0207694_10063272 3300025924 Bacteria 2882
256 Ga0207644_10005229 3300025931 Bacteria 8473
257 Ga0207690_10000258 3300025932 Bacteria 38278
258 Ga0207706_10000044 3300025933 Bacteria 123576
259 Ga0207706_10000122 3300025933 Bacteria 83838
260 Ga0207709_10000253 3300025935 Bacteria 64210
261 Ga0207704_10000056 3300025938 Bacteria 78848
262 Ga0207691_10000091 3300025940 Bacteria 77556
263 Ga0207689_10075476 3300025942 Bacteria 2771
264 Ga0207661_10017542 3300025944 Bacteria 5300
265 Ga0207667_10000045 3300025949 Bacteria 246053
266 Ga0207667_10000816 3300025949 Bacteria 40267
267 Ga0207667_10006462 3300025949 Bacteria 14186
268 Ga0207667_10016399 3300025949 Bacteria 8373
269 Ga0207667_10019194 3300025949 Bacteria 7645
270 Ga0207667_10035131 3300025949 Bacteria 5378
271 Ga0207651_10000169 3300025960 Bacteria 28288
272 Ga0207651_10021319 3300025960 Bacteria 3936
273 Ga0207668_10000530 3300025972 Bacteria 23880
274 Ga0207658_10001536 3300025986 Bacteria 17899
275 Ga0207677_10001553 3300026023 Bacteria 12152
276 Ga0207677_10003574 3300026023 Bacteria 8234
277 Ga0207703_10001685 3300026035 Bacteria 19871
278 Ga0207639_10019786 3300026041 Bacteria 4808
279 Ga0207639_10048704 3300026041 Bacteria 3209
280 Ga0207639_10053786 3300026041 Bacteria 3074
281 Ga0207702_10000142 3300026078 Bacteria 85850
282 Ga0207641_10007519 3300026088 Bacteria 9067
283 Ga0207648_10001719 3300026089 Bacteria 23960
284 Ga0207648_10001957 3300026089 Bacteria 22508
285 Ga0207676_10004230 3300026095 Bacteria 10138
286 Ga0207674_10015142 3300026116 Bacteria 8486
287 Ga0207675_100031082 3300026118 Bacteria 4972
288 Ga0207675_100105094 3300026118 Bacteria 2661
289 Ga0207683_10022049 3300026121 Bacteria 5464
290 Ga0207698_10006465 3300026142 Bacteria 7315
291 Ga0207698_10108499 3300026142 Bacteria 2321
292 Ga0209281_1000367 3300027111 Bacteria 73152
293 Ga0209489_118165 3300027361 Bacteria 2863
294 Ga0209282_1019171 3300027666 Bacteria 4342
295 Ga0207428_10103481 3300027907 Unclassified 2198
296 Ga0268266_10000137 3300028379 Bacteria 140685
297 Ga0268264_10008810 3300028381 Bacteria 8368
298 Ga0307515_10000001 3300028794 Bacteria 4259510
299 Ga0307515_10000676 3300028794 Bacteria 78539
300 Ga0307515_10003783 3300028794 Bacteria 31678
301 Ga0265338_10076012 3300028800 Bacteria 2847
302 Ga0307509_10021155 3300031507 Bacteria 7360
303 Ga0307509_10025452 3300031507 Bacteria 6608
304 Ga0307509_10090437 3300031507 Bacteria 3137
305 Ga0307408_100000277 3300031548 Bacteria 51510
306 Ga0307508_10000439 3300031616 Bacteria 49671
307 Ga0316575_10014693 3300031665 Bacteria 2943
308 Ga0316578_10038242 3300031728 Bacteria 2767
309 Ga0316578_10079127 3300031728 Bacteria 1954
310 Ga0307516_10056586 3300031730 Bacteria 3824
311 Ga0307405_10000019 3300031731 Bacteria 167960
312 Ga0307413_10001417 3300031824 Bacteria 9061
313 Ga0307413_10055373 3300031824 Bacteria 2413
314 Ga0307410_10001048 3300031852 Bacteria 12013
315 Ga0307406_10000028 3300031901 Bacteria 91602
316 Ga0307407_10000019 3300031903 Bacteria 129701
317 Ga0307407_10000122 3300031903 Bacteria 24812
318 Ga0307412_10000017 3300031911 Bacteria 294698
319 Ga0307412_10000028 3300031911 Bacteria 213966
320 Ga0307412_10000031 3300031911 Bacteria 207128
321 Ga0307416_100000043 3300032002 Bacteria 130035
322 Ga0307416_100000052 3300032002 Bacteria 114516
323 Ga0307416_100000066 3300032002 Bacteria 94549
324 Ga0307414_10000022 3300032004 Bacteria 212123
325 Ga0307414_10001315 3300032004 Bacteria 12831
326 Ga0307414_10003132 3300032004 Bacteria 8783
327 Ga0307414_10004089 3300032004 Bacteria 7870
328 Ga0307414_10011212 3300032004 Bacteria 5246
329 Ga0307414_10040940 3300032004 Bacteria 3133
330 Ga0307414_10051340 3300032004 Bacteria 2862
331 Ga0307411_10000003 3300032005 Bacteria 477556
332 Ga0316585_10020272 3300032137 Unclassified 2034
333 Ga0307507_10000078 3300033179 Bacteria 151026
334 Ga0307510_10006279 3300033180 Bacteria 14175
335 Ga0316584_0011173 3300036712 Bacteria 6303
336 Ga0395899_0000547 3300037312 Bacteria 40664
337 Ga0395899_0001786 3300037312 Bacteria 17821
338 Ga0395899_0015505 3300037312 Bacteria 5810
339 Ga0395899_0037000 3300037312 Bacteria 3659
340 Ga0395900_0000014 3300037418 Bacteria 386513
341 Ga0395900_0001236 3300037418 Bacteria 31409
342 Ga0395900_0017094 3300037418 Bacteria 7405
343 Ga0395900_0020010 3300037418 Bacteria 6824
344 Ga0395900_0023953 3300037418 Bacteria 6247
345 Ga0395900_0104275 3300037418 Bacteria 2913
346 Ga0395898_0004302 3300037466 Bacteria 15598
347 Ga0395898_0023540 3300037466 Bacteria 6222
348 Ga0395898_0088879 3300037466 Bacteria 2973
349 Ga0395905_0000520 3300037471 Bacteria 52744
350 Ga0395905_0002984 3300037471 Bacteria 18364
351 Ga0395905_0051107 3300037471 Bacteria 3871
352 Ga0395901_0011513 3300038443 Bacteria 8964
353 Ga0395901_0012317 3300038443 Bacteria 8679
354 Ga0436365_0602250 3300039437 Bacteria 9732
355 Ga0439447_000024 3300041407 Bacteria 53601
356 Ga0439466_0000251 3300041411 Bacteria 21210
357 Ga0439448_0000648 3300042005 Bacteria 8249
358 Ga0466972_0000074 3300044658 Bacteria 95327
359 Ga0453683_0001377 3300044673 Bacteria 21128
360 Ga0466961_0018455 3300044693 Bacteria 4487
361 Ga0466961_0064411 3300044693 Unclassified 2329
362 Ga0453684_0004838 3300044712 Bacteria 27641
363 Ga0453684_0009059 3300044712 Bacteria 17564
364 Ga0466970_0001079 3300044765 Bacteria 13203
365 Ga0466959_0005895 3300045049 Bacteria 8439
366 Ga0451576_0029460 3300045051 Bacteria 5873
367 Ga0451576_0043562 3300045051 Bacteria 4735
368 Ga0451576_0127553 3300045051 Bacteria 2651
369 Ga0495650_0000023 3300046471 Bacteria 527763
370 Ga0495585_0000065 3300046492 Bacteria 108945
371 Ga0495585_0002118 3300046492 Bacteria 14495
372 Ga0495596_0002143 3300046500 Bacteria 10777
373 Ga0495607_0010500 3300046501 Bacteria 6222
374 Ga0495583_0024151 3300046506 Bacteria 3061
375 Ga0495606_0000264 3300046507 Bacteria 92733
376 Ga0495606_0004339 3300046507 Bacteria 14244
377 Ga0495606_0005538 3300046507 Bacteria 12048
378 Ga0495610_0000001 3300046512 Bacteria 1620061
379 Ga0495610_0000035 3300046512 Bacteria 189683
380 Ga0495610_0001928 3300046512 Bacteria 17885
381 Ga0495610_0003808 3300046512 Bacteria 11502
382 Ga0495616_0001380 3300046513 Bacteria 16915
383 Ga0495616_0028276 3300046513 Bacteria 2969
384 Ga0495630_0073169 3300046517 Bacteria 2581
385 Ga0495631_0013420 3300046518 Bacteria 3977
386 Ga0495632_0005270 3300046519 Bacteria 8590
387 Ga0495644_0003918 3300046523 Bacteria 5856
388 Ga0495648_0012683 3300046524 Bacteria 6266
389 Ga0495609_0004360 3300046538 Bacteria 7772
390 Ga0495609_0039723 3300046538 Bacteria 2118
391 Ga0495633_0000042 3300046558 Bacteria 173748
392 Ga0495633_0000804 3300046558 Bacteria 27892
393 Ga0495633_0001947 3300046558 Bacteria 15002
394 Ga0495633_0026119 3300046558 Bacteria 2868
395 Ga0495668_0000011 3300046616 Bacteria 472186
396 Ga0495625_0000211 3300046660 Bacteria 92222
397 Ga0495625_0000344 3300046660 Bacteria 71298
398 Ga0495625_0000873 3300046660 Bacteria 41027
399 Ga0495625_0003761 3300046660 Bacteria 14738
400 Ga0495625_0066464 3300046660 Bacteria 2539
401 Ga0495661_0003542 3300046665 Bacteria 11508
402 Ga0495649_0000090 3300046694 Bacteria 78509
403 Ga0495660_0003680 3300046810 Bacteria 9432
404 Ga0495674_0012661 3300047319 Bacteria 7950
405 Ga0495672_0024151 3300047320 Bacteria 3922
406 Ga0495687_002088 3300047443 Bacteria 16801
407 Ga0495686_0000097 3300047472 Bacteria 183450
408 Ga0495686_0000138 3300047472 Bacteria 146224
409 Ga0495686_0000911 3300047472 Bacteria 37058
410 Ga0495686_0014741 3300047472 Bacteria 5372
411 Ga0496102_0019859 3300048905 Bacteria 5925
412 Ga0496109_0051035 3300048912 Bacteria 3767
413 Ga0496116_0000002 3300048919 Bacteria 920291
414 Ga0496116_0000012 3300048919 Bacteria 611365
415 Ga0496117_0000257 3300048920 Bacteria 99879
416 Ga0496118_0000196 3300048921 Bacteria 106933
417 Ga0496119_0000002 3300048922 Bacteria 738385
418 Ga0496121_0032796 3300048924 Bacteria 4713
419 Ga0496122_0000045 3300048925 Bacteria 279912
420 Ga0496122_0000633 3300048925 Bacteria 71586
421 Ga0496122_0006096 3300048925 Bacteria 14040
422 Ga0496122_0007918 3300048925 Bacteria 11639
423 Ga0496123_0002553 3300048926 Bacteria 22190
424 Ga0496123_0014141 3300048926 Bacteria 6637
425 Ga0496124_0003447 3300048927 Bacteria 19339
426 Ga0496125_0000108 3300048928 Bacteria 196060
427 Ga0496125_0006707 3300048928 Bacteria 12379
428 Ga0496125_0014883 3300048928 Bacteria 7554
429 Ga0496125_0023885 3300048928 Bacteria 5633
430 Ga0496126_0040689 3300048929 Bacteria 4308
431 Ga0501032_0003268 3300049569 Bacteria 12478
432 Ga0501033_0045490 3300049570 Bacteria 3266
433 Ga0501034_0017880 3300049571 Bacteria 7271
434 Ga0501034_0031119 3300049571 Bacteria 5423
435 Ga0501047_0017752 3300049581 Bacteria 6817
436 Ga0501048_0012015 3300049582 Bacteria 6453
437 Ga0501073_0008490 3300049589 Bacteria 7618
438 Ga0501074_0002581 3300049590 Bacteria 12645
439 Ga0501238_000020 3300049671 Bacteria 29326
440 Ga0501249_000002 3300049679 Bacteria 262756
441 Ga0501249_000784 3300049679 Bacteria 7104
442 Ga0501079_0095419 3300049741 Bacteria 2305
443 Ga0501266_000003 3300049763 Bacteria 388836
444 Ga0501280_000274 3300049776 Bacteria 13109
445 Ga0501035_0006287 3300049822 Bacteria 11174
446 Ga0501035_0096263 3300049822 Bacteria 2601
447 Ga0501044_0096478 3300049823 Bacteria 2978
448 Ga0501044_0104323 3300049823 Bacteria 2849
449 nmdc:mga0k408_1057_c1 3300050493 Bacteria 15126
450 nmdc:mga08y16_79088_c1 3300050511 Unclassified 3427
451 Ga0500651_0000390 3300053093 Bacteria 23995
452 Ga0500651_0000590 3300053093 Bacteria 18220
453 Ga0500641_0000033 3300053096 Bacteria 78369
454 Ga0500641_0000142 3300053096 Bacteria 26342
455 Ga0500597_004380 3300053120 Bacteria 4368
456 Ga0500608_001005 3300053122 Bacteria 10125
457 Ga0500614_001445 3300053123 Bacteria 5684
458 Ga0500618_000010 3300053125 Bacteria 203909
459 Ga0500658_0000015 3300053134 Bacteria 151134
460 Ga0500624_000123 3300053157 Bacteria 35255
461 2511234473 2511231000 Bacteria 4488346
462 2513234775 2513020052 Bacteria 5120511
463 2520880530 2519899754 Bacteria 5336938
464 2585155828 2582581281 Bacteria 4487904
465 2585160248 2582581282 Bacteria 4495830
466 2586206630 2585427687 Bacteria 5544917
467 2588208308 2585428182 Bacteria 5007281
468 2588219474 2585428184 Bacteria 4978681
469 2588234373 2585428187 Bacteria 4629388
470 2599479258 2599185184 Bacteria 6430550
471 2644012066 2643221600 Bacteria 5530138
472 2644371354 2643221667 Bacteria 5627472
473 2644641333 2643221716 Bacteria 4986332
474 2644682536 2643221725 Bacteria 5087956
475 2738733846 2738541279 Bacteria 6149495
476 2738759312 2738541283 Bacteria 7222293
477 2738766197 2738541285 Bacteria 6150075
478 2738853552 2738541302 Bacteria 5944758
479 2739215427 2738543007 Bacteria 6149845
480 2739300084 2738543023 Bacteria 6767879
481 2739588677 2739367651 Bacteria 6359826
482 2739615829 2739367656 Bacteria 5152243
483 2739645358 2739367663 Bacteria 5040914
484 2740000295 2739367857 Bacteria 5433684
485 2740005111 2739367858 Bacteria 5432813
486 2772606887 2772190705 Bacteria 4666226
487 2775673614 2775506739 Bacteria 3855222
488 2802651310 2802428842 Bacteria 4926114
489 2816872858 2816332188 Bacteria 5133218
490 2817414194 2816332280 Bacteria 5109718
491 2819548072 2818991437 Bacteria 5805520
492 2842083940 2842083920 Bacteria 4857652
493 2842723838 2842722452 Bacteria 6263924
494 2842910349 2842909656 Bacteria 6185908
495 2849282309 2849281842 Bacteria 6065644
496 2852628739 2852627209 Bacteria 5896285
497 2857617731 2857613821 Bacteria 4917088
498 2857621453 2857618242 Bacteria 5635925
499 2857628514 2857627736 Bacteria 5625397
500 2881361504 2881359912 Bacteria 4935907
501 2884793924 2884791551 Bacteria 8511252
502 2889291891 2889290771 Bacteria 5530962
503 2890737909 2890737413 Bacteria 4269751
504 2896320393 2896317667 Bacteria 4606601
505 2896344538 2896344016 Bacteria 3811746
506 2898714914 2898713307 Bacteria 4110805
507 2903895270 2903895155 Bacteria 5258610
508 2904420329 2904419702 Bacteria 5166287
509 2904445635 2904445276 Bacteria 5310396
510 2904557822 2904555929 Bacteria 5218588
511 2906000668 2905999023 Bacteria 4591259
512 2919097720 2919097161 Bacteria 3860339
513 2919192468 2919191525 Bacteria 5765973
514 2919440220 2919437846 Bacteria 6199444
515 2919512505 2919509842 Bacteria 4104664
516 2919684114 2919683626 Bacteria 5534354
517 2928082431 2928078545 Bacteria 6534839
518 2928148985 2928147474 Bacteria 6512076
519 2929151350 2929150217 Bacteria 5462483
520 2932087515 2932082852 Bacteria 6563563
521 2945927346 2945924605 Bacteria 4296724
522 2946000689 2945997725 Bacteria 6404843
523 2946022237 2946019816 Bacteria 4621265
524 2954017574 2954016120 Bacteria 6446024
525 2958459617 2958458903 Bacteria 5301041
526 2958512639 2958512119 Bacteria 4528530
527 2965321627 2965320100 Bacteria 3975600
528 2977246517 2977243572 Bacteria 4374394
529 2977272724 2977268062 Bacteria 5243061
530 2984575874 2984572630 Bacteria 4186940
531 2984609330 2984606641 Bacteria 4186971
532 2993373776 2993372514 Bacteria 4214139
533 2993484450 2993480792 Bacteria 4022225
534 8054310802 8054307821 Bacteria 5212224
535 8055420051 8055419101 Bacteria 5289643
536 8055596948 8055592153 Bacteria 5961247
537 8056444243 8056440228 Bacteria 4946504
538 Ga0105240_10004451
539 MRS2a_Contig_373
540 SwRhRL2b_contig_1128713
541 SwRhRL2b_contig_904052
542 JGI24739J22299_10017457
543 JGI24737J22298_10000722
544 JGI24737J22298_10002911
545 JGI24735J21928_10000009
546 JGI25162J39368_1000292
547 JGI25164J39214_1002075
548 JGI25152J39213_1000168
549 JGI25150J39212_1000019
550 JGI25151J46595_10000074
551 JGI25165J46597_1000899
552 JGI25153J46596_10000056
553 rootH1_10063162
554 rootH2_10004828
555 rootH2_10011163
556 rootH2_10016199
557 rootL2_10098561
558 rootH1_10004761
559 rootH1_10017992
560 rootH1_10020752
561 rootH1_10173249
562 JGI25160J50197_1000262
563 Ga0055536_1000011
564 Ga0055531_10000327
565 Ga0065714_10001936
566 Ga0065714_10004920
567 Ga0065714_10021939
568 Ga0065714_10064466
569 Ga0065714_10064574
570 Ga0065714_10065077
571 Ga0065714_10070011
572 Ga0065704_10000199
573 Ga0065704_10000219
574 Ga0065704_10002606
575 Ga0065704_10075970
576 Ga0065704_10088246
577 Ga0070658_10000019
578 Ga0070658_10003094
579 Ga0070658_10080530
580 Ga0070676_10000907
581 Ga0070683_100005004
582 Ga0070683_100010840
583 Ga0070670_100167370
584 Ga0070666_10002042
585 Ga0070666_10022706
586 Ga0070682_100000964
587 Ga0068868_100002007
588 Ga0068868_100004013
589 Ga0068868_100029572
590 Ga0070660_100000583
591 Ga0070660_100015409
592 Ga0070691_10007713
593 Ga0070668_100000379
594 Ga0070671_100001609
595 Ga0070673_100001339
596 Ga0070659_100000417
597 Ga0070667_100000907
598 Ga0070663_100015107
599 Ga0070678_100001445
600 Ga0070662_100000011
601 Ga0070662_100000020
602 Ga0070662_100008497
603 Ga0070681_10014621
604 Ga0068867_100000136
605 Ga0070679_100000364
606 Ga0070679_100001518
607 Ga0070679_100001706
608 Ga0070684_100015944
609 Ga0070684_100061390
610 Ga0070684_100061646
611 Ga0068853_100001721
612 Ga0068853_100004820
613 Ga0068853_100017751
614 Ga0068853_100021734
615 Ga0068853_100026331
616 Ga0070672_100002460
617 Ga0070665_100001529
618 Ga0068855_100000009
619 Ga0068855_100001312
620 Ga0068855_100007477
621 Ga0068855_100020504
622 Ga0068855_100040412
623 Ga0068855_100137595
624 Ga0068855_100143854
625 Ga0068856_100000169
626 Ga0068856_100088818
627 Ga0068856_100096325
628 Ga0068852_100006093
629 Ga0068852_100044487
630 Ga0068852_100053963
631 Ga0068859_100095349
632 Ga0068866_10024252
633 Ga0068851_10001692
634 Ga0068851_10018687
635 Ga0068863_100004330
636 Ga0068858_100000469
637 Ga0068860_100009068
638 Ga0097621_100000178
639 Ga0068871_100000045
640 Ga0068865_100000067
641 Ga0068865_100010233
642 Ga0097620_100095348
643 Ga0099824_1022130
644 Ga0079104_1000079
645 Ga0099826_10000622
646 Ga0105244_10000054
647 Ga0105244_10000732
648 Ga0105240_10000008
649 Ga0105240_10000193
650 Ga0105240_10001190
651 Ga0105240_10027445
652 Ga0105240_10071565
653 Ga0105240_10145417
654 Ga0105240_10253004
655 Ga0105240_10274420
656 Ga0111539_10038921
657 Ga0105243_10000057
658 Ga0105241_10000134
659 Ga0105241_10002510
660 Ga0105241_10003725
661 Ga0105241_10037280
662 Ga0105237_10000343
663 Ga0105237_10000417
664 Ga0105237_10000943
665 Ga0105237_10001192
666 Ga0105237_10001556
667 Ga0105237_10181438
668 Ga0105238_10005014
669 Ga0105238_10067868
670 Ga0105239_10000006
671 Ga0105239_10000305
672 Ga0105239_10000482
673 Ga0105239_10000996
674 Ga0105239_10001766
675 Ga0157373_10000015
676 Ga0157373_10000035
677 Ga0157373_10000097
678 Ga0157373_10000310
679 Ga0157373_10010465
680 Ga0157371_10000037
681 Ga0157371_10000139
682 Ga0157371_10000684
683 Ga0157371_10000708
684 Ga0157371_10002855
685 Ga0157371_10004254
686 Ga0157371_10034328
687 Ga0157371_10041266
688 Ga0157370_10001800
689 Ga0157370_10002522
690 Ga0157370_10003225
691 Ga0157370_10003712
692 Ga0157370_10003823
693 Ga0157370_10006984
694 Ga0157370_10009368
695 Ga0157370_10015791
696 Ga0157370_10092243
697 Ga0157370_10144327
698 Ga0157369_10000002
699 Ga0157369_10000235
700 Ga0157369_10001134
701 Ga0157369_10012614
702 Ga0157369_10014069
703 Ga0157369_10023316
704 Ga0157374_10000001
705 Ga0157374_10000079
706 Ga0157374_10002137
707 Ga0157374_10002296
708 Ga0157378_10018206
709 Ga0163162_10000024
710 Ga0163162_10001849
711 Ga0163162_10006294
712 Ga0163162_10007797
713 Ga0163162_10074046
714 Ga0157372_10000099
715 Ga0157372_10001590
716 Ga0157372_10002607
717 Ga0157372_10009327
718 Ga0157372_10187660
719 Ga0157375_10000052
720 Ga0157375_10000801
721 Ga0157375_10097942
722 Ga0157375_10136916
723 Ga0163163_10000428
724 Ga0182008_10000319
725 Ga0182008_10000471
726 Ga0157379_10085353
727 Ga0157376_10000237
728 Ga0157376_10014295
729 Ga0157376_10016147
730 Ga0182006_1000048
731 Ga0182006_1000134
732 Ga0182006_1001094
733 Ga0182006_1002117
734 Ga0182006_1004360
735 Ga0182006_1008696
736 Ga0182007_10000001
737 Ga0183373_1006
738 Ga0163161_10000091
739 Ga0163161_10000940
740 Ga0163161_10001750
741 Ga0163161_10003517
742 Ga0163161_10013572
743 Ga0163161_10017421
744 Ga0213876_10006567
745 Ga0207427_100110
746 Ga0209437_100041
747 Ga0209437_100093
748 Ga0207425_1000007
749 Ga0209026_1000432
750 Ga0209129_1000006
751 Ga0209233_1000089
752 Ga0209675_1000032
753 Ga0209676_1000001
754 Ga0209025_1000025
755 Ga0209758_1000016
756 Ga0209050_1000016
757 Ga0207426_1000059
758 Ga0209257_1000005
759 Ga0207656_10006030
760 Ga0207655_1000003
761 Ga0207647_10000051
762 Ga0207647_10000102
763 Ga0207647_10004404
764 Ga0207645_10000067
765 Ga0207645_10002131
766 Ga0207705_10000069
767 Ga0207705_10001436
768 Ga0207705_10035796
769 Ga0207654_10000999
770 Ga0207654_10003113
771 Ga0207654_10074504
772 Ga0207707_10022837
773 Ga0207695_10000013
774 Ga0207695_10000021
775 Ga0207695_10000039
776 Ga0207695_10000071
777 Ga0207695_10003832
778 Ga0207695_10011314
779 Ga0207695_10012580
780 Ga0207695_10151935
781 Ga0207671_10000584
782 Ga0207671_10000946
783 Ga0207671_10003128
784 Ga0207671_10009412
785 Ga0207671_10014789
786 Ga0207671_10016432
787 Ga0207660_10133746
788 Ga0207657_10001364
789 Ga0207652_10000027
790 Ga0207652_10000181
791 Ga0207652_10005338
792 Ga0207694_10063272
793 Ga0207644_10005229
794 Ga0207690_10000258
795 Ga0207706_10000044
796 Ga0207706_10000122
797 Ga0207709_10000253
798 Ga0207704_10000056
799 Ga0207691_10000091
800 Ga0207689_10075476
801 Ga0207661_10017542
802 Ga0207667_10000045
803 Ga0207667_10000816
804 Ga0207667_10006462
805 Ga0207667_10016399
806 Ga0207667_10019194
807 Ga0207667_10035131
808 Ga0207651_10000169
809 Ga0207651_10021319
810 Ga0207668_10000530
811 Ga0207658_10001536
812 Ga0207677_10001553
813 Ga0207677_10003574
814 Ga0207703_10001685
815 Ga0207639_10019786
816 Ga0207639_10048704
817 Ga0207639_10053786
818 Ga0207702_10000142
819 Ga0207641_10007519
820 Ga0207648_10001719
821 Ga0207648_10001957
822 Ga0207676_10004230
823 Ga0207674_10015142
824 Ga0207675_100031082
825 Ga0207675_100105094
826 Ga0207683_10022049
827 Ga0207698_10006465
828 Ga0207698_10108499
829 Ga0209281_1000367
830 Ga0209489_118165
831 Ga0209282_1019171
832 Ga0207428_10103481
833 Ga0268266_10000137
834 Ga0268264_10008810
835 Ga0307515_10000001
836 Ga0307515_10000676
837 Ga0307515_10003783
838 Ga0265338_10076012
839 Ga0307509_10021155
840 Ga0307509_10025452
841 Ga0307509_10090437
842 Ga0307408_100000277
843 Ga0307508_10000439
844 Ga0316575_10014693
845 Ga0316578_10038242
846 Ga0316578_10079127
847 Ga0307516_10056586
848 Ga0307405_10000019
849 Ga0307413_10001417
850 Ga0307413_10055373
851 Ga0307410_10001048
852 Ga0307406_10000028
853 Ga0307407_10000019
854 Ga0307407_10000122
855 Ga0307412_10000017
856 Ga0307412_10000028
857 Ga0307412_10000031
858 Ga0307416_100000043
859 Ga0307416_100000052
860 Ga0307416_100000066
861 Ga0307414_10000022
862 Ga0307414_10001315
863 Ga0307414_10003132
864 Ga0307414_10004089
865 Ga0307414_10011212
866 Ga0307414_10040940
867 Ga0307414_10051340
868 Ga0307411_10000003
869 Ga0316585_10020272
870 Ga0307507_10000078
871 Ga0307510_10006279
872 Ga0316584_0011173
873 Ga0395899_0000547
874 Ga0395899_0001786
875 Ga0395899_0015505
876 Ga0395899_0037000
877 Ga0395900_0000014
878 Ga0395900_0001236
879 Ga0395900_0017094
880 Ga0395900_0020010
881 Ga0395900_0023953
882 Ga0395900_0104275
883 Ga0395898_0004302
884 Ga0395898_0023540
885 Ga0395898_0088879
886 Ga0395905_0000520
887 Ga0395905_0002984
888 Ga0395905_0051107
889 Ga0395901_0011513
890 Ga0395901_0012317
891 Ga0436365_0602250
892 Ga0439447_000024
893 Ga0439466_0000251
894 Ga0439448_0000648
895 Ga0466972_0000074
896 Ga0453683_0001377
897 Ga0466961_0018455
898 Ga0466961_0064411
899 Ga0453684_0004838
900 Ga0453684_0009059
901 Ga0466970_0001079
902 Ga0466959_0005895
903 Ga0451576_0029460
904 Ga0451576_0043562
905 Ga0451576_0127553
906 Ga0495650_0000023
907 Ga0495585_0000065
908 Ga0495585_0002118
909 Ga0495596_0002143
910 Ga0495607_0010500
911 Ga0495583_0024151
912 Ga0495606_0000264
913 Ga0495606_0004339
914 Ga0495606_0005538
915 Ga0495610_0000001
916 Ga0495610_0000035
917 Ga0495610_0001928
918 Ga0495610_0003808
919 Ga0495616_0001380
920 Ga0495616_0028276
921 Ga0495630_0073169
922 Ga0495631_0013420
923 Ga0495632_0005270
924 Ga0495644_0003918
925 Ga0495648_0012683
926 Ga0495609_0004360
927 Ga0495609_0039723
928 Ga0495633_0000042
929 Ga0495633_0000804
930 Ga0495633_0001947
931 Ga0495633_0026119
932 Ga0495668_0000011
933 Ga0495625_0000211
934 Ga0495625_0000344
935 Ga0495625_0000873
936 Ga0495625_0003761
937 Ga0495625_0066464
938 Ga0495661_0003542
939 Ga0495649_0000090
940 Ga0495660_0003680
941 Ga0495674_0012661
942 Ga0495672_0024151
943 Ga0495687_002088
944 Ga0495686_0000097
945 Ga0495686_0000138
946 Ga0495686_0000911
947 Ga0495686_0014741
948 Ga0496102_0019859
949 Ga0496109_0051035
950 Ga0496116_0000002
951 Ga0496116_0000012
952 Ga0496117_0000257
953 Ga0496118_0000196
954 Ga0496119_0000002
955 Ga0496121_0032796
956 Ga0496122_0000045
957 Ga0496122_0000633
958 Ga0496122_0006096
959 Ga0496122_0007918
960 Ga0496123_0002553
961 Ga0496123_0014141
962 Ga0496124_0003447
963 Ga0496125_0000108
964 Ga0496125_0006707
965 Ga0496125_0014883
966 Ga0496125_0023885
967 Ga0496126_0040689
968 Ga0501032_0003268
969 Ga0501033_0045490
970 Ga0501034_0017880
971 Ga0501034_0031119
972 Ga0501047_0017752
973 Ga0501048_0012015
974 Ga0501073_0008490
975 Ga0501074_0002581
976 Ga0501238_000020
977 Ga0501249_000002
978 Ga0501249_000784
979 Ga0501079_0095419
980 Ga0501266_000003
981 Ga0501280_000274
982 Ga0501035_0006287
983 Ga0501035_0096263
984 Ga0501044_0096478
985 Ga0501044_0104323
986 nmdc:mga0k408_1057_c1
987 nmdc:mga08y16_79088_c1
988 Ga0500651_0000390
989 Ga0500651_0000590
990 Ga0500641_0000033
991 Ga0500641_0000142
992 Ga0500597_004380
993 Ga0500608_001005
994 Ga0500614_001445
995 Ga0500618_000010
996 Ga0500658_0000015
997 Ga0500624_000123
998 2511234473
999 2513234775
1000 2520880530
1001 2585155828
1002 2585160248
1003 2586206630
1004 2588208308
1005 2588219474
1006 2588234373
1007 2599479258
1008 2644012066
1009 2644371354
1010 2644641333
1011 2644682536
1012 2738733846
1013 2738759312
1014 2738766197
1015 2738853552
1016 2739215427
1017 2739300084
1018 2739588677
1019 2739615829
1020 2739645358
1021 2740000295
1022 2740005111
1023 2772606887
1024 2775673614
1025 2802651310
1026 2816872858
1027 2817414194
1028 2819548072
1029 2842083940
1030 2842723838
1031 2842910349
1032 2849282309
1033 2852628739
1034 2857617731
1035 2857621453
1036 2857628514
1037 2881361504
1038 2884793924
1039 2889291891
1040 2890737909
1041 2896320393
1042 2896344538
1043 2898714914
1044 2903895270
1045 2904420329
1046 2904445635
1047 2904557822
1048 2906000668
1049 2919097720
1050 2919192468
1051 2919440220
1052 2919512505
1053 2919684114
1054 2928082431
1055 2928148985
1056 2929151350
1057 2932087515
1058 2945927346
1059 2946000689
1060 2946022237
1061 2954017574
1062 2958459617
1063 2958512639
1064 2965321627
1065 2977246517
1066 2977272724
1067 2984575874
1068 2984609330
1069 2993373776
1070 2993484450
1071 8054310802
1072 8055420051
1073 8055596948
1074 8056444243

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02782

FGGY_C

FGGY family of carbohydrate kinases, C-terminal domain

339

556

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gll-assembly1.cif.gz_O escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion 0.867 4 550
3qdk-assembly1.cif.gz_B structural insight on mechanism and diverse substrate selection strategy of ribulokinase 0.8653 5 551
3d7e-assembly1.cif.gz_X enterococcus casseliflavus glycerol kinase mutant his232ala complexed with glycerol 0.8599 5 550
2dpn-assembly1.cif.gz_B crystal structure of the glycerol kinase from thermus thermophilus hb8 0.8558 8 547
3qdk-assembly2.cif.gz_C structural insight on mechanism and diverse substrate selection strategy of ribulokinase 0.8548 5 551
ID Description Score Start End Superfamily
af_Q4DBR1_13_290_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9808 5 280 3.30.420.40
af_Q4DBR1_13_290_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9704 5 280 3.30.420.40
af_Q4CRA5_13_211_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9674 5 202 3.30.420.40
af_Q4DBR1_294_568_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9603 285 553 3.30.420.40
af_Q4CRA5_13_211_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9579 5 202 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A3M7LH59-F1-model_v4 deleted 0.9773 423 553
AF-A0A4Q3BBX6-F1-model_v4 deleted 0.9752 1 553
AF-A0A4Q8X0P2-F1-model_v4 deleted 0.9726 5 217
AF-A0A4Q6AC02-F1-model_v4 Ribulokinase (EC 2.7.1.16) 0.9724 2 142 GO:0005737
GO:0008741
GO:0019150
GO:0019321
AF-A0A2V2XHG0-F1-model_v4 Putative L-ribulokinase 0.9701 86 273 GO:0005737
GO:0019150
GO:0019321

Map