metagRoot

F460902

General Info

Members	Datasets	Scaffolds	Average Seq Length
537	283	515	195

Family's Representative Sequence

Representative Sequence	3300009094\|Ga0111539_10852424\|Ga0111539_108524242
Length	226
Sequence	MAAIFHRACHSRVPVGVSWVEGNKILRREGREMPSTSTFRIPKAEVTGAYGALMKLFANKMLDGEFPDNGYVYFHNKPVLKAILSFERKVEKWDRLDEDLKSYAQLASAGVIGCSWCLDFGCFKAHNDGLDLDKVREVPRWRESDVFTPLERDVLEYAEAMTVTPPTVTDEMVAHLVAELGAPAVVELTQMVALENMRSRFNCAAGLQSQGYSDVCELPLAVPSHS

Samples

	Sample ID	Description	Type	Environment
1	2558860112	Pseudonocardia acaciae DSM 45401	Isolate	Unclassified
2	2582581313	Streptomyces mirabilis OV308	Isolate	Rhizosphere
3	2622736626	Micromonospora rhizosphaerae DSM 45431	Isolate	Rhizosphere
4	2643221561	Nocardioides sp. Root151	Isolate	Unclassified
5	2643221615	Nocardioides sp. Root224	Isolate	Unclassified
6	2643221641	Nocardioides sp. Root122	Isolate	Unclassified
7	2643221657	Nocardioides sp. Root1257	Isolate	Unclassified
8	2643221690	Cellulomonas sp. Root485	Isolate	Unclassified
9	2643221696	Nocardioides sp. Root140	Isolate	Unclassified
10	2643221711	Terrabacter sp. Root85	Isolate	Unclassified
11	2738541305	Nocardioides sp. CF167	Isolate	Unclassified
12	2751185782	Actinoplanes subtropicus NRRL B-24665	Isolate	Rhizosphere
13	2808606365	Phycicoccus sp. SLBN-51	Isolate	Unclassified
14	2811994874	Nocardioides sp. SLBN-35	Isolate	Unclassified
15	2831935698	Jishengella sp. AZ1-13	Isolate	Unclassified
16	2837183177	Egibacter rhizosphaerae EGI 80759	Isolate	Unclassified
17	2844849076	Arthrobacter cupressi DSM 24664	Isolate	Rhizosphere
18	2884791551	Chitinophaga oryzae 1310	Isolate	Unclassified
19	2915768154	Amycolatopsis pittospori PIP199	Isolate	Unclassified
20	2939647034	Arthrobacter sp. 2762	Isolate	Rhizosphere
21	2946024296	Arthrobacter woluwensis W4I2	Isolate	Rhizosphere
22	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
23	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
24	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
25	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
26	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
27	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
28	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
29	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
30	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
31	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
32	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
33	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
34	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
35	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
36	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
37	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
38	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
39	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
40	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
41	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
42	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
43	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
44	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
45	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
46	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
47	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
48	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
49	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
50	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
51	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
52	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
53	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
54	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
55	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
56	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
57	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
58	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
59	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
60	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
61	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
62	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
63	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
64	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
65	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
66	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
67	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
68	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
69	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
70	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
71	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
72	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
73	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
75	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
76	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
77	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
78	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
79	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
80	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
81	3300009987	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG	Metagenome	Rhizosphere
82	3300009993	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG	Metagenome	Rhizosphere
83	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
84	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
85	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
86	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
87	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
88	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
89	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
90	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
91	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
92	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
93	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
94	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
95	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
96	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
97	3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3)	Metatranscriptome	Rhizosphere
98	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
99	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
100	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
101	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
102	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
103	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
104	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
131	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
134	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
135	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
136	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
137	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
138	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
139	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
140	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
141	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
142	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
143	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
144	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
145	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
146	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
147	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
148	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
149	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
150	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
151	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
152	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
153	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
154	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
155	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
156	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
157	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
158	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
159	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
160	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
161	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
162	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
163	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
164	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
165	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
166	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
167	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
168	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
169	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
170	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
171	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
172	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
173	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
174	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
175	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
176	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
177	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
178	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
179	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
180	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
181	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
182	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
183	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
184	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
185	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
186	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
187	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
188	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
189	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
190	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
191	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
192	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
193	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
194	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
195	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
196	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
197	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
198	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
199	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
200	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
201	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
202	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
203	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
204	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
205	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
206	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
207	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
208	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
209	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
210	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
211	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
212	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
213	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
214	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
215	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
216	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
217	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
218	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
219	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
220	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
221	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
222	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
223	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
224	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
225	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
226	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
227	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
228	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
229	3300049518	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control	Metagenome	Rhizosphere
230	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
231	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
232	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
233	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
234	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
235	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
236	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
237	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
239	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
240	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
241	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
242	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
243	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
244	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
245	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
246	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
247	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
248	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
249	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
250	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
251	3300049650	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought	Metagenome	Rhizosphere
252	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
253	3300049708	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control	Metagenome	Rhizosphere
254	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
255	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
256	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
257	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
258	3300049767	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought	Metagenome	Rhizosphere
259	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
261	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
262	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
263	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
264	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
265	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
266	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
267	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
268	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
269	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
270	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
271	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
272	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
273	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
274	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
275	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
276	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
277	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
278	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
279	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
280	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
281	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
282	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
283	8055412473	Micromonospora phytophila DSM 105363	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	94.79
Metatranscriptomes	1.12
Isolates	4.1

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	16.95
Nodule	0.19
Rhizoplane	10.43
Rhizosphere	66.48
Stem	0
Stem Tuber	0
Unclassified	5.96

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10015465	3300003203	Bacteria	3217
2	Ga0070658_11008428	3300005327	Bacteria	724
3	Ga0070666_10117069	3300005335	Bacteria	1846
4	Ga0068868_101348802	3300005338	Bacteria	664
5	Ga0070689_100603688	3300005340	Bacteria	951
6	Ga0070691_10525460	3300005341	Bacteria	688
7	Ga0070668_100057404	3300005347	Bacteria	3008
8	Ga0070674_100124694	3300005356	Bacteria	1911
9	Ga0070674_101061543	3300005356	Bacteria	713
10	Ga0070674_101140803	3300005356	Bacteria	690
11	Ga0070688_100266308	3300005365	Bacteria	1226
12	Ga0070659_100024214	3300005366	Bacteria	4652
13	Ga0070659_100224351	3300005366	Bacteria	1552
14	Ga0070659_100481653	3300005366	Bacteria	1056
15	Ga0070667_100173076	3300005367	Bacteria	1907
16	Ga0070709_10105035	3300005434	Bacteria	1888
17	Ga0070714_100766702	3300005435	Bacteria	933
18	Ga0070710_10013150	3300005437	Bacteria	4135
19	Ga0070701_10215159	3300005438	Bacteria	1143
20	Ga0070711_100036778	3300005439	Bacteria	3282
21	Ga0070700_100396399	3300005441	Bacteria	1036
22	Ga0070700_100463442	3300005441	Bacteria	967
23	Ga0070663_100329734	3300005455	Bacteria	1230
24	Ga0070663_101211091	3300005455	Bacteria	664
25	Ga0070685_10661048	3300005466	Bacteria	758
26	Ga0070707_100816234	3300005468	Bacteria	897
27	Ga0070698_100901087	3300005471	Bacteria	830
28	Ga0070679_100006635	3300005530	Bacteria	10790
29	Ga0070679_100822541	3300005530	Bacteria	872
30	Ga0070672_100237259	3300005543	Bacteria	1533
31	Ga0070696_100014304	3300005546	Bacteria	5321
32	Ga0070665_100963663	3300005548	Bacteria	865
33	Ga0068855_100227335	3300005563	Bacteria	2091
34	Ga0070664_100483918	3300005564	Bacteria	1139
35	Ga0070664_100929285	3300005564	Bacteria	816
36	Ga0068856_100656671	3300005614	Bacteria	1069
37	Ga0070702_100100285	3300005615	Bacteria	1775
38	Ga0070702_100118322	3300005615	Bacteria	1654
39	Ga0070702_100768165	3300005615	Bacteria	742
40	Ga0068852_100010849	3300005616	Bacteria	6828
41	Ga0068852_100317515	3300005616	Bacteria	1512
42	Ga0068852_101419901	3300005616	Bacteria	716
43	Ga0068861_101435142	3300005719	Bacteria	675
44	Ga0068860_100000578	3300005843	Bacteria	44029
45	Ga0068862_100412260	3300005844	Bacteria	1266
46	Ga0081455_10351727	3300005937	Bacteria	1039
47	Ga0081538_10138611	3300005981	Bacteria	1127
48	Ga0081539_10002358	3300005985	Bacteria	27118
49	Ga0081539_10003148	3300005985	Bacteria	20948
50	Ga0081539_10012325	3300005985	Bacteria	6609
51	Ga0081539_10021139	3300005985	Bacteria	4359
52	Ga0081539_10033886	3300005985	Bacteria	3100
53	Ga0081539_10042298	3300005985	Bacteria	2656
54	Ga0081539_10148814	3300005985	Bacteria	1129
55	Ga0070717_10007807	3300006028	Bacteria	7961
56	Ga0070717_10864232	3300006028	Bacteria	823
57	Ga0075365_10008185	3300006038	Bacteria	5915
58	Ga0075365_10008445	3300006038	Bacteria	5849
59	Ga0075365_10017444	3300006038	Bacteria	4392
60	Ga0075365_10092041	3300006038	Bacteria	2067
61	Ga0075365_10129795	3300006038	Bacteria	1744
62	Ga0075365_10174186	3300006038	Bacteria	1502
63	Ga0075365_10211102	3300006038	Bacteria	1361
64	Ga0075365_10240491	3300006038	Bacteria	1271
65	Ga0075365_10245515	3300006038	Bacteria	1258
66	Ga0075365_10409356	3300006038	Bacteria	957
67	Ga0075368_10006230	3300006042	Bacteria	4156
68	Ga0075368_10006944	3300006042	Bacteria	3982
69	Ga0075368_10029371	3300006042	Bacteria	2126
70	Ga0075368_10102634	3300006042	Bacteria	1175
71	Ga0075368_10289380	3300006042	Bacteria	705
72	Ga0075363_100004260	3300006048	Bacteria	6221
73	Ga0075363_100005391	3300006048	Bacteria	5684
74	Ga0075363_100017399	3300006048	Bacteria	3565
75	Ga0075363_100031757	3300006048	Bacteria	2739
76	Ga0075363_100064733	3300006048	Bacteria	1975
77	Ga0075363_100139169	3300006048	Bacteria	1366
78	Ga0075363_100141810	3300006048	Bacteria	1353
79	Ga0075364_10019676	3300006051	Bacteria	4239
80	Ga0075364_10077251	3300006051	Bacteria	2198
81	Ga0075364_10077631	3300006051	Bacteria	2192
82	Ga0075364_10104078	3300006051	Bacteria	1891
83	Ga0075364_10118161	3300006051	Bacteria	1773
84	Ga0075364_10131230	3300006051	Bacteria	1681
85	Ga0075364_10135174	3300006051	Bacteria	1656
86	Ga0075364_10206843	3300006051	Bacteria	1331
87	Ga0075364_10375594	3300006051	Bacteria	969
88	Ga0070716_100201950	3300006173	Bacteria	1322
89	Ga0070712_100005049	3300006175	Bacteria	8174
90	Ga0075362_10026505	3300006177	Bacteria	2476
91	Ga0075367_10004333	3300006178	Bacteria	6908
92	Ga0075367_10040460	3300006178	Bacteria	2721
93	Ga0075367_10060500	3300006178	Bacteria	2258
94	Ga0075367_10064302	3300006178	Bacteria	2194
95	Ga0075367_10077584	3300006178	Bacteria	2006
96	Ga0075367_10124866	3300006178	Bacteria	1588
97	Ga0075370_10012188	3300006353	Bacteria	4537
98	Ga0075370_10014015	3300006353	Bacteria	4269
99	Ga0075370_10069580	3300006353	Bacteria	2012
100	Ga0075428_100100249	3300006844	Bacteria	3158
101	Ga0075431_100000549	3300006847	Bacteria	31563
102	Ga0075431_100264958	3300006847	Bacteria	1743
103	Ga0075431_100415149	3300006847	Bacteria	1346
104	Ga0075429_100000823	3300006880	Bacteria	24344
105	Ga0075429_100009377	3300006880	Bacteria	8498
106	Ga0105244_10011217	3300009036	Bacteria	5391
107	Ga0105244_10073589	3300009036	Bacteria	1701
108	Ga0105250_10355739	3300009092	Bacteria	642
109	Ga0111539_10098526	3300009094	Bacteria	3433
110	Ga0111539_10370904	3300009094	Bacteria	1666
111	Ga0111539_10852424	3300009094	Bacteria	1060
112	Ga0111539_11339656	3300009094	Bacteria	831
113	Ga0105245_10564124	3300009098	Bacteria	1162
114	Ga0105245_10675514	3300009098	Bacteria	1064
115	Ga0105247_10914285	3300009101	Bacteria	679
116	Ga0114129_10250436	3300009147	Bacteria	2378
117	Ga0114129_11976798	3300009147	Bacteria	706
118	Ga0105243_10005171	3300009148	Bacteria	10218
119	Ga0105243_10125275	3300009148	Bacteria	2172
120	Ga0105243_10423630	3300009148	Bacteria	1242
121	Ga0105243_10675128	3300009148	Bacteria	1004
122	Ga0105241_10076729	3300009174	Bacteria	2607
123	Ga0105238_10217170	3300009551	Bacteria	1888
124	Ga0105249_10161867	3300009553	Bacteria	2163
125	Ga0105030_106252	3300009987	Bacteria	1011
126	Ga0105028_114200	3300009993	Bacteria	845
127	Ga0105239_10054436	3300010375	Bacteria	4389
128	Ga0105246_10012623	3300011119	Bacteria	5276
129	Ga0105246_10459747	3300011119	Bacteria	1072
130	Ga0105246_10770715	3300011119	Bacteria	850
131	Ga0157370_10429882	3300013104	Bacteria	1214
132	Ga0157370_10552567	3300013104	Bacteria	1055
133	Ga0157369_10447243	3300013105	Bacteria	1338
134	Ga0157369_10589172	3300013105	Bacteria	1148
135	Ga0157374_11324797	3300013296	Bacteria	742
136	Ga0163162_10091754	3300013306	Bacteria	3121
137	Ga0163162_10131049	3300013306	Bacteria	2616
138	Ga0157372_10578665	3300013307	Bacteria	1309
139	Ga0157372_10628658	3300013307	Bacteria	1251
140	Ga0157375_10550383	3300013308	Bacteria	1315
141	Ga0163163_10117190	3300014325	Bacteria	2695
142	Ga0157380_10248204	3300014326	Bacteria	1609
143	Ga0157380_10503846	3300014326	Bacteria	1177
144	Ga0157380_10754853	3300014326	Bacteria	985
145	Ga0157377_10518995	3300014745	Bacteria	836
146	Ga0157377_10560178	3300014745	Bacteria	809
147	Ga0157379_10828304	3300014968	Bacteria	875
148	Ga0163161_10102918	3300017792	Bacteria	2127
149	Ga0163161_10304605	3300017792	Bacteria	1256
150	Ga0197907_11115886	3300020069	Bacteria	2522
151	Ga0197907_11165220	3300020069	Bacteria	1467
152	Ga0206355_1284026	3300020076	Bacteria	786
153	Ga0206350_11435542	3300020080	Bacteria	1410
154	Ga0224712_10008174	3300022467	Bacteria	3086
155	Ga0224712_10072285	3300022467	Bacteria	1404
156	Ga0207425_1003629	3300025245	Bacteria	4872
157	Ga0209129_1000068	3300025258	Bacteria	217385
158	Ga0209025_1000045	3300025294	Bacteria	349118
159	Ga0209051_1006969	3300025303	Bacteria	6268
160	Ga0207697_10017392	3300025315	Bacteria	2955
161	Ga0207692_10102085	3300025898	Bacteria	1576
162	Ga0207680_10072695	3300025903	Bacteria	2136
163	Ga0207705_10800285	3300025909	Bacteria	732
164	Ga0207654_10039468	3300025911	Bacteria	2656
165	Ga0207707_10228413	3300025912	Bacteria	1619
166	Ga0207707_10326197	3300025912	Bacteria	1325
167	Ga0207707_10672866	3300025912	Bacteria	871
168	Ga0207693_10701614	3300025915	Bacteria	784
169	Ga0207652_10000596	3300025921	Bacteria	36173
170	Ga0207664_10085948	3300025929	Bacteria	2568
171	Ga0207690_10691413	3300025932	Bacteria	838
172	Ga0207709_10127360	3300025935	Bacteria	1729
173	Ga0207665_10159195	3300025939	Bacteria	1623
174	Ga0207691_10482067	3300025940	Bacteria	1054
175	Ga0207661_10044130	3300025944	Bacteria	3522
176	Ga0207661_10069476	3300025944	Bacteria	2872
177	Ga0207661_10837615	3300025944	Bacteria	847
178	Ga0207679_10009195	3300025945	Bacteria	6317
179	Ga0207667_10104345	3300025949	Bacteria	2924
180	Ga0207712_10149878	3300025961	Bacteria	1800
181	Ga0207668_10043271	3300025972	Bacteria	3055
182	Ga0207668_10443164	3300025972	Bacteria	1107
183	Ga0207658_10154816	3300025986	Bacteria	1872
184	Ga0207677_11038067	3300026023	Bacteria	745
185	Ga0207678_10001445	3300026067	Bacteria	21828
186	Ga0207678_10553937	3300026067	Bacteria	1006
187	Ga0207678_10576148	3300026067	Bacteria	986
188	Ga0207708_10647501	3300026075	Bacteria	899
189	Ga0207708_10685823	3300026075	Bacteria	875
190	Ga0207702_10381156	3300026078	Bacteria	1356
191	Ga0207702_10486895	3300026078	Bacteria	1201
192	Ga0207674_10293983	3300026116	Bacteria	1573
193	Ga0207675_100482849	3300026118	Bacteria	1232
194	Ga0207698_10001762	3300026142	Bacteria	12625
195	Ga0207698_10126040	3300026142	Bacteria	2178
196	Ga0209813_10001796	3300027866	Bacteria	4833
197	Ga0209813_10028717	3300027866	Bacteria	1624
198	Ga0209813_10058342	3300027866	Bacteria	1226
199	Ga0268266_10145175	3300028379	Bacteria	2132
200	Ga0268266_10461846	3300028379	Bacteria	1208
201	Ga0268264_10000226	3300028381	Bacteria	109817
202	Ga0307512_10053164	3300030522	Bacteria	3223
203	Ga0316177_1210231	3300030731	Bacteria	694
204	Ga0316180_1131519	3300030736	Bacteria	749
205	Ga0316183_1207072	3300030742	Bacteria	821
206	Ga0307513_10043631	3300031456	Bacteria	4922
207	Ga0307408_100374549	3300031548	Bacteria	1215
208	Ga0307514_10097404	3300031649	Bacteria	2122
209	Ga0307405_10137422	3300031731	Bacteria	1699
210	Ga0307405_10266539	3300031731	Bacteria	1282
211	Ga0307405_10429410	3300031731	Bacteria	1042
212	Ga0307410_10047018	3300031852	Bacteria	2882
213	Ga0307410_10324329	3300031852	Bacteria	1223
214	Ga0307410_10548656	3300031852	Bacteria	958
215	Ga0307406_10063874	3300031901	Bacteria	2387
216	Ga0307406_10070476	3300031901	Bacteria	2289
217	Ga0307406_10823530	3300031901	Bacteria	785
218	Ga0307407_10247373	3300031903	Bacteria	1220
219	Ga0307407_10305359	3300031903	Bacteria	1111
220	Ga0307407_10614878	3300031903	Bacteria	810
221	Ga0307412_10196199	3300031911	Bacteria	1530
222	Ga0307412_10502340	3300031911	Bacteria	1010
223	Ga0307409_100017364	3300031995	Bacteria	4793
224	Ga0307409_100139817	3300031995	Bacteria	2084
225	Ga0307409_100235247	3300031995	Bacteria	1664
226	Ga0307409_100325128	3300031995	Bacteria	1441
227	Ga0307409_100575171	3300031995	Bacteria	1110
228	Ga0307409_101074898	3300031995	Bacteria	825
229	Ga0307409_101123187	3300031995	Bacteria	808
230	Ga0307416_100022377	3300032002	Bacteria	4562
231	Ga0307416_100940031	3300032002	Bacteria	966
232	Ga0307416_101099697	3300032002	Bacteria	899
233	Ga0307416_101153325	3300032002	Bacteria	880
234	Ga0307414_10236631	3300032004	Bacteria	1509
235	Ga0307414_10823364	3300032004	Bacteria	848
236	Ga0307414_10863552	3300032004	Bacteria	828
237	Ga0307414_11183872	3300032004	Bacteria	707
238	Ga0307415_100047591	3300032126	Bacteria	2887
239	Ga0307415_100070557	3300032126	Bacteria	2454
240	Ga0307415_100106478	3300032126	Bacteria	2070
241	Ga0307415_100319259	3300032126	Bacteria	1294
242	Ga0307415_100659989	3300032126	Bacteria	939
243	Ga0307415_100695223	3300032126	Bacteria	917
244	Ga0307415_100698176	3300032126	Bacteria	915
245	Ga0307415_100860712	3300032126	Bacteria	832
246	Ga0373953_0305107	3300035117	Bacteria	695
247	Ga0373943_0140665	3300035170	Bacteria	1300
248	Ga0373931_0383399	3300035691	Bacteria	887
249	Ga0373947_0068945	3300035725	Bacteria	2164
250	Ga0373937_0070192	3300036401	Bacteria	3231
251	Ga0395899_0154627	3300037312	Bacteria	1624
252	Ga0395900_0040692	3300037418	Bacteria	4790
253	Ga0395900_0092063	3300037418	Bacteria	3115
254	Ga0395900_0101804	3300037418	Bacteria	2950
255	Ga0395900_0125305	3300037418	Bacteria	2635
256	Ga0395900_0290920	3300037418	Bacteria	1622
257	Ga0395900_0633096	3300037418	Bacteria	1008
258	Ga0395898_0100676	3300037466	Bacteria	2775
259	Ga0395898_0132691	3300037466	Bacteria	2385
260	Ga0395898_0570557	3300037466	Bacteria	1074
261	Ga0395898_0609265	3300037466	Bacteria	1035
262	Ga0395898_0633645	3300037466	Bacteria	1012
263	Ga0395905_0170198	3300037471	Bacteria	2046
264	Ga0395905_0299597	3300037471	Bacteria	1495
265	Ga0436364_0406268	3300037853	Bacteria	1218
266	Ga0395901_0129508	3300038443	Bacteria	2652
267	Ga0395901_0133749	3300038443	Bacteria	2606
268	Ga0395901_0166355	3300038443	Bacteria	2315
269	Ga0395901_0472328	3300038443	Bacteria	1280
270	Ga0436365_1024213	3300039437	Bacteria	1052
271	Ga0436363_1641931	3300039450	Bacteria	862
272	Ga0451793_1701285	3300041452	Bacteria	1436
273	Ga0451797_0815514	3300041453	Bacteria	964
274	Ga0451795_0247030	3300041456	Bacteria	624
275	Ga0451795_1639384	3300041456	Bacteria	885
276	Ga0451798_0170431	3300041458	Bacteria	746
277	Ga0451837_0745280	3300041494	Bacteria	835
278	Ga0451847_0089042	3300041503	Bacteria	767
279	Ga0451843_1277382	3300041509	Bacteria	758
280	Ga0439442_026406	3300042002	Bacteria	1208
281	Ga0439442_057649	3300042002	Bacteria	822
282	Ga0439448_0144101	3300042005	Bacteria	825
283	Ga0439449_0028068	3300042007	Bacteria	2098
284	Ga0439452_039513	3300042010	Bacteria	1117
285	Ga0450903_001014	3300042138	Bacteria	5385
286	Ga0439458_0011676	3300042157	Bacteria	1965
287	Ga0439434_0052924	3300042435	Bacteria	1261
288	Ga0466965_0006751	3300044683	Bacteria	5236
289	Ga0466965_0100555	3300044683	Bacteria	1478
290	Ga0466965_0114196	3300044683	Bacteria	1390
291	Ga0466961_0176568	3300044693	Bacteria	1327
292	Ga0466963_0318845	3300044694	Bacteria	1094
293	Ga0466963_0637521	3300044694	Bacteria	752
294	Ga0466970_0066793	3300044765	Bacteria	1931
295	Ga0466970_0230982	3300044765	Bacteria	1034
296	Ga0466970_0343311	3300044765	Bacteria	846
297	Ga0466960_0103038	3300044901	Bacteria	1473
298	Ga0466960_0162716	3300044901	Bacteria	1199
299	Ga0466960_0229160	3300044901	Bacteria	1025
300	Ga0466960_0394092	3300044901	Bacteria	796
301	Ga0466959_0021275	3300045049	Bacteria	4783
302	Ga0466967_0009531	3300045976	Bacteria	7211
303	Ga0466967_0222068	3300045976	Bacteria	1796
304	Ga0466967_0254614	3300045976	Bacteria	1678
305	Ga0466967_1195984	3300045976	Bacteria	757
306	Ga0495651_0079276	3300046462	Bacteria	2482
307	Ga0495653_0258229	3300046463	Bacteria	1153
308	Ga0495608_0090605	3300046511	Bacteria	1978
309	Ga0495620_0057589	3300046515	Bacteria	1630
310	Ga0495628_0039956	3300046516	Bacteria	3751
311	Ga0495628_0541335	3300046516	Bacteria	837
312	Ga0495652_0090281	3300046529	Bacteria	2507
313	Ga0495665_0323996	3300046531	Bacteria	787
314	Ga0495640_0047762	3300046533	Bacteria	2961
315	Ga0495587_0352638	3300046536	Bacteria	820
316	Ga0495645_0138263	3300046543	Bacteria	1702
317	Ga0495645_0242896	3300046543	Bacteria	1201
318	Ga0495667_0006779	3300046559	Bacteria	7772
319	Ga0495634_0112485	3300046642	Bacteria	1750
320	Ga0495625_0054235	3300046660	Bacteria	2864
321	Ga0495635_0087546	3300046663	Bacteria	2131
322	Ga0495635_0237629	3300046663	Bacteria	1230
323	Ga0495657_0009464	3300046675	Bacteria	7378
324	Ga0495599_0316463	3300046678	Bacteria	940
325	Ga0495646_0033965	3300046680	Bacteria	3170
326	Ga0495658_0350441	3300046683	Bacteria	938
327	Ga0495613_0277262	3300046689	Bacteria	1165
328	Ga0495671_0122786	3300046692	Bacteria	1267
329	Ga0495600_0011655	3300046809	Bacteria	5483
330	Ga0495604_0015715	3300047317	Bacteria	6040
331	Ga0495674_0777977	3300047319	Bacteria	746
332	Ga0495676_0246464	3300047321	Bacteria	1221
333	Ga0495684_0017430	3300047471	Bacteria	5530
334	Ga0495602_0028993	3300048088	Bacteria	5284
335	Ga0496100_0143859	3300048903	Bacteria	1693
336	Ga0496100_0169267	3300048903	Bacteria	1572
337	Ga0496100_0477071	3300048903	Bacteria	959
338	Ga0496101_0005319	3300048904	Bacteria	8197
339	Ga0496101_0034064	3300048904	Bacteria	3596
340	Ga0496101_0101238	3300048904	Bacteria	2157
341	Ga0496102_0006313	3300048905	Bacteria	10105
342	Ga0496102_0009007	3300048905	Bacteria	8566
343	Ga0496102_0845401	3300048905	Bacteria	837
344	Ga0496102_0961509	3300048905	Bacteria	775
345	Ga0496102_1015507	3300048905	Bacteria	750
346	Ga0496102_1464242	3300048905	Bacteria	602
347	Ga0496103_0061989	3300048906	Bacteria	2327
348	Ga0496103_0230822	3300048906	Bacteria	1190
349	Ga0496104_0005944	3300048907	Bacteria	10685
350	Ga0496104_0009637	3300048907	Bacteria	8600
351	Ga0496104_0131379	3300048907	Bacteria	2405
352	Ga0496104_0213872	3300048907	Bacteria	1839
353	Ga0496105_0025655	3300048908	Bacteria	4799
354	Ga0496105_0032143	3300048908	Bacteria	4305
355	Ga0496105_0063708	3300048908	Bacteria	3041
356	Ga0496105_0329133	3300048908	Bacteria	1223
357	Ga0496106_0079782	3300048909	Bacteria	2513
358	Ga0496106_0100962	3300048909	Bacteria	2238
359	Ga0496107_0046251	3300048910	Bacteria	3132
360	Ga0496107_0121568	3300048910	Bacteria	1924
361	Ga0496107_0127675	3300048910	Bacteria	1876
362	Ga0496107_0165204	3300048910	Bacteria	1641
363	Ga0496108_0070593	3300048911	Bacteria	2948
364	Ga0496108_0194700	3300048911	Bacteria	1758
365	Ga0496108_0358112	3300048911	Bacteria	1273
366	Ga0496108_1097608	3300048911	Bacteria	676
367	Ga0496109_0128971	3300048912	Bacteria	2360
368	Ga0496109_0249084	3300048912	Bacteria	1673
369	Ga0496109_0291574	3300048912	Bacteria	1538
370	Ga0496109_0391360	3300048912	Bacteria	1313
371	Ga0496109_0414785	3300048912	Bacteria	1272
372	Ga0496110_0119353	3300048913	Bacteria	2375
373	Ga0496111_0021292	3300048914	Bacteria	4524
374	Ga0496111_0216281	3300048914	Bacteria	1423
375	Ga0496111_0465256	3300048914	Bacteria	932
376	Ga0496112_0004018	3300048915	Bacteria	12333
377	Ga0496113_0215582	3300048916	Bacteria	1529
378	Ga0496113_0252425	3300048916	Bacteria	1408
379	Ga0496114_0074405	3300048917	Bacteria	2859
380	Ga0496114_0074430	3300048917	Bacteria	2859
381	Ga0496114_0079511	3300048917	Bacteria	2767
382	Ga0496114_0083309	3300048917	Bacteria	2705
383	Ga0496114_0127421	3300048917	Bacteria	2195
384	Ga0496114_0377314	3300048917	Bacteria	1255
385	Ga0496114_0535770	3300048917	Bacteria	1035
386	Ga0496119_0015617	3300048922	Bacteria	5830
387	Ga0496119_0054591	3300048922	Bacteria	2432
388	Ga0496121_0076943	3300048924	Bacteria	2659
389	Ga0496122_0213673	3300048925	Bacteria	1114
390	Ga0496124_0222593	3300048927	Bacteria	1418
391	Ga0496124_0248342	3300048927	Bacteria	1318
392	Ga0496124_0330990	3300048927	Bacteria	1086
393	Ga0496125_0017445	3300048928	Bacteria	6843
394	Ga0501295_042958	3300049518	Bacteria	944
395	Ga0501031_0147576	3300049568	Bacteria	1537
396	Ga0501033_0000653	3300049570	Bacteria	32031
397	Ga0501034_0013729	3300049571	Bacteria	8332
398	Ga0501034_0020124	3300049571	Bacteria	6813
399	Ga0501034_0548290	3300049571	Bacteria	1066
400	Ga0501036_0026528	3300049572	Bacteria	4891
401	Ga0501036_0230028	3300049572	Bacteria	1556
402	Ga0501037_0049627	3300049573	Bacteria	3073
403	Ga0501038_0000471	3300049574	Bacteria	35396
404	Ga0501039_0101270	3300049575	Bacteria	2248
405	Ga0501039_0213793	3300049575	Bacteria	1516
406	Ga0501039_0279918	3300049575	Bacteria	1311
407	Ga0501042_0050927	3300049578	Bacteria	2954
408	Ga0501042_0206683	3300049578	Bacteria	1416
409	Ga0501042_0796294	3300049578	Bacteria	688
410	Ga0501043_0414515	3300049579	Bacteria	1016
411	Ga0501043_0687271	3300049579	Bacteria	748
412	Ga0501043_0777484	3300049579	Bacteria	694
413	Ga0501046_0006182	3300049580	Bacteria	10633
414	Ga0501047_0004082	3300049581	Bacteria	13735
415	Ga0501048_0292625	3300049582	Bacteria	1158
416	Ga0501048_0500238	3300049582	Bacteria	871
417	Ga0501067_0066331	3300049583	Bacteria	1998
418	Ga0501067_0123919	3300049583	Bacteria	1438
419	Ga0501067_0180198	3300049583	Bacteria	1177
420	Ga0501067_0318385	3300049583	Bacteria	866
421	Ga0501068_0035552	3300049584	Bacteria	2974
422	Ga0501068_0153362	3300049584	Bacteria	1449
423	Ga0501069_0012245	3300049585	Bacteria	4558
424	Ga0501069_0037990	3300049585	Bacteria	2657
425	Ga0501069_0114081	3300049585	Bacteria	1541
426	Ga0501069_0163284	3300049585	Bacteria	1283
427	Ga0501069_0188438	3300049585	Bacteria	1193
428	Ga0501070_0012570	3300049586	Bacteria	7141
429	Ga0501070_0013880	3300049586	Bacteria	6784
430	Ga0501070_0438282	3300049586	Bacteria	1054
431	Ga0501071_0183130	3300049587	Bacteria	1570
432	Ga0501071_0221310	3300049587	Bacteria	1424
433	Ga0501072_0041623	3300049588	Bacteria	3609
434	Ga0501072_0108940	3300049588	Bacteria	2204
435	Ga0501072_0117102	3300049588	Bacteria	2122
436	Ga0501072_0952425	3300049588	Bacteria	670
437	Ga0501073_0031886	3300049589	Bacteria	3760
438	Ga0501073_0160536	3300049589	Bacteria	1557
439	Ga0501074_0042386	3300049590	Bacteria	3293
440	Ga0501074_0116797	3300049590	Bacteria	1909
441	Ga0501074_0242576	3300049590	Bacteria	1282
442	Ga0501075_0164287	3300049591	Bacteria	1694
443	Ga0501075_0982517	3300049591	Bacteria	641
444	Ga0501199_011675	3300049650	Bacteria	952
445	Ga0501249_084704	3300049679	Bacteria	748
446	Ga0501245_071441	3300049708	Bacteria	654
447	Ga0501079_0203968	3300049741	Bacteria	1545
448	Ga0501079_0457224	3300049741	Bacteria	1003
449	Ga0501080_0054936	3300049742	Bacteria	3708
450	Ga0501080_0256722	3300049742	Bacteria	1593
451	Ga0501081_0679373	3300049743	Bacteria	773
452	Ga0501083_0134497	3300049744	Bacteria	1620
453	Ga0501270_049850	3300049767	Bacteria	755
454	Ga0501044_0053689	3300049823	Bacteria	4145
455	Ga0501045_0123845	3300049824	Bacteria	1920
456	Ga0501045_0140483	3300049824	Bacteria	1796
457	nmdc:mga03683_6999_c1	3300050489	Bacteria	3891
458	nmdc:mga03n38_170185_c1	3300050490	Bacteria	1109
459	nmdc:mga03n38_187390_c1	3300050490	Bacteria	1064
460	nmdc:mga03n38_190945_c1	3300050490	Bacteria	1055
461	nmdc:mga03n38_91431_c1	3300050490	Bacteria	1450
462	nmdc:mga00v17_129216_c1	3300050491	Bacteria	1613
463	nmdc:mga00v17_14879_c1	3300050491	Bacteria	4353
464	nmdc:mga00v17_176477_c1	3300050491	Bacteria	1378
465	nmdc:mga00v17_199947_c1	3300050491	Bacteria	1292
466	nmdc:mga00v17_24296_c1	3300050491	Bacteria	3514
467	nmdc:mga00v17_55635_c1	3300050491	Bacteria	2417
468	nmdc:mga00v17_56786_c1	3300050491	Bacteria	2394
469	nmdc:mga00v17_568112_c1	3300050491	Bacteria	733
470	nmdc:mga00v17_61409_c1	3300050491	Bacteria	2310
471	nmdc:mga0yw44_129773_c1	3300050492	Bacteria	1631
472	nmdc:mga0yw44_129836_c1	3300050492	Bacteria	1630
473	nmdc:mga0yw44_183528_c1	3300050492	Bacteria	1378
474	nmdc:mga0yw44_18482_c1	3300050492	Bacteria	3820
475	nmdc:mga0yw44_207691_c1	3300050492	Bacteria	1295
476	nmdc:mga0yw44_265264_c1	3300050492	Bacteria	1145
477	nmdc:mga0yw44_493331_c1	3300050492	Bacteria	831
478	nmdc:mga0yw44_61951_c1	3300050492	Bacteria	2296
479	nmdc:mga0yw44_7386_c1	3300050492	Bacteria	5403
480	nmdc:mga0yw44_826735_c1	3300050492	Bacteria	629
481	nmdc:mga0yw44_97308_c1	3300050492	Bacteria	1869
482	nmdc:mga06z11_244445_c1	3300050494	Bacteria	1055
483	nmdc:mga06z11_260578_c1	3300050494	Bacteria	1023
484	nmdc:mga06z11_378134_c1	3300050494	Bacteria	851
485	nmdc:mga06z11_42398_c1	3300050494	Bacteria	2283
486	nmdc:mga04h51_36527_c1	3300050495	Bacteria	1581
487	nmdc:mga04h51_6070_c1	3300050495	Bacteria	3114
488	nmdc:mga04h51_7032_c1	3300050495	Bacteria	2950
489	nmdc:mga07m45_11731_c1	3300050496	Bacteria	4611
490	nmdc:mga07m45_54887_c1	3300050496	Bacteria	2251
491	nmdc:mga07m45_67673_c1	3300050496	Bacteria	2030
492	nmdc:mga07m45_83004_c1	3300050496	Bacteria	1830
493	nmdc:mga05p37_176809_c1	3300050507	Bacteria	2600
494	nmdc:mga05p37_332266_c1	3300050507	Bacteria	1795
495	nmdc:mga09592_216_c1	3300050508	Bacteria	41559
496	nmdc:mga09592_24874_c1	3300050508	Bacteria	4952
497	nmdc:mga0qj67_363_c1	3300050509	Bacteria	31290
498	nmdc:mga06r32_1194432_c1	3300050510	Bacteria	707
499	nmdc:mga06r32_401641_c1	3300050510	Bacteria	1352
500	nmdc:mga06r32_452_c1	3300050510	Bacteria	34936
501	nmdc:mga08y16_565030_c1	3300050511	Bacteria	1150
502	Ga0495619_0023977	3300053085	Bacteria	3913
503	Ga0495619_0055764	3300053085	Bacteria	2618
504	Ga0495619_0226134	3300053085	Bacteria	1296
505	Ga0500644_0000192	3300053088	Bacteria	37965
506	Ga0500556_0002184	3300053104	Bacteria	6587
507	Ga0500593_002842	3300053117	Bacteria	6425
508	Ga0500594_0187720	3300053118	Bacteria	676
509	Ga0500616_0004085	3300053153	Bacteria	10600
510	Ga0500616_0114482	3300053153	Bacteria	1298
511	Ga0500630_125256	3300053159	Bacteria	1131
512	Ga0501084_1131735	3300054114	Bacteria	657
513	Ga0590075_011768	3300059424	Bacteria	2119
514	Ga0501082_0214110	3300060353	Bacteria	1676
515	Ga0501082_0953244	3300060353	Bacteria	750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025940	Ga0207691_10482067	Ga0207691_104820672	169
2	3300048905	Ga0496102_1015507	Ga0496102_1015507_227_739	170
3	3300048908	Ga0496105_0032143	Ga0496105_0032143_12_536	170
4	3300035725	Ga0373947_0068945	Ga0373947_0068945_525_1058	172
5	3300049591	Ga0501075_0982517	Ga0501075_0982517_92_625	173
6	3300048905	Ga0496102_1464242	Ga0496102_1464242_22_558	174
7	3300009987	Ga0105030_106252	Ga0105030_1062522	175
8	3300044694	Ga0466963_0318845	Ga0466963_0318845_262_795	177
9	3300005335	Ga0070666_10117069	Ga0070666_101170691	179
10	3300005548	Ga0070665_100963663	Ga0070665_1009636632	179
11	3300006038	Ga0075365_10092041	Ga0075365_100920412	179
12	3300025903	Ga0207680_10072695	Ga0207680_100726952	179
13	3300025944	Ga0207661_10069476	Ga0207661_100694761	179
14	3300028379	Ga0268266_10145175	Ga0268266_101451752	179
15	3300041456	Ga0451795_0247030	Ga0451795_0247030_49_606	179
16	3300046692	Ga0495671_0122786	Ga0495671_0122786_642_1193	179
17	3300048907	Ga0496104_0213872	Ga0496104_0213872_797_1348	179
18	3300048910	Ga0496107_0127675	Ga0496107_0127675_760_1311	179
19	3300048911	Ga0496108_1097608	Ga0496108_1097608_104_655	179
20	3300048912	Ga0496109_0249084	Ga0496109_0249084_856_1407	179
21	3300048922	Ga0496119_0015617	Ga0496119_0015617_3878_4429	179
22	3300048924	Ga0496121_0076943	Ga0496121_0076943_472_1023	179
23	3300048927	Ga0496124_0248342	Ga0496124_0248342_677_1231	179
24	3300048928	Ga0496125_0017445	Ga0496125_0017445_3611_4162	179
25	3300005434	Ga0070709_10105035	Ga0070709_101050352	180
26	3300005437	Ga0070710_10013150	Ga0070710_100131505	180
27	3300005439	Ga0070711_100036778	Ga0070711_1000367783	180
28	3300005530	Ga0070679_100006635	Ga0070679_10000663512	180
29	3300006028	Ga0070717_10007807	Ga0070717_100078072	180
30	3300006173	Ga0070716_100201950	Ga0070716_1002019502	180
31	3300006175	Ga0070712_100005049	Ga0070712_1000050491	180
32	3300025898	Ga0207692_10102085	Ga0207692_101020852	180
33	3300025912	Ga0207707_10326197	Ga0207707_103261972	180
34	3300025921	Ga0207652_10000596	Ga0207652_1000059621	180
35	3300025929	Ga0207664_10085948	Ga0207664_100859481	180
36	3300025939	Ga0207665_10159195	Ga0207665_101591952	180
37	3300026067	Ga0207678_10001445	Ga0207678_1000144518	180
38	3300035117	Ga0373953_0305107	Ga0373953_0305107_40_603	180
39	3300036401	Ga0373937_0070192	Ga0373937_0070192_36_599	180
40	3300039437	Ga0436365_1024213	Ga0436365_1024213_345_911	180
41	3300039450	Ga0436363_1641931	Ga0436363_1641931_80_649	180
42	3300046462	Ga0495651_0079276	Ga0495651_0079276_1655_2218	180
43	3300046516	Ga0495628_0039956	Ga0495628_0039956_264_827	180
44	3300046529	Ga0495652_0090281	Ga0495652_0090281_90_653	180
45	3300046533	Ga0495640_0047762	Ga0495640_0047762_1030_1593	180
46	3300046536	Ga0495587_0352638	Ga0495587_0352638_107_670	180
47	3300046543	Ga0495645_0138263	Ga0495645_0138263_972_1535	180
48	3300046559	Ga0495667_0006779	Ga0495667_0006779_2551_3114	180
49	3300046642	Ga0495634_0112485	Ga0495634_0112485_866_1462	180
50	3300046663	Ga0495635_0087546	Ga0495635_0087546_1465_2028	180
51	3300046675	Ga0495657_0009464	Ga0495657_0009464_4633_5196	180
52	3300046678	Ga0495599_0316463	Ga0495599_0316463_225_788	180
53	3300046680	Ga0495646_0033965	Ga0495646_0033965_318_881	180
54	3300046809	Ga0495600_0011655	Ga0495600_0011655_1018_1581	180
55	3300047317	Ga0495604_0015715	Ga0495604_0015715_95_658	180
56	3300047319	Ga0495674_0777977	Ga0495674_0777977_94_657	180
57	3300047471	Ga0495684_0017430	Ga0495684_0017430_4102_4665	180
58	3300048088	Ga0495602_0028993	Ga0495602_0028993_1435_2031	180
59	3300053085	Ga0495619_0055764	Ga0495619_0055764_1368_1931	180
60	iso_pu_bacteria	2582581313	2585305469	180
61	iso_pu_bacteria	2884791551	2884796932	180
62	3300010375	Ga0105239_10054436	Ga0105239_100544362	181
63	3300005615	Ga0070702_100100285	Ga0070702_1001002851	182
64	3300041453	Ga0451797_0815514	Ga0451797_0815514_133_702	182
65	iso_pu_bacteria	2643221641	2644229591	182
66	iso_pu_bacteria	2844849076	2844851083	183
67	iso_pu_bacteria	2939647034	2939649182	183
68	iso_pu_bacteria	2946024296	2946027143	183
69	3300005327	Ga0070658_11008428	Ga0070658_110084281	184
70	3300005615	Ga0070702_100118322	Ga0070702_1001183221	184
71	3300011119	Ga0105246_10770715	Ga0105246_107707151	184
72	3300020069	Ga0197907_11165220	Ga0197907_111652201	184
73	3300022467	Ga0224712_10072285	Ga0224712_100722851	184
74	3300025909	Ga0207705_10800285	Ga0207705_108002851	184
75	3300030522	Ga0307512_10053164	Ga0307512_100531643	184
76	3300031649	Ga0307514_10097404	Ga0307514_100974042	184
77	3300037466	Ga0395898_0132691	Ga0395898_0132691_257_868	184
78	3300041458	Ga0451798_0170431	Ga0451798_0170431_16_570	184
79	3300042005	Ga0439448_0144101	Ga0439448_0144101_32_637	184
80	3300042138	Ga0450903_001014	Ga0450903_001014_3158_3763	184
81	3300042157	Ga0439458_0011676	Ga0439458_0011676_42_647	184
82	3300044765	Ga0466970_0066793	Ga0466970_0066793_491_1066	184
83	3300046660	Ga0495625_0054235	Ga0495625_0054235_1207_1884	184
84	3300049585	Ga0501069_0037990	Ga0501069_0037990_1485_2069	184
85	3300005340	Ga0070689_100603688	Ga0070689_1006036881	185
86	3300005341	Ga0070691_10525460	Ga0070691_105254601	185
87	3300005365	Ga0070688_100266308	Ga0070688_1002663082	185
88	3300005441	Ga0070700_100396399	Ga0070700_1003963991	185
89	3300005466	Ga0070685_10661048	Ga0070685_106610481	185
90	3300006051	Ga0075364_10375594	Ga0075364_103755942	185
91	3300006178	Ga0075367_10004333	Ga0075367_100043336	185
92	3300009094	Ga0111539_10370904	Ga0111539_103709041	185
93	3300013104	Ga0157370_10429882	Ga0157370_104298822	185
94	3300013105	Ga0157369_10589172	Ga0157369_105891722	185
95	3300013307	Ga0157372_10628658	Ga0157372_106286582	185
96	3300013308	Ga0157375_10550383	Ga0157375_105503832	185
97	3300014326	Ga0157380_10503846	Ga0157380_105038462	185
98	3300014745	Ga0157377_10560178	Ga0157377_105601781	185
99	3300025935	Ga0207709_10127360	Ga0207709_101273602	185
100	3300026075	Ga0207708_10647501	Ga0207708_106475012	185
101	3300026116	Ga0207674_10293983	Ga0207674_102939831	185
102	3300031731	Ga0307405_10429410	Ga0307405_104294103	185
103	3300031901	Ga0307406_10070476	Ga0307406_100704763	185
104	3300031903	Ga0307407_10614878	Ga0307407_106148781	185
105	3300031911	Ga0307412_10196199	Ga0307412_101961991	185
106	3300031995	Ga0307409_100139817	Ga0307409_1001398173	185
107	3300032002	Ga0307416_100940031	Ga0307416_1009400312	185
108	3300032004	Ga0307414_10863552	Ga0307414_108635522	185
109	3300032126	Ga0307415_100070557	Ga0307415_1000705573	185
110	3300041503	Ga0451847_0089042	Ga0451847_0089042_61_642	185
111	3300044683	Ga0466965_0100555	Ga0466965_0100555_751_1326	185
112	3300044765	Ga0466970_0230982	Ga0466970_0230982_318_893	185
113	3300044901	Ga0466960_0394092	Ga0466960_0394092_103_678	185
114	3300045976	Ga0466967_0222068	Ga0466967_0222068_910_1476	185
115	3300046515	Ga0495620_0057589	Ga0495620_0057589_483_1088	185
116	3300048907	Ga0496104_0131379	Ga0496104_0131379_247_822	185
117	3300048908	Ga0496105_0329133	Ga0496105_0329133_118_693	185
118	3300048911	Ga0496108_0358112	Ga0496108_0358112_508_1083	185
119	3300048912	Ga0496109_0391360	Ga0496109_0391360_239_814	185
120	3300048913	Ga0496110_0119353	Ga0496110_0119353_217_792	185
121	3300048914	Ga0496111_0465256	Ga0496111_0465256_309_884	185
122	3300048917	Ga0496114_0083309	Ga0496114_0083309_1902_2477	185
123	3300048917	Ga0496114_0535770	Ga0496114_0535770_237_812	185
124	3300049568	Ga0501031_0147576	Ga0501031_0147576_113_694	185
125	3300049571	Ga0501034_0548290	Ga0501034_0548290_360_941	185
126	3300049575	Ga0501039_0101270	Ga0501039_0101270_508_1089	185
127	3300049575	Ga0501039_0213793	Ga0501039_0213793_764_1345	185
128	3300049578	Ga0501042_0796294	Ga0501042_0796294_97_678	185
129	3300049579	Ga0501043_0777484	Ga0501043_0777484_78_659	185
130	3300049587	Ga0501071_0183130	Ga0501071_0183130_553_1134	185
131	3300049587	Ga0501071_0221310	Ga0501071_0221310_458_1039	185
132	3300049743	Ga0501081_0679373	Ga0501081_0679373_88_669	185
133	3300049824	Ga0501045_0140483	Ga0501045_0140483_145_726	185
134	3300050490	nmdc:mga03n38_190945_c1	nmdc:mga03n38_190945_c1_312_893	185
135	3300050491	nmdc:mga00v17_568112_c1	nmdc:mga00v17_568112_c1_74_655	185
136	3300050492	nmdc:mga0yw44_207691_c1	nmdc:mga0yw44_207691_c1_415_996	185
137	3300050492	nmdc:mga0yw44_61951_c1	nmdc:mga0yw44_61951_c1_1079_1654	185
138	3300050494	nmdc:mga06z11_378134_c1	nmdc:mga06z11_378134_c1_215_796	185
139	3300050511	nmdc:mga08y16_565030_c1	nmdc:mga08y16_565030_c1_370_945	185
140	3300053104	Ga0500556_0002184	Ga0500556_0002184_5085_5660	185
141	3300053117	Ga0500593_002842	Ga0500593_002842_4866_5498	185
142	3300005614	Ga0068856_100656671	Ga0068856_1006566711	186
143	3300006042	Ga0075368_10102634	Ga0075368_101026342	186
144	3300006048	Ga0075363_100031757	Ga0075363_1000317574	186
145	3300006051	Ga0075364_10135174	Ga0075364_101351742	186
146	3300006051	Ga0075364_10206843	Ga0075364_102068432	186
147	3300006178	Ga0075367_10064302	Ga0075367_100643022	186
148	3300006353	Ga0075370_10069580	Ga0075370_100695802	186
149	3300009094	Ga0111539_10852424	Ga0111539_108524242	186
150	3300031995	Ga0307409_100575171	Ga0307409_1005751712	186
151	3300049578	Ga0501042_0206683	Ga0501042_0206683_371_1048	186
152	3300049582	Ga0501048_0292625	Ga0501048_0292625_386_1063	186
153	3300049588	Ga0501072_0108940	Ga0501072_0108940_1322_1999	186
154	3300049591	Ga0501075_0164287	Ga0501075_0164287_228_812	186
155	3300049824	Ga0501045_0123845	Ga0501045_0123845_436_1020	186
156	3300050495	nmdc:mga04h51_36527_c1	nmdc:mga04h51_36527_c1_845_1429	186
157	3300050496	nmdc:mga07m45_54887_c1	nmdc:mga07m45_54887_c1_1261_1845	186
158	3300060353	Ga0501082_0214110	Ga0501082_0214110_652_1236	186
159	3300060353	Ga0501082_0953244	Ga0501082_0953244_54_731	186
160	iso_pu_bacteria	2643221615	2644093213	186
161	iso_pu_bacteria	2643221657	2644322824	186
162	iso_pu_bacteria	2643221711	2644608645	186
163	iso_pu_bacteria	2808606365	2808872276	186
164	iso_pu_bacteria	2831935698	2831935940	186
165	3300005356	Ga0070674_101061543	Ga0070674_1010615431	187
166	3300005366	Ga0070659_100224351	Ga0070659_1002243513	187
167	3300005438	Ga0070701_10215159	Ga0070701_102151591	187
168	3300005455	Ga0070663_101211091	Ga0070663_1012110911	187
169	3300005564	Ga0070664_100483918	Ga0070664_1004839182	187
170	3300005616	Ga0068852_100317515	Ga0068852_1003175153	187
171	3300006038	Ga0075365_10129795	Ga0075365_101297952	187
172	3300006038	Ga0075365_10240491	Ga0075365_102404911	187
173	3300006042	Ga0075368_10029371	Ga0075368_100293712	187
174	3300006048	Ga0075363_100141810	Ga0075363_1001418102	187
175	3300006051	Ga0075364_10077251	Ga0075364_100772512	187
176	3300006178	Ga0075367_10124866	Ga0075367_101248662	187
177	3300009036	Ga0105244_10011217	Ga0105244_100112176	187
178	3300009036	Ga0105244_10073589	Ga0105244_100735892	187
179	3300009098	Ga0105245_10675514	Ga0105245_106755142	187
180	3300009148	Ga0105243_10005171	Ga0105243_1000517110	187
181	3300009148	Ga0105243_10125275	Ga0105243_101252751	187
182	3300011119	Ga0105246_10012623	Ga0105246_100126234	187
183	3300011119	Ga0105246_10459747	Ga0105246_104597472	187
184	3300013296	Ga0157374_11324797	Ga0157374_113247972	187
185	3300025245	Ga0207425_1003629	Ga0207425_10036294	187
186	3300025258	Ga0209129_1000068	Ga0209129_100006839	187
187	3300025294	Ga0209025_1000045	Ga0209025_1000045285	187
188	3300025303	Ga0209051_1006969	Ga0209051_10069699	187
189	3300025315	Ga0207697_10017392	Ga0207697_100173921	187
190	3300025932	Ga0207690_10691413	Ga0207690_106914131	187
191	3300025945	Ga0207679_10009195	Ga0207679_100091953	187
192	3300026142	Ga0207698_10126040	Ga0207698_101260402	187
193	3300027866	Ga0209813_10058342	Ga0209813_100583422	187
194	3300028379	Ga0268266_10461846	Ga0268266_104618462	187
195	3300031995	Ga0307409_101123187	Ga0307409_1011231871	187
196	3300037466	Ga0395898_0633645	Ga0395898_0633645_199_780	187
197	3300041452	Ga0451793_1701285	Ga0451793_1701285_534_1112	187
198	3300041494	Ga0451837_0745280	Ga0451837_0745280_82_666	187
199	3300042002	Ga0439442_026406	Ga0439442_026406_199_837	187
200	3300042007	Ga0439449_0028068	Ga0439449_0028068_353_934	187
201	3300042010	Ga0439452_039513	Ga0439452_039513_417_998	187
202	3300042435	Ga0439434_0052924	Ga0439434_0052924_549_1130	187
203	3300044765	Ga0466970_0343311	Ga0466970_0343311_177_794	187
204	3300048905	Ga0496102_0961509	Ga0496102_0961509_134_712	187
205	3300048915	Ga0496112_0004018	Ga0496112_0004018_7658_8233	187
206	3300048927	Ga0496124_0222593	Ga0496124_0222593_578_1162	187
207	3300049583	Ga0501067_0123919	Ga0501067_0123919_329_898	187
208	3300049585	Ga0501069_0188438	Ga0501069_0188438_129_713	187
209	3300049589	Ga0501073_0031886	Ga0501073_0031886_50_634	187
210	3300049590	Ga0501074_0116797	Ga0501074_0116797_1188_1772	187
211	3300049741	Ga0501079_0457224	Ga0501079_0457224_195_779	187
212	3300049742	Ga0501080_0256722	Ga0501080_0256722_207_791	187
213	3300050491	nmdc:mga00v17_129216_c1	nmdc:mga00v17_129216_c1_758_1342	187
214	3300050491	nmdc:mga00v17_176477_c1	nmdc:mga00v17_176477_c1_131_715	187
215	3300050491	nmdc:mga00v17_55635_c1	nmdc:mga00v17_55635_c1_860_1444	187
216	3300050491	nmdc:mga00v17_56786_c1	nmdc:mga00v17_56786_c1_772_1356	187
217	3300050492	nmdc:mga0yw44_18482_c1	nmdc:mga0yw44_18482_c1_71_655	187
218	3300050492	nmdc:mga0yw44_97308_c1	nmdc:mga0yw44_97308_c1_379_963	187
219	3300050494	nmdc:mga06z11_260578_c1	nmdc:mga06z11_260578_c1_141_725	187
220	3300050496	nmdc:mga07m45_67673_c1	nmdc:mga07m45_67673_c1_1319_1903	187
221	3300050496	nmdc:mga07m45_83004_c1	nmdc:mga07m45_83004_c1_696_1280	187
222	3300053088	Ga0500644_0000192	Ga0500644_0000192_29373_29957	187
223	3300054114	Ga0501084_1131735	Ga0501084_1131735_35_616	187
224	iso_pu_bacteria	2643221561	2643824790	187
225	iso_pu_bacteria	2643221696	2644536041	187
226	iso_pu_bacteria	2751185782	2753267771	187
227	3300005468	Ga0070707_100816234	Ga0070707_1008162341	188
228	3300005471	Ga0070698_100901087	Ga0070698_1009010872	188
229	3300006038	Ga0075365_10211102	Ga0075365_102111021	188
230	3300037312	Ga0395899_0154627	Ga0395899_0154627_349_921	188
231	3300037418	Ga0395900_0101804	Ga0395900_0101804_360_932	188
232	3300037466	Ga0395898_0100676	Ga0395898_0100676_176_748	188
233	3300037466	Ga0395898_0570557	Ga0395898_0570557_407_985	188
234	3300037471	Ga0395905_0170198	Ga0395905_0170198_356_928	188
235	3300038443	Ga0395901_0166355	Ga0395901_0166355_1440_2012	188
236	3300049583	Ga0501067_0180198	Ga0501067_0180198_19_603	188
237	3300049585	Ga0501069_0114081	Ga0501069_0114081_567_1151	188
238	3300050492	nmdc:mga0yw44_129836_c1	nmdc:mga0yw44_129836_c1_659_1252	188
239	iso_pu_bacteria	2558860112	2558905569	188
240	iso_pu_bacteria	2622736626	2623586287	188
241	iso_pu_bacteria	2643221690	2644505964	188
242	iso_pu_bacteria	2738541305	2738868910	188
243	iso_pu_bacteria	2811994874	2812330371	188
244	iso_pu_bacteria	2837183177	2837184593	188
245	iso_pu_bacteria	2915768154	2915769765	188
246	iso_pu_bacteria	8055412473	8055412521	188
247	3300005356	Ga0070674_101140803	Ga0070674_1011408031	189
248	3300005564	Ga0070664_100929285	Ga0070664_1009292851	189
249	3300005719	Ga0068861_101435142	Ga0068861_1014351421	189
250	3300005985	Ga0081539_10021139	Ga0081539_100211393	189
251	3300006038	Ga0075365_10008445	Ga0075365_100084454	189
252	3300006038	Ga0075365_10245515	Ga0075365_102455152	189
253	3300006042	Ga0075368_10006230	Ga0075368_100062303	189
254	3300006048	Ga0075363_100004260	Ga0075363_1000042605	189
255	3300006048	Ga0075363_100139169	Ga0075363_1001391692	189
256	3300006051	Ga0075364_10118161	Ga0075364_101181613	189
257	3300006177	Ga0075362_10026505	Ga0075362_100265053	189
258	3300006178	Ga0075367_10060500	Ga0075367_100605003	189
259	3300006353	Ga0075370_10012188	Ga0075370_100121885	189
260	3300009148	Ga0105243_10675128	Ga0105243_106751282	189
261	3300014745	Ga0157377_10518995	Ga0157377_105189952	189
262	3300017792	Ga0163161_10102918	Ga0163161_101029183	189
263	3300027866	Ga0209813_10028717	Ga0209813_100287171	189
264	3300044683	Ga0466965_0114196	Ga0466965_0114196_316_903	189
265	3300048903	Ga0496100_0169267	Ga0496100_0169267_556_1182	189
266	3300048905	Ga0496102_0845401	Ga0496102_0845401_104_730	189
267	3300048909	Ga0496106_0100962	Ga0496106_0100962_1476_2102	189
268	3300048910	Ga0496107_0165204	Ga0496107_0165204_57_683	189
269	3300050489	nmdc:mga03683_6999_c1	nmdc:mga03683_6999_c1_3013_3603	189
270	3300050490	nmdc:mga03n38_170185_c1	nmdc:mga03n38_170185_c1_127_717	189
271	3300050490	nmdc:mga03n38_91431_c1	nmdc:mga03n38_91431_c1_134_724	189
272	3300050491	nmdc:mga00v17_14879_c1	nmdc:mga00v17_14879_c1_2907_3497	189
273	3300050492	nmdc:mga0yw44_129773_c1	nmdc:mga0yw44_129773_c1_557_1147	189
274	3300050492	nmdc:mga0yw44_265264_c1	nmdc:mga0yw44_265264_c1_299_892	189
275	3300050492	nmdc:mga0yw44_493331_c1	nmdc:mga0yw44_493331_c1_82_669	189
276	3300050495	nmdc:mga04h51_7032_c1	nmdc:mga04h51_7032_c1_1378_1968	189
277	3300005347	Ga0070668_100057404	Ga0070668_1000574043	190
278	3300005367	Ga0070667_100173076	Ga0070667_1001730762	190
279	3300005530	Ga0070679_100822541	Ga0070679_1008225412	190
280	3300005546	Ga0070696_100014304	Ga0070696_1000143047	190
281	3300005616	Ga0068852_101419901	Ga0068852_1014199011	190
282	3300005844	Ga0068862_100412260	Ga0068862_1004122602	190
283	3300005981	Ga0081538_10138611	Ga0081538_101386111	190
284	3300005985	Ga0081539_10012325	Ga0081539_100123252	190
285	3300005985	Ga0081539_10033886	Ga0081539_100338862	190
286	3300005985	Ga0081539_10042298	Ga0081539_100422983	190
287	3300005985	Ga0081539_10148814	Ga0081539_101488141	190
288	3300006847	Ga0075431_100415149	Ga0075431_1004151492	190
289	3300009094	Ga0111539_10098526	Ga0111539_100985263	190
290	3300009147	Ga0114129_10250436	Ga0114129_102504363	190
291	3300009148	Ga0105243_10423630	Ga0105243_104236301	190
292	3300013306	Ga0163162_10091754	Ga0163162_100917542	190
293	3300014325	Ga0163163_10117190	Ga0163163_101171903	190
294	3300025912	Ga0207707_10228413	Ga0207707_102284132	190
295	3300025944	Ga0207661_10837615	Ga0207661_108376152	190
296	3300025972	Ga0207668_10043271	Ga0207668_100432713	190
297	3300025986	Ga0207658_10154816	Ga0207658_101548162	190
298	3300030731	Ga0316177_1210231	Ga0316177_12102311	190
299	3300030736	Ga0316180_1131519	Ga0316180_11315191	190
300	3300031903	Ga0307407_10247373	Ga0307407_102473732	190
301	3300031995	Ga0307409_100235247	Ga0307409_1002352472	190
302	3300032002	Ga0307416_101153325	Ga0307416_1011533252	190
303	3300032126	Ga0307415_100106478	Ga0307415_1001064783	190
304	3300032126	Ga0307415_100319259	Ga0307415_1003192592	190
305	3300035691	Ga0373931_0383399	Ga0373931_0383399_156_740	190
306	3300037418	Ga0395900_0633096	Ga0395900_0633096_85_732	190
307	3300037471	Ga0395905_0299597	Ga0395905_0299597_429_1226	190
308	3300038443	Ga0395901_0133749	Ga0395901_0133749_1829_2476	190
309	3300041456	Ga0451795_1639384	Ga0451795_1639384_268_858	190
310	3300041509	Ga0451843_1277382	Ga0451843_1277382_124_708	190
311	3300042002	Ga0439442_057649	Ga0439442_057649_106_696	190
312	3300044694	Ga0466963_0637521	Ga0466963_0637521_116_706	190
313	3300044901	Ga0466960_0162716	Ga0466960_0162716_42_632	190
314	3300045976	Ga0466967_0009531	Ga0466967_0009531_4960_5550	190
315	3300045976	Ga0466967_1195984	Ga0466967_1195984_156_740	190
316	3300046463	Ga0495653_0258229	Ga0495653_0258229_408_992	190
317	3300046663	Ga0495635_0237629	Ga0495635_0237629_481_1065	190
318	3300048903	Ga0496100_0143859	Ga0496100_0143859_420_1004	190
319	3300048903	Ga0496100_0477071	Ga0496100_0477071_288_878	190
320	3300048904	Ga0496101_0005319	Ga0496101_0005319_1465_2049	190
321	3300048904	Ga0496101_0034064	Ga0496101_0034064_1658_2242	190
322	3300048904	Ga0496101_0101238	Ga0496101_0101238_150_737	190
323	3300048905	Ga0496102_0006313	Ga0496102_0006313_886_1470	190
324	3300048905	Ga0496102_0009007	Ga0496102_0009007_3158_3742	190
325	3300048906	Ga0496103_0061989	Ga0496103_0061989_1415_1999	190
326	3300048906	Ga0496103_0230822	Ga0496103_0230822_356_940	190
327	3300048907	Ga0496104_0005944	Ga0496104_0005944_5644_6231	190
328	3300048907	Ga0496104_0009637	Ga0496104_0009637_5754_6338	190
329	3300048908	Ga0496105_0025655	Ga0496105_0025655_4039_4623	190
330	3300048908	Ga0496105_0063708	Ga0496105_0063708_780_1367	190
331	3300048909	Ga0496106_0079782	Ga0496106_0079782_678_1262	190
332	3300048910	Ga0496107_0046251	Ga0496107_0046251_1411_1995	190
333	3300048910	Ga0496107_0121568	Ga0496107_0121568_759_1343	190
334	3300048911	Ga0496108_0070593	Ga0496108_0070593_1412_1996	190
335	3300048912	Ga0496109_0291574	Ga0496109_0291574_183_767	190
336	3300048912	Ga0496109_0414785	Ga0496109_0414785_160_744	190
337	3300048914	Ga0496111_0216281	Ga0496111_0216281_813_1397	190
338	3300048916	Ga0496113_0215582	Ga0496113_0215582_414_998	190
339	3300048916	Ga0496113_0252425	Ga0496113_0252425_134_718	190
340	3300048917	Ga0496114_0074405	Ga0496114_0074405_423_1007	190
341	3300048917	Ga0496114_0074430	Ga0496114_0074430_366_950	190
342	3300048917	Ga0496114_0079511	Ga0496114_0079511_1158_1745	190
343	3300048917	Ga0496114_0127421	Ga0496114_0127421_334_918	190
344	3300048922	Ga0496119_0054591	Ga0496119_0054591_391_978	190
345	3300049518	Ga0501295_042958	Ga0501295_042958_261_890	190
346	3300049570	Ga0501033_0000653	Ga0501033_0000653_22358_22945	190
347	3300049571	Ga0501034_0013729	Ga0501034_0013729_7534_8145	190
348	3300049572	Ga0501036_0026528	Ga0501036_0026528_1152_1763	190
349	3300049572	Ga0501036_0230028	Ga0501036_0230028_304_912	190
350	3300049573	Ga0501037_0049627	Ga0501037_0049627_1725_2336	190
351	3300049574	Ga0501038_0000471	Ga0501038_0000471_27050_27661	190
352	3300049575	Ga0501039_0279918	Ga0501039_0279918_566_1177	190
353	3300049578	Ga0501042_0050927	Ga0501042_0050927_1969_2580	190
354	3300049579	Ga0501043_0414515	Ga0501043_0414515_206_817	190
355	3300049579	Ga0501043_0687271	Ga0501043_0687271_99_686	190
356	3300049580	Ga0501046_0006182	Ga0501046_0006182_5790_6377	190
357	3300049581	Ga0501047_0004082	Ga0501047_0004082_2837_3448	190
358	3300049582	Ga0501048_0500238	Ga0501048_0500238_79_690	190
359	3300049583	Ga0501067_0066331	Ga0501067_0066331_227_814	190
360	3300049583	Ga0501067_0318385	Ga0501067_0318385_176_760	190
361	3300049584	Ga0501068_0035552	Ga0501068_0035552_1752_2414	190
362	3300049584	Ga0501068_0153362	Ga0501068_0153362_785_1378	190
363	3300049585	Ga0501069_0012245	Ga0501069_0012245_406_1068	190
364	3300049585	Ga0501069_0163284	Ga0501069_0163284_194_778	190
365	3300049586	Ga0501070_0012570	Ga0501070_0012570_1500_2162	190
366	3300049586	Ga0501070_0438282	Ga0501070_0438282_113_706	190
367	3300049588	Ga0501072_0041623	Ga0501072_0041623_749_1411	190
368	3300049588	Ga0501072_0117102	Ga0501072_0117102_323_913	190
369	3300049588	Ga0501072_0952425	Ga0501072_0952425_40_630	190
370	3300049589	Ga0501073_0160536	Ga0501073_0160536_41_703	190
371	3300049590	Ga0501074_0042386	Ga0501074_0042386_1127_1789	190
372	3300049590	Ga0501074_0242576	Ga0501074_0242576_136_744	190
373	3300049650	Ga0501199_011675	Ga0501199_011675_100_729	190
374	3300049679	Ga0501249_084704	Ga0501249_084704_130_729	190
375	3300049708	Ga0501245_071441	Ga0501245_071441_35_634	190
376	3300049741	Ga0501079_0203968	Ga0501079_0203968_198_860	190
377	3300049742	Ga0501080_0054936	Ga0501080_0054936_1439_2101	190
378	3300049744	Ga0501083_0134497	Ga0501083_0134497_567_1229	190
379	3300049767	Ga0501270_049850	Ga0501270_049850_29_628	190
380	3300049823	Ga0501044_0053689	Ga0501044_0053689_769_1380	190
381	3300050507	nmdc:mga05p37_176809_c1	nmdc:mga05p37_176809_c1_149_736	190
382	3300050510	nmdc:mga06r32_1194432_c1	nmdc:mga06r32_1194432_c1_38_625	190
383	3300053085	Ga0495619_0023977	Ga0495619_0023977_2717_3301	190
384	3300053118	Ga0500594_0187720	Ga0500594_0187720_35_622	190
385	3300053153	Ga0500616_0114482	Ga0500616_0114482_546_1160	190
386	3300005366	Ga0070659_100481653	Ga0070659_1004816531	191
387	3300005441	Ga0070700_100463442	Ga0070700_1004634421	191
388	3300005563	Ga0068855_100227335	Ga0068855_1002273352	191
389	3300005843	Ga0068860_100000578	Ga0068860_10000057826	191
390	3300005937	Ga0081455_10351727	Ga0081455_103517272	191
391	3300006038	Ga0075365_10008185	Ga0075365_100081853	191
392	3300006038	Ga0075365_10017444	Ga0075365_100174442	191
393	3300006038	Ga0075365_10174186	Ga0075365_101741862	191
394	3300006038	Ga0075365_10409356	Ga0075365_104093562	191
395	3300006042	Ga0075368_10006944	Ga0075368_100069443	191
396	3300006042	Ga0075368_10289380	Ga0075368_102893802	191
397	3300006048	Ga0075363_100005391	Ga0075363_1000053915	191
398	3300006048	Ga0075363_100017399	Ga0075363_1000173992	191
399	3300006048	Ga0075363_100064733	Ga0075363_1000647332	191
400	3300006051	Ga0075364_10019676	Ga0075364_100196766	191
401	3300006051	Ga0075364_10077631	Ga0075364_100776313	191
402	3300006051	Ga0075364_10104078	Ga0075364_101040782	191
403	3300006051	Ga0075364_10131230	Ga0075364_101312302	191
404	3300006178	Ga0075367_10040460	Ga0075367_100404602	191
405	3300006178	Ga0075367_10077584	Ga0075367_100775842	191
406	3300006353	Ga0075370_10014015	Ga0075370_100140152	191
407	3300009092	Ga0105250_10355739	Ga0105250_103557391	191
408	3300009101	Ga0105247_10914285	Ga0105247_109142851	191
409	3300009147	Ga0114129_11976798	Ga0114129_119767981	191
410	3300013104	Ga0157370_10552567	Ga0157370_105525672	191
411	3300013105	Ga0157369_10447243	Ga0157369_104472432	191
412	3300020069	Ga0197907_11115886	Ga0197907_111158861	191
413	3300020076	Ga0206355_1284026	Ga0206355_12840261	191
414	3300020080	Ga0206350_11435542	Ga0206350_114355421	191
415	3300022467	Ga0224712_10008174	Ga0224712_100081742	191
416	3300025912	Ga0207707_10672866	Ga0207707_106728661	191
417	3300025915	Ga0207693_10701614	Ga0207693_107016141	191
418	3300025949	Ga0207667_10104345	Ga0207667_101043452	191
419	3300026075	Ga0207708_10685823	Ga0207708_106858232	191
420	3300026118	Ga0207675_100482849	Ga0207675_1004828491	191
421	3300027866	Ga0209813_10001796	Ga0209813_100017965	191
422	3300028381	Ga0268264_10000226	Ga0268264_1000022626	191
423	3300031852	Ga0307410_10548656	Ga0307410_105486562	191
424	3300031995	Ga0307409_101074898	Ga0307409_1010748982	191
425	3300032126	Ga0307415_100659989	Ga0307415_1006599892	191
426	3300035170	Ga0373943_0140665	Ga0373943_0140665_243_833	191
427	3300037418	Ga0395900_0040692	Ga0395900_0040692_2346_2942	191
428	3300037418	Ga0395900_0125305	Ga0395900_0125305_304_900	191
429	3300038443	Ga0395901_0129508	Ga0395901_0129508_83_682	191
430	3300038443	Ga0395901_0472328	Ga0395901_0472328_232_825	191
431	3300044693	Ga0466961_0176568	Ga0466961_0176568_198_818	191
432	3300044901	Ga0466960_0103038	Ga0466960_0103038_650_1228	191
433	3300045049	Ga0466959_0021275	Ga0466959_0021275_1195_1815	191
434	3300046511	Ga0495608_0090605	Ga0495608_0090605_452_1042	191
435	3300046516	Ga0495628_0541335	Ga0495628_0541335_21_641	191
436	3300046543	Ga0495645_0242896	Ga0495645_0242896_369_959	191
437	3300046683	Ga0495658_0350441	Ga0495658_0350441_69_713	191
438	3300046689	Ga0495613_0277262	Ga0495613_0277262_288_878	191
439	3300047321	Ga0495676_0246464	Ga0495676_0246464_500_1090	191
440	3300048911	Ga0496108_0194700	Ga0496108_0194700_366_989	191
441	3300048925	Ga0496122_0213673	Ga0496122_0213673_501_1100	191
442	3300049586	Ga0501070_0013880	Ga0501070_0013880_2419_3012	191
443	3300050490	nmdc:mga03n38_187390_c1	nmdc:mga03n38_187390_c1_30_614	191
444	3300050491	nmdc:mga00v17_199947_c1	nmdc:mga00v17_199947_c1_390_983	191
445	3300050491	nmdc:mga00v17_24296_c1	nmdc:mga00v17_24296_c1_905_1498	191
446	3300050491	nmdc:mga00v17_61409_c1	nmdc:mga00v17_61409_c1_370_966	191
447	3300050492	nmdc:mga0yw44_183528_c1	nmdc:mga0yw44_183528_c1_149_742	191
448	3300050492	nmdc:mga0yw44_7386_c1	nmdc:mga0yw44_7386_c1_1969_2565	191
449	3300050492	nmdc:mga0yw44_826735_c1	nmdc:mga0yw44_826735_c1_10_606	191
450	3300050494	nmdc:mga06z11_244445_c1	nmdc:mga06z11_244445_c1_28_621	191
451	3300050494	nmdc:mga06z11_42398_c1	nmdc:mga06z11_42398_c1_1137_1730	191
452	3300050495	nmdc:mga04h51_6070_c1	nmdc:mga04h51_6070_c1_1387_1980	191
453	3300050496	nmdc:mga07m45_11731_c1	nmdc:mga07m45_11731_c1_3283_3942	191
454	3300053085	Ga0495619_0226134	Ga0495619_0226134_89_679	191
455	3300003203	JGI25406J46586_10015465	JGI25406J46586_100154652	192
456	3300005338	Ga0068868_101348802	Ga0068868_1013488021	192
457	3300005356	Ga0070674_100124694	Ga0070674_1001246942	192
458	3300005366	Ga0070659_100024214	Ga0070659_1000242142	192
459	3300005435	Ga0070714_100766702	Ga0070714_1007667021	192
460	3300005455	Ga0070663_100329734	Ga0070663_1003297341	192
461	3300005543	Ga0070672_100237259	Ga0070672_1002372592	192
462	3300005615	Ga0070702_100768165	Ga0070702_1007681651	192
463	3300005616	Ga0068852_100010849	Ga0068852_1000108494	192
464	3300005985	Ga0081539_10002358	Ga0081539_1000235816	192
465	3300005985	Ga0081539_10003148	Ga0081539_1000314815	192
466	3300006028	Ga0070717_10864232	Ga0070717_108642322	192
467	3300006844	Ga0075428_100100249	Ga0075428_1001002493	192
468	3300006847	Ga0075431_100000549	Ga0075431_10000054922	192
469	3300006847	Ga0075431_100264958	Ga0075431_1002649581	192
470	3300006880	Ga0075429_100000823	Ga0075429_10000082310	192
471	3300006880	Ga0075429_100009377	Ga0075429_1000093773	192
472	3300009094	Ga0111539_11339656	Ga0111539_113396562	192
473	3300009098	Ga0105245_10564124	Ga0105245_105641242	192
474	3300009174	Ga0105241_10076729	Ga0105241_100767292	192
475	3300009551	Ga0105238_10217170	Ga0105238_102171702	192
476	3300009553	Ga0105249_10161867	Ga0105249_101618672	192
477	3300009993	Ga0105028_114200	Ga0105028_1142001	192
478	3300013306	Ga0163162_10131049	Ga0163162_101310493	192
479	3300013307	Ga0157372_10578665	Ga0157372_105786652	192
480	3300014326	Ga0157380_10248204	Ga0157380_102482042	192
481	3300014326	Ga0157380_10754853	Ga0157380_107548531	192
482	3300014968	Ga0157379_10828304	Ga0157379_108283041	192
483	3300017792	Ga0163161_10304605	Ga0163161_103046052	192
484	3300025911	Ga0207654_10039468	Ga0207654_100394682	192
485	3300025944	Ga0207661_10044130	Ga0207661_100441303	192
486	3300025961	Ga0207712_10149878	Ga0207712_101498783	192
487	3300025972	Ga0207668_10443164	Ga0207668_104431641	192
488	3300026023	Ga0207677_11038067	Ga0207677_110380671	192
489	3300026067	Ga0207678_10553937	Ga0207678_105539372	192
490	3300026067	Ga0207678_10576148	Ga0207678_105761482	192
491	3300026078	Ga0207702_10381156	Ga0207702_103811562	192
492	3300026078	Ga0207702_10486895	Ga0207702_104868952	192
493	3300026142	Ga0207698_10001762	Ga0207698_1000176210	192
494	3300030742	Ga0316183_1207072	Ga0316183_12070722	192
495	3300031456	Ga0307513_10043631	Ga0307513_100436314	192
496	3300031548	Ga0307408_100374549	Ga0307408_1003745492	192
497	3300031731	Ga0307405_10137422	Ga0307405_101374222	192
498	3300031731	Ga0307405_10266539	Ga0307405_102665392	192
499	3300031852	Ga0307410_10047018	Ga0307410_100470182	192
500	3300031852	Ga0307410_10324329	Ga0307410_103243291	192
501	3300031901	Ga0307406_10063874	Ga0307406_100638743	192
502	3300031901	Ga0307406_10823530	Ga0307406_108235301	192
503	3300031903	Ga0307407_10305359	Ga0307407_103053591	192
504	3300031911	Ga0307412_10502340	Ga0307412_105023401	192
505	3300031995	Ga0307409_100017364	Ga0307409_1000173644	192
506	3300031995	Ga0307409_100325128	Ga0307409_1003251282	192
507	3300032002	Ga0307416_100022377	Ga0307416_1000223773	192
508	3300032002	Ga0307416_101099697	Ga0307416_1010996972	192
509	3300032004	Ga0307414_10236631	Ga0307414_102366312	192
510	3300032004	Ga0307414_10823364	Ga0307414_108233642	192
511	3300032004	Ga0307414_11183872	Ga0307414_111838721	192
512	3300032126	Ga0307415_100047591	Ga0307415_1000475913	192
513	3300032126	Ga0307415_100695223	Ga0307415_1006952232	192
514	3300032126	Ga0307415_100698176	Ga0307415_1006981762	192
515	3300032126	Ga0307415_100860712	Ga0307415_1008607121	192
516	3300037418	Ga0395900_0092063	Ga0395900_0092063_746_1339	192
517	3300037418	Ga0395900_0290920	Ga0395900_0290920_116_712	192
518	3300037466	Ga0395898_0609265	Ga0395898_0609265_120_713	192
519	3300037853	Ga0436364_0406268	Ga0436364_0406268_366_977	192
520	3300044683	Ga0466965_0006751	Ga0466965_0006751_3665_4270	192
521	3300044901	Ga0466960_0229160	Ga0466960_0229160_102_695	192
522	3300045976	Ga0466967_0254614	Ga0466967_0254614_659_1237	192
523	3300046531	Ga0495665_0323996	Ga0495665_0323996_74_661	192
524	3300048912	Ga0496109_0128971	Ga0496109_0128971_1143_1733	192
525	3300048914	Ga0496111_0021292	Ga0496111_0021292_823_1476	192
526	3300048917	Ga0496114_0377314	Ga0496114_0377314_116_706	192
527	3300048927	Ga0496124_0330990	Ga0496124_0330990_364_1017	192
528	3300049571	Ga0501034_0020124	Ga0501034_0020124_2385_3011	192
529	3300050507	nmdc:mga05p37_332266_c1	nmdc:mga05p37_332266_c1_306_947	192
530	3300050508	nmdc:mga09592_216_c1	nmdc:mga09592_216_c1_6113_6754	192
531	3300050508	nmdc:mga09592_24874_c1	nmdc:mga09592_24874_c1_4002_4580	192
532	3300050509	nmdc:mga0qj67_363_c1	nmdc:mga0qj67_363_c1_21738_22379	192
533	3300050510	nmdc:mga06r32_401641_c1	nmdc:mga06r32_401641_c1_505_1083	192
534	3300050510	nmdc:mga06r32_452_c1	nmdc:mga06r32_452_c1_16199_16840	192
535	3300053153	Ga0500616_0004085	Ga0500616_0004085_7921_8562	192
536	3300053159	Ga0500630_125256	Ga0500630_125256_47_637	192
537	3300059424	Ga0590075_011768	Ga0590075_011768_870_1448	192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

77

160

0.91 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2gmy-assembly1.cif.gz_C	crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd	0.9169	38	174
7xw1-assembly1.cif.gz_A	the crystal structure of ahpd from pseudomonas aeruginosa	0.8944	41	172
2ijc-assembly2.cif.gz_I	structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa	0.8832	38	175
7xw1-assembly1.cif.gz_A	the crystal structure of ahpd from pseudomonas aeruginosa	0.882	41	172
6ohi-assembly1.cif.gz_B	crystal structure of the debrominase bmp8 (apo)	0.8632	20	180

ID	Description	Score	Start	End	Superfamily
af_O53377_388_550_1.20.1290.10	Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like	0.9358	18	177	1.20.1290.10
2gmyF00	Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like	0.9155	38	174	1.20.1290.10
af_O53377_388_550_1.20.1290.10	Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like	0.914	18	177	1.20.1290.10
af_O53905_23_180_1.20.1290.10	Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like	0.8879	37	178	1.20.1290.10
af_P76222_42_172_1.20.1290.10	Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like	0.885	47	175	1.20.1290.10

ID	Description	Score	Start	End	GO Terms
AF-K8XN06-F1-model_v4	Carboxymuconolactone decarboxylase-like domain-containing protein	0.9988	1	189	GO:0051920
AF-N1MD04-F1-model_v4	deleted	0.998	1	189
AF-A0A6J4Q8I4-F1-model_v4	Carboxymuconolactone decarboxylase	0.9922	51	192	GO:0016020 GO:0051920
AF-A0A402DVB0-F1-model_v4	Carboxymuconolactone decarboxylase-like domain-containing protein	0.9908	1	189	GO:0051920
AF-A0A4Q8BDN7-F1-model_v4	Alkylhydroperoxidase family enzyme	0.9892	5	190	GO:0051920

Feature Viewer

pLDDT	pTM	Quality
94.76	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F460902

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02627

CMD

Carboxymuconolactone decarboxylase family

77

160

0.91

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map