F460907

General Info

Members Datasets Scaffolds Average Seq Length
537 235 524 184

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10407576|Ga0105249_104075762
Length 209
Sequence MACCATAEDKATRPRILSMAASESEPLHQDGIGGPDGLERLWTPYRMAYIRGESKPSDDSEGECPFCRIPREDDDERFLVVRRGRLAYAVLNLYPYAPGHLMVCPYRHIADFTETTDAESVEIAAMTKAALRTLRSVSKAEGFNVGMNQGAAGGAGIAAHLHQHVVPRWVGDQNFMPVIGHTKTLPQLLQETRGLIADAWDEPAGQATG

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2643221679 Angustibacter sp. Root456 Isolate Unclassified
3 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
4 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
5 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
6 2808606394 Promicromonospora sp. C35 Isolate Unclassified
7 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
8 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
9 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
10 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
11 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
12 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
13 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
129 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
145 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
146 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
147 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
148 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
149 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
150 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
151 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
152 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0
Isolates 2.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 0
Rhizoplane 11.17
Rhizosphere 79.14
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10082217 3300001979 Bacteria 842
2 JGI24737J22298_10100807 3300001990 Bacteria 855
3 JGI24735J21928_10020671 3300002067 Bacteria 2015
4 JGI25406J46586_10037567 3300003203 Bacteria 1744
5 Ga0070658_10124374 3300005327 Bacteria 2146
6 Ga0070658_10202272 3300005327 Bacteria 1676
7 Ga0070658_11303750 3300005327 Bacteria 631
8 Ga0070683_100004167 3300005329 Bacteria 11841
9 Ga0070683_100146494 3300005329 Bacteria 2238
10 Ga0070683_100424109 3300005329 Bacteria 1269
11 Ga0070677_10527349 3300005333 Bacteria 644
12 Ga0070682_100015633 3300005337 Bacteria 4400
13 Ga0070682_100021170 3300005337 Bacteria 3832
14 Ga0068868_100204962 3300005338 Bacteria 1646
15 Ga0068868_100303417 3300005338 Bacteria 1357
16 Ga0068868_100474494 3300005338 Bacteria 1092
17 Ga0070660_100005730 3300005339 Bacteria 8602
18 Ga0070660_100084791 3300005339 Bacteria 2491
19 Ga0070689_100808097 3300005340 Bacteria 825
20 Ga0070691_10211470 3300005341 Bacteria 1023
21 Ga0070687_100070259 3300005343 Bacteria 1878
22 Ga0070692_10167961 3300005345 Bacteria 1262
23 Ga0070668_100038354 3300005347 Bacteria 3661
24 Ga0070669_100519814 3300005353 Bacteria 989
25 Ga0070671_101469066 3300005355 Bacteria 603
26 Ga0070674_100372881 3300005356 Bacteria 1159
27 Ga0070674_100660122 3300005356 Bacteria 890
28 Ga0070659_100014011 3300005366 Bacteria 5983
29 Ga0070659_100151301 3300005366 Unclassified 1893
30 Ga0070659_100186222 3300005366 Bacteria 1705
31 Ga0070659_100220864 3300005366 Bacteria 1564
32 Ga0070667_100013554 3300005367 Bacteria 6734
33 Ga0070700_100855050 3300005441 Bacteria 737
34 Ga0070678_100545200 3300005456 Bacteria 1029
35 Ga0070662_100077975 3300005457 Bacteria 2460
36 Ga0070662_100934529 3300005457 Bacteria 741
37 Ga0070681_10170818 3300005458 Bacteria 2096
38 Ga0070681_10319133 3300005458 Bacteria 1463
39 Ga0068867_100585424 3300005459 Bacteria 971
40 Ga0070679_100007194 3300005530 Bacteria 10395
41 Ga0070684_100021693 3300005535 Bacteria 5350
42 Ga0070684_100146426 3300005535 Bacteria 2138
43 Ga0070684_100182623 3300005535 Bacteria 1908
44 Ga0070684_100191932 3300005535 Bacteria 1859
45 Ga0070684_100222488 3300005535 Bacteria 1722
46 Ga0070684_100356386 3300005535 Bacteria 1346
47 Ga0070672_100322308 3300005543 Bacteria 1314
48 Ga0070696_100624587 3300005546 Bacteria 871
49 Ga0070664_100058520 3300005564 Bacteria 3278
50 Ga0068857_100005137 3300005577 Bacteria 11127
51 Ga0068857_100566875 3300005577 Bacteria 1071
52 Ga0068857_100957081 3300005577 Bacteria 823
53 Ga0070702_100371621 3300005615 Bacteria 1014
54 Ga0070702_100513674 3300005615 Bacteria 882
55 Ga0070702_100936790 3300005615 Bacteria 681
56 Ga0068859_101294702 3300005617 Bacteria 803
57 Ga0068864_100056624 3300005618 Bacteria 3387
58 Ga0068866_10187280 3300005718 Unclassified 1227
59 Ga0068866_10552840 3300005718 Bacteria 770
60 Ga0068861_100063324 3300005719 Bacteria 2843
61 Ga0068861_100122199 3300005719 Bacteria 2102
62 Ga0068861_100166954 3300005719 Bacteria 1821
63 Ga0068861_100648335 3300005719 Bacteria 975
64 Ga0068851_10522364 3300005834 Bacteria 714
65 Ga0068870_10072069 3300005840 Bacteria 1887
66 Ga0068860_100182941 3300005843 Bacteria 2026
67 Ga0068862_100874881 3300005844 Unclassified 882
68 Ga0081539_10000127 3300005985 Bacteria 179934
69 Ga0075365_10033077 3300006038 Bacteria 3329
70 Ga0075365_10070173 3300006038 Bacteria 2356
71 Ga0075365_10081115 3300006038 Bacteria 2197
72 Ga0075365_10116088 3300006038 Bacteria 1843
73 Ga0075365_10128106 3300006038 Bacteria 1755
74 Ga0075365_10172013 3300006038 Bacteria 1512
75 Ga0075365_10492899 3300006038 Bacteria 866
76 Ga0075368_10096895 3300006042 Bacteria 1209
77 Ga0075363_100003180 3300006048 Bacteria 6921
78 Ga0075363_100041754 3300006048 Bacteria 2420
79 Ga0075363_100066044 3300006048 Bacteria 1957
80 Ga0075364_10029255 3300006051 Bacteria 3532
81 Ga0075364_10054928 3300006051 Bacteria 2605
82 Ga0075364_10285756 3300006051 Bacteria 1122
83 Ga0075367_10163545 3300006178 Bacteria 1384
84 Ga0075428_100034251 3300006844 Bacteria 5603
85 Ga0075430_100122736 3300006846 Bacteria 2166
86 Ga0075431_100033384 3300006847 Bacteria 5304
87 Ga0075433_10011509 3300006852 Bacteria 7125
88 Ga0075433_10020818 3300006852 Bacteria 5490
89 Ga0075434_100003989 3300006871 Bacteria 13221
90 Ga0075434_100394158 3300006871 Bacteria 1405
91 Ga0075429_100040766 3300006880 Bacteria 4043
92 Ga0075429_101221911 3300006880 Bacteria 656
93 Ga0068865_100039942 3300006881 Bacteria 3186
94 Ga0068865_100093593 3300006881 Bacteria 2185
95 Ga0068865_100158941 3300006881 Bacteria 1722
96 Ga0075436_100003948 3300006914 Bacteria 10166
97 Ga0097620_101294513 3300006931 Bacteria 803
98 Ga0075435_100002516 3300007076 Bacteria 12200
99 Ga0075435_100102388 3300007076 Bacteria 2373
100 Ga0111539_11657968 3300009094 Bacteria 741
101 Ga0105245_10037145 3300009098 Bacteria 4330
102 Ga0105245_10106760 3300009098 Bacteria 2599
103 Ga0105245_10164000 3300009098 Bacteria 2111
104 Ga0105245_10858002 3300009098 Bacteria 948
105 Ga0105245_11106731 3300009098 Bacteria 838
106 Ga0105247_11199498 3300009101 Bacteria 604
107 Ga0105243_10016977 3300009148 Bacteria 5504
108 Ga0105243_10094842 3300009148 Bacteria 2465
109 Ga0105242_10010999 3300009176 Bacteria 6951
110 Ga0105242_10252204 3300009176 Bacteria 1590
111 Ga0105248_10522364 3300009177 Bacteria 1339
112 Ga0105248_10547129 3300009177 Bacteria 1306
113 Ga0105238_10143226 3300009551 Bacteria 2367
114 Ga0105238_10161975 3300009551 Bacteria 2213
115 Ga0105249_10043608 3300009553 Bacteria 4079
116 Ga0105249_10044913 3300009553 Bacteria 4018
117 Ga0105249_10407576 3300009553 Bacteria 1391
118 Ga0105249_10506625 3300009553 Bacteria 1253
119 Ga0105239_10011816 3300010375 Bacteria 9745
120 Ga0105239_10200467 3300010375 Bacteria 2236
121 Ga0105239_11592511 3300010375 Bacteria 755
122 Ga0105246_11002962 3300011119 Bacteria 756
123 Ga0157371_10105206 3300013102 Bacteria 2002
124 Ga0157371_10144228 3300013102 Bacteria 1696
125 Ga0157369_10250356 3300013105 Bacteria 1849
126 Ga0157374_11049549 3300013296 Bacteria 835
127 Ga0157378_10479134 3300013297 Bacteria 1239
128 Ga0163162_10025921 3300013306 Bacteria 5794
129 Ga0163162_10584497 3300013306 Bacteria 1244
130 Ga0157372_10005055 3300013307 Bacteria 14014
131 Ga0157372_10153423 3300013307 Bacteria 2659
132 Ga0157372_10239890 3300013307 Bacteria 2103
133 Ga0157375_10022317 3300013308 Bacteria 5825
134 Ga0157375_10070276 3300013308 Bacteria 3511
135 Ga0157375_10178795 3300013308 Bacteria 2273
136 Ga0157375_10184116 3300013308 Bacteria 2241
137 Ga0157375_11288104 3300013308 Bacteria 859
138 Ga0163163_10025986 3300014325 Bacteria 5591
139 Ga0163163_10709436 3300014325 Bacteria 1069
140 Ga0157380_10203181 3300014326 Bacteria 1759
141 Ga0157380_11196820 3300014326 Bacteria 803
142 Ga0157380_11241815 3300014326 Bacteria 790
143 Ga0157377_10182210 3300014745 Bacteria 1322
144 Ga0157377_10877454 3300014745 Unclassified 668
145 Ga0163161_10137655 3300017792 Bacteria 1847
146 Ga0163161_10261628 3300017792 Bacteria 1351
147 Ga0207656_10357834 3300025321 Bacteria 729
148 Ga0207688_10009974 3300025901 Bacteria 5167
149 Ga0207688_10104875 3300025901 Bacteria 1636
150 Ga0207688_10113802 3300025901 Bacteria 1573
151 Ga0207688_10496920 3300025901 Bacteria 764
152 Ga0207647_10009136 3300025904 Bacteria 7052
153 Ga0207647_10087049 3300025904 Bacteria 1867
154 Ga0207647_10257451 3300025904 Bacteria 1000
155 Ga0207645_10898807 3300025907 Bacteria 601
156 Ga0207643_10052044 3300025908 Bacteria 2325
157 Ga0207643_10299036 3300025908 Bacteria 1001
158 Ga0207705_10121134 3300025909 Bacteria 1941
159 Ga0207705_10320334 3300025909 Bacteria 1191
160 Ga0207707_10081176 3300025912 Bacteria 2831
161 Ga0207707_10203939 3300025912 Bacteria 1724
162 Ga0207662_10454993 3300025918 Bacteria 876
163 Ga0207657_10058676 3300025919 Bacteria 3310
164 Ga0207657_10210956 3300025919 Bacteria 1559
165 Ga0207652_10039890 3300025921 Bacteria 3986
166 Ga0207681_10091553 3300025923 Bacteria 2173
167 Ga0207694_10412217 3300025924 Bacteria 1125
168 Ga0207659_10401898 3300025926 Bacteria 1146
169 Ga0207687_10010253 3300025927 Bacteria 6120
170 Ga0207687_10082718 3300025927 Bacteria 2323
171 Ga0207687_10136195 3300025927 Bacteria 1857
172 Ga0207687_10157060 3300025927 Bacteria 1741
173 Ga0207687_10973287 3300025927 Bacteria 727
174 Ga0207690_10019354 3300025932 Bacteria 4191
175 Ga0207690_10198671 3300025932 Bacteria 1521
176 Ga0207690_10435393 3300025932 Bacteria 1051
177 Ga0207709_10055188 3300025935 Bacteria 2453
178 Ga0207704_10033521 3300025938 Bacteria 2921
179 Ga0207704_10151578 3300025938 Bacteria 1636
180 Ga0207704_10154297 3300025938 Bacteria 1625
181 Ga0207704_10184202 3300025938 Bacteria 1512
182 Ga0207691_10338395 3300025940 Bacteria 1288
183 Ga0207711_10383964 3300025941 Bacteria 1303
184 Ga0207661_10085539 3300025944 Bacteria 2614
185 Ga0207661_10207351 3300025944 Bacteria 1726
186 Ga0207661_10298524 3300025944 Bacteria 1444
187 Ga0207661_10444249 3300025944 Bacteria 1180
188 Ga0207661_10446666 3300025944 Bacteria 1177
189 Ga0207661_11145772 3300025944 Bacteria 716
190 Ga0207679_10042248 3300025945 Bacteria 3275
191 Ga0207667_10157068 3300025949 Bacteria 2340
192 Ga0207667_11164928 3300025949 Bacteria 752
193 Ga0207712_10018134 3300025961 Bacteria 4580
194 Ga0207712_10030760 3300025961 Bacteria 3611
195 Ga0207712_10080238 3300025961 Bacteria 2373
196 Ga0207712_10296892 3300025961 Bacteria 1324
197 Ga0207668_10044522 3300025972 Bacteria 3020
198 Ga0207668_10303735 3300025972 Bacteria 1318
199 Ga0207668_10489347 3300025972 Bacteria 1056
200 Ga0207639_10568765 3300026041 Bacteria 1042
201 Ga0207708_10173670 3300026075 Bacteria 1708
202 Ga0207702_11205919 3300026078 Bacteria 751
203 Ga0207648_10022104 3300026089 Bacteria 5714
204 Ga0207676_10206995 3300026095 Bacteria 1738
205 Ga0207676_10385213 3300026095 Bacteria 1306
206 Ga0207674_10007885 3300026116 Bacteria 12370
207 Ga0207674_10712800 3300026116 Bacteria 968
208 Ga0207675_100009269 3300026118 Bacteria 9229
209 Ga0207675_100011648 3300026118 Bacteria 8223
210 Ga0207675_100108800 3300026118 Bacteria 2614
211 Ga0207683_10050535 3300026121 Bacteria 3642
212 Ga0207698_10219567 3300026142 Bacteria 1717
213 Ga0207698_12045546 3300026142 Bacteria 587
214 Ga0209813_10002147 3300027866 Bacteria 4501
215 Ga0209813_10166573 3300027866 Bacteria 798
216 Ga0207428_10000855 3300027907 Bacteria 34313
217 Ga0207428_10008400 3300027907 Bacteria 9325
218 Ga0268265_11241709 3300028380 Bacteria 744
219 Ga0268264_10000576 3300028381 Bacteria 44482
220 Ga0316181_1019724 3300030744 Bacteria 1596
221 Ga0316182_1384724 3300030745 Bacteria 764
222 Ga0265327_10000062 3300031251 Bacteria 234320
223 Ga0307413_10762144 3300031824 Bacteria 810
224 Ga0307410_10038061 3300031852 Bacteria 3147
225 Ga0307410_10494167 3300031852 Bacteria 1006
226 Ga0307410_10718625 3300031852 Bacteria 843
227 Ga0307406_10026597 3300031901 Bacteria 3477
228 Ga0307406_10457930 3300031901 Bacteria 1025
229 Ga0307406_10649252 3300031901 Bacteria 876
230 Ga0307407_10005801 3300031903 Bacteria 5402
231 Ga0307407_10112694 3300031903 Bacteria 1710
232 Ga0307407_10405024 3300031903 Bacteria 980
233 Ga0307412_10025274 3300031911 Bacteria 3677
234 Ga0307412_10988301 3300031911 Bacteria 743
235 Ga0307409_100089280 3300031995 Bacteria 2519
236 Ga0307409_100112482 3300031995 Bacteria 2286
237 Ga0307409_100182419 3300031995 Bacteria 1859
238 Ga0307409_100371204 3300031995 Bacteria 1357
239 Ga0307409_100685121 3300031995 Bacteria 1023
240 Ga0307416_100020809 3300032002 Bacteria 4692
241 Ga0307416_100249440 3300032002 Bacteria 1726
242 Ga0307416_100599351 3300032002 Bacteria 1181
243 Ga0307416_100692880 3300032002 Bacteria 1107
244 Ga0307411_10018683 3300032005 Bacteria 3984
245 Ga0307411_10126893 3300032005 Bacteria 1857
246 Ga0307411_10249378 3300032005 Bacteria 1395
247 Ga0307415_100003106 3300032126 Bacteria 8400
248 Ga0395900_0027470 3300037418 Bacteria 5830
249 Ga0395900_0208137 3300037418 Bacteria 1976
250 Ga0395898_0009822 3300037466 Bacteria 10031
251 Ga0395898_0033637 3300037466 Bacteria 5114
252 Ga0395898_0185297 3300037466 Bacteria 1989
253 Ga0395905_0030766 3300037471 Bacteria 5056
254 Ga0395901_0052553 3300038443 Bacteria 4234
255 Ga0395901_0090101 3300038443 Bacteria 3210
256 Ga0395901_0111700 3300038443 Bacteria 2870
257 Ga0395901_0260071 3300038443 Bacteria 1807
258 Ga0451787_738908 3300041441 Bacteria 742
259 Ga0451793_1107916 3300041452 Bacteria 3797
260 Ga0451797_0053692 3300041453 Bacteria 1489
261 Ga0451835_0972303 3300041492 Bacteria 618
262 Ga0451837_1114922 3300041494 Bacteria 946
263 Ga0451841_0298374 3300041498 Bacteria 1269
264 Ga0451845_0011386 3300041501 Bacteria 1132
265 Ga0451849_0240205 3300041505 Bacteria 1038
266 Ga0451843_0456137 3300041509 Bacteria 799
267 Ga0451853_2225099 3300041512 Bacteria 978
268 Ga0451853_3478986 3300041512 Bacteria 2019
269 Ga0439463_020975 3300042016 Bacteria 1631
270 Ga0466972_0024035 3300044658 Bacteria 3026
271 Ga0466972_0030451 3300044658 Bacteria 2656
272 Ga0466965_0022651 3300044683 Bacteria 3029
273 Ga0466965_0051804 3300044683 Bacteria 2037
274 Ga0466965_0067095 3300044683 Bacteria 1800
275 Ga0466965_0661178 3300044683 Bacteria 597
276 Ga0466966_0030796 3300044684 Bacteria 3480
277 Ga0466966_0033730 3300044684 Bacteria 3313
278 Ga0466966_0138379 3300044684 Bacteria 1489
279 Ga0466966_0295829 3300044684 Bacteria 973
280 Ga0466961_0016493 3300044693 Bacteria 4746
281 Ga0466961_0017051 3300044693 Bacteria 4664
282 Ga0466961_0020218 3300044693 Bacteria 4284
283 Ga0466961_0095105 3300044693 Bacteria 1879
284 Ga0466961_0171204 3300044693 Bacteria 1350
285 Ga0466963_0009098 3300044694 Bacteria 5970
286 Ga0466963_0041680 3300044694 Bacteria 3012
287 Ga0466963_0254294 3300044694 Bacteria 1233
288 Ga0466963_0305952 3300044694 Bacteria 1118
289 Ga0466964_0023936 3300044706 Bacteria 2377
290 Ga0466971_0050423 3300044719 Bacteria 1873
291 Ga0466971_0093046 3300044719 Bacteria 1381
292 Ga0466970_0006407 3300044765 Bacteria 5887
293 Ga0466970_0008863 3300044765 Bacteria 5072
294 Ga0466970_0115977 3300044765 Bacteria 1465
295 Ga0466970_0207474 3300044765 Bacteria 1091
296 Ga0466970_0294185 3300044765 Bacteria 915
297 Ga0466957_0016137 3300044842 Bacteria 4366
298 Ga0466957_0035939 3300044842 Bacteria 2976
299 Ga0466957_0150234 3300044842 Bacteria 1506
300 Ga0466957_0303068 3300044842 Bacteria 1074
301 Ga0466957_0595387 3300044842 Bacteria 774
302 Ga0466960_0008282 3300044901 Bacteria 4253
303 Ga0466960_0073936 3300044901 Bacteria 1702
304 Ga0466960_0087243 3300044901 Bacteria 1584
305 Ga0466960_0089070 3300044901 Bacteria 1570
306 Ga0466959_0027187 3300045049 Bacteria 4243
307 Ga0466959_0144576 3300045049 Bacteria 1679
308 Ga0466959_0331086 3300045049 Bacteria 1040
309 Ga0466959_0473839 3300045049 Bacteria 848
310 Ga0466958_0063052 3300045836 Bacteria 2260
311 Ga0466958_0076799 3300045836 Bacteria 2051
312 Ga0466958_0138042 3300045836 Bacteria 1534
313 Ga0466958_0248475 3300045836 Bacteria 1137
314 Ga0466967_0023189 3300045976 Bacteria 5082
315 Ga0466967_0045637 3300045976 Bacteria 3808
316 Ga0466967_0096205 3300045976 Bacteria 2700
317 Ga0466967_0104448 3300045976 Bacteria 2594
318 Ga0466967_0164099 3300045976 Bacteria 2087
319 Ga0466967_0170434 3300045976 Bacteria 2048
320 Ga0466967_0363748 3300045976 Bacteria 1402
321 Ga0466967_0393938 3300045976 Bacteria 1346
322 Ga0466967_0398715 3300045976 Bacteria 1338
323 Ga0466967_1072997 3300045976 Bacteria 802
324 Ga0495608_0077615 3300046511 Bacteria 2162
325 Ga0495608_0228118 3300046511 Bacteria 1167
326 Ga0495620_0130358 3300046515 Bacteria 987
327 Ga0495632_0291827 3300046519 Bacteria 725
328 Ga0495635_0259239 3300046663 Bacteria 1171
329 Ga0495658_0377471 3300046683 Bacteria 902
330 Ga0495670_0041459 3300046691 Bacteria 2297
331 Ga0495671_0342723 3300046692 Bacteria 717
332 Ga0495636_0236535 3300047318 Bacteria 841
333 Ga0495674_0843883 3300047319 Bacteria 710
334 Ga0496100_0077880 3300048903 Bacteria 2230
335 Ga0496100_0154912 3300048903 Bacteria 1638
336 Ga0496101_0074891 3300048904 Bacteria 2491
337 Ga0496101_0321452 3300048904 Bacteria 1214
338 Ga0496102_0006010 3300048905 Bacteria 10336
339 Ga0496102_0062692 3300048905 Bacteria 3404
340 Ga0496102_0077546 3300048905 Bacteria 3058
341 Ga0496102_0143205 3300048905 Bacteria 2242
342 Ga0496102_0177192 3300048905 Bacteria 2008
343 Ga0496102_0419110 3300048905 Bacteria 1258
344 Ga0496103_0073461 3300048906 Bacteria 2142
345 Ga0496103_0246221 3300048906 Bacteria 1150
346 Ga0496103_0431274 3300048906 Bacteria 846
347 Ga0496104_0009172 3300048907 Bacteria 8799
348 Ga0496104_0565384 3300048907 Bacteria 1048
349 Ga0496105_0139518 3300048908 Bacteria 1996
350 Ga0496105_0477604 3300048908 Bacteria 981
351 Ga0496105_0534942 3300048908 Bacteria 916
352 Ga0496106_0025998 3300048909 Bacteria 4356
353 Ga0496106_0120268 3300048909 Bacteria 2052
354 Ga0496106_0472994 3300048909 Bacteria 1007
355 Ga0496106_0611233 3300048909 Bacteria 873
356 Ga0496107_0051667 3300048910 Bacteria 2965
357 Ga0496107_0209047 3300048910 Bacteria 1451
358 Ga0496107_0334594 3300048910 Bacteria 1127
359 Ga0496107_0458702 3300048910 Bacteria 946
360 Ga0496108_0028403 3300048911 Bacteria 4628
361 Ga0496108_0029647 3300048911 Bacteria 4533
362 Ga0496108_0069740 3300048911 Bacteria 2966
363 Ga0496108_0232545 3300048911 Bacteria 1603
364 Ga0496109_0004950 3300048912 Bacteria 11126
365 Ga0496109_0068878 3300048912 Bacteria 3244
366 Ga0496109_0071412 3300048912 Bacteria 3187
367 Ga0496109_0137914 3300048912 Bacteria 2280
368 Ga0496109_0342773 3300048912 Bacteria 1411
369 Ga0496109_0399366 3300048912 Bacteria 1299
370 Ga0496109_0592239 3300048912 Bacteria 1045
371 Ga0496110_0033429 3300048913 Bacteria 4448
372 Ga0496110_0035173 3300048913 Bacteria 4344
373 Ga0496110_0230098 3300048913 Bacteria 1686
374 Ga0496110_0467715 3300048913 Bacteria 1149
375 Ga0496111_0102729 3300048914 Bacteria 2102
376 Ga0496111_0189377 3300048914 Bacteria 1529
377 Ga0496111_0387157 3300048914 Bacteria 1034
378 Ga0496113_0012785 3300048916 Bacteria 5656
379 Ga0496114_0004325 3300048917 Bacteria 10993
380 Ga0496114_0015700 3300048917 Bacteria 6093
381 Ga0496114_0073275 3300048917 Bacteria 2882
382 Ga0496114_0159051 3300048917 Bacteria 1963
383 Ga0496114_0268158 3300048917 Bacteria 1504
384 Ga0496114_0434833 3300048917 Bacteria 1162
385 Ga0496114_0452097 3300048917 Bacteria 1138
386 Ga0496114_0481168 3300048917 Bacteria 1098
387 Ga0496114_0537263 3300048917 Bacteria 1033
388 Ga0496114_0809464 3300048917 Bacteria 816
389 Ga0496115_0011541 3300048918 Bacteria 6623
390 Ga0496115_0202424 3300048918 Bacteria 1640
391 Ga0496124_0048904 3300048927 Bacteria 3610
392 Ga0501031_0000074 3300049568 Bacteria 52791
393 Ga0501031_0059948 3300049568 Bacteria 2480
394 Ga0501032_0001064 3300049569 Bacteria 21945
395 Ga0501032_0010169 3300049569 Bacteria 6791
396 Ga0501032_0142509 3300049569 Bacteria 1578
397 Ga0501033_0000637 3300049570 Bacteria 32382
398 Ga0501034_0012497 3300049571 Bacteria 8766
399 Ga0501034_0034458 3300049571 Bacteria 5132
400 Ga0501034_0076745 3300049571 Bacteria 3348
401 Ga0501034_0272343 3300049571 Bacteria 1634
402 Ga0501036_0000629 3300049572 Bacteria 25714
403 Ga0501036_0012142 3300049572 Bacteria 7137
404 Ga0501036_0047151 3300049572 Bacteria 3649
405 Ga0501036_0344928 3300049572 Bacteria 1244
406 Ga0501037_0000235 3300049573 Bacteria 47804
407 Ga0501037_0084923 3300049573 Bacteria 2292
408 Ga0501037_0214751 3300049573 Bacteria 1355
409 Ga0501038_0000196 3300049574 Bacteria 52394
410 Ga0501038_0008938 3300049574 Bacteria 9190
411 Ga0501038_0230606 3300049574 Bacteria 1474
412 Ga0501039_0000124 3300049575 Bacteria 53373
413 Ga0501039_0041251 3300049575 Bacteria 3564
414 Ga0501040_0415423 3300049576 Bacteria 967
415 Ga0501040_0804928 3300049576 Bacteria 680
416 Ga0501041_0021665 3300049577 Bacteria 3850
417 Ga0501041_0239250 3300049577 Bacteria 1141
418 Ga0501042_0019976 3300049578 Bacteria 4659
419 Ga0501042_0164022 3300049578 Bacteria 1603
420 Ga0501042_0365055 3300049578 Bacteria 1045
421 Ga0501043_0000762 3300049579 Bacteria 28608
422 Ga0501043_0583489 3300049579 Bacteria 827
423 Ga0501043_0833815 3300049579 Bacteria 665
424 Ga0501046_0001934 3300049580 Bacteria 19677
425 Ga0501046_0012936 3300049580 Bacteria 7094
426 Ga0501046_0391504 3300049580 Bacteria 1005
427 Ga0501047_0000378 3300049581 Bacteria 50236
428 Ga0501047_0088505 3300049581 Bacteria 2973
429 Ga0501047_0139856 3300049581 Bacteria 2300
430 Ga0501048_0000096 3300049582 Bacteria 47896
431 Ga0501048_0016922 3300049582 Bacteria 5375
432 Ga0501048_0138160 3300049582 Bacteria 1722
433 Ga0501067_0002075 3300049583 Bacteria 11034
434 Ga0501067_0002914 3300049583 Bacteria 9429
435 Ga0501067_0016195 3300049583 Bacteria 4120
436 Ga0501067_0026505 3300049583 Bacteria 3210
437 Ga0501067_0048989 3300049583 Bacteria 2342
438 Ga0501067_0088819 3300049583 Bacteria 1715
439 Ga0501067_0126781 3300049583 Bacteria 1420
440 Ga0501067_0448923 3300049583 Bacteria 720
441 Ga0501068_0012143 3300049584 Bacteria 4871
442 Ga0501068_0015371 3300049584 Bacteria 4394
443 Ga0501068_0036008 3300049584 Bacteria 2957
444 Ga0501068_0075027 3300049584 Bacteria 2068
445 Ga0501069_0000615 3300049585 Bacteria 16460
446 Ga0501069_0091339 3300049585 Bacteria 1722
447 Ga0501069_0134807 3300049585 Bacteria 1415
448 Ga0501069_0243531 3300049585 Bacteria 1048
449 Ga0501069_0261117 3300049585 Bacteria 1011
450 Ga0501069_0604305 3300049585 Bacteria 658
451 Ga0501070_0000216 3300049586 Bacteria 54638
452 Ga0501070_0000763 3300049586 Bacteria 29376
453 Ga0501070_0005725 3300049586 Bacteria 10597
454 Ga0501070_0037832 3300049586 Bacteria 4027
455 Ga0501070_0106948 3300049586 Bacteria 2312
456 Ga0501070_0132232 3300049586 Bacteria 2061
457 Ga0501070_0211075 3300049586 Bacteria 1593
458 Ga0501071_0014469 3300049587 Bacteria 5396
459 Ga0501071_0248729 3300049587 Bacteria 1342
460 Ga0501072_0100650 3300049588 Bacteria 2297
461 Ga0501073_0000629 3300049589 Bacteria 24820
462 Ga0501073_0010094 3300049589 Bacteria 6943
463 Ga0501073_0052092 3300049589 Bacteria 2866
464 Ga0501073_0133820 3300049589 Bacteria 1718
465 Ga0501074_0007116 3300049590 Bacteria 8086
466 Ga0501074_0009232 3300049590 Bacteria 7166
467 Ga0501074_0041234 3300049590 Bacteria 3342
468 Ga0501074_0044876 3300049590 Bacteria 3198
469 Ga0501074_0634896 3300049590 Bacteria 755
470 Ga0501076_0140375 3300049592 Bacteria 1963
471 Ga0501076_0369508 3300049592 Bacteria 1179
472 Ga0501077_0017281 3300049593 Bacteria 4550
473 Ga0501077_0260982 3300049593 Bacteria 1102
474 Ga0501079_0036380 3300049741 Bacteria 3793
475 Ga0501079_0116865 3300049741 Bacteria 2073
476 Ga0501079_0189098 3300049741 Bacteria 1607
477 Ga0501079_0288400 3300049741 Bacteria 1283
478 Ga0501080_0000177 3300049742 Bacteria 46889
479 Ga0501080_0003278 3300049742 Bacteria 14297
480 Ga0501080_0052948 3300049742 Bacteria 3778
481 Ga0501080_0135030 3300049742 Bacteria 2283
482 Ga0501083_0001818 3300049744 Bacteria 14626
483 Ga0501083_0067514 3300049744 Bacteria 2380
484 Ga0501083_0122392 3300049744 Bacteria 1706
485 Ga0501035_0000648 3300049822 Bacteria 38367
486 Ga0501035_0053935 3300049822 Bacteria 3593
487 Ga0501035_0234058 3300049822 Bacteria 1565
488 Ga0501035_0247782 3300049822 Bacteria 1514
489 Ga0501044_0000585 3300049823 Bacteria 44237
490 Ga0501044_0102473 3300049823 Bacteria 2878
491 Ga0501045_0005967 3300049824 Bacteria 8429
492 Ga0501045_0182239 3300049824 Bacteria 1565
493 Ga0501045_0215124 3300049824 Bacteria 1431
494 nmdc:mga03n38_132928_c1 3300050490 Bacteria 1235
495 nmdc:mga03n38_21569_c1 3300050490 Bacteria 2594
496 nmdc:mga03n38_2943_c1 3300050490 Bacteria 5375
497 nmdc:mga00v17_220503_c1 3300050491 Bacteria 1228
498 nmdc:mga00v17_43129_c1 3300050491 Bacteria 2715
499 nmdc:mga0yw44_190499_c1 3300050492 Bacteria 1352
500 nmdc:mga0yw44_20939_c1 3300050492 Bacteria 3640
501 nmdc:mga0yw44_219113_c1 3300050492 Bacteria 1261
502 nmdc:mga0yw44_29165_c1 3300050492 Bacteria 3183
503 nmdc:mga0yw44_326555_c1 3300050492 Bacteria 1031
504 nmdc:mga0yw44_499053_c1 3300050492 Bacteria 826
505 nmdc:mga06z11_1232_c1 3300050494 Bacteria 9453
506 nmdc:mga04h51_11257_c1 3300050495 Bacteria 2479
507 nmdc:mga04h51_186837_c1 3300050495 Bacteria 809
508 nmdc:mga0qj67_114869_c1 3300050509 Bacteria 2174
509 Ga0495601_0060877 3300053077 Bacteria 2396
510 Ga0495601_0658705 3300053077 Bacteria 670
511 Ga0500644_0000129 3300053088 Bacteria 46233
512 Ga0500644_0027017 3300053088 Bacteria 1782
513 Ga0501084_0000922 3300054114 Bacteria 22716
514 Ga0501084_0023992 3300054114 Bacteria 5087
515 Ga0501084_0096568 3300054114 Bacteria 2482
516 Ga0501082_0002096 3300060353 Bacteria 17564
517 Ga0501082_0022251 3300060353 Bacteria 5463
518 Ga0501082_0110036 3300060353 Bacteria 2385
519 Ga0501082_0249741 3300060353 Bacteria 1544
520 Ga0466962_0005346 3300061719 Bacteria 6174
521 Ga0466962_0027080 3300061719 Bacteria 2753
522 Ga0466962_0032527 3300061719 Bacteria 2497
523 Ga0530510_0203278 3300061734 Bacteria 1472
524 Ga0530510_0497816 3300061734 Bacteria 924

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2515154155 2515851071 151
2 3300038443 Ga0395901_0090101 Ga0395901_0090101_697_1257 167
3 3300044694 Ga0466963_0041680 Ga0466963_0041680_559_1110 167
4 3300044706 Ga0466964_0023936 Ga0466964_0023936_1507_2058 167
5 3300045976 Ga0466967_0096205 Ga0466967_0096205_59_610 167
6 3300026095 Ga0207676_10206995 Ga0207676_102069952 169
7 3300005844 Ga0068862_100874881 Ga0068862_1008748811 173
8 3300006852 Ga0075433_10011509 Ga0075433_100115094 173
9 3300006871 Ga0075434_100003989 Ga0075434_1000039896 173
10 3300006880 Ga0075429_101221911 Ga0075429_1012219111 173
11 3300006914 Ga0075436_100003948 Ga0075436_1000039484 173
12 3300007076 Ga0075435_100002516 Ga0075435_10000251617 173
13 3300009553 Ga0105249_10043608 Ga0105249_100436083 173
14 3300014745 Ga0157377_10877454 Ga0157377_108774541 173
15 3300027907 Ga0207428_10000855 Ga0207428_1000085533 173
16 3300028380 Ga0268265_11241709 Ga0268265_112417092 173
17 3300041494 Ga0451837_1114922 Ga0451837_1114922_63_689 173
18 3300044683 Ga0466965_0661178 Ga0466965_0661178_12_542 173
19 3300044684 Ga0466966_0030796 Ga0466966_0030796_130_708 173
20 3300044693 Ga0466961_0017051 Ga0466961_0017051_3719_4297 173
21 3300044694 Ga0466963_0009098 Ga0466963_0009098_4952_5530 173
22 3300044719 Ga0466971_0050423 Ga0466971_0050423_1070_1648 173
23 3300045049 Ga0466959_0027187 Ga0466959_0027187_2568_3146 173
24 3300045836 Ga0466958_0248475 Ga0466958_0248475_529_1107 173
25 3300046519 Ga0495632_0291827 Ga0495632_0291827_40_603 173
26 3300046691 Ga0495670_0041459 Ga0495670_0041459_688_1251 173
27 3300046692 Ga0495671_0342723 Ga0495671_0342723_35_598 173
28 3300048917 Ga0496114_0159051 Ga0496114_0159051_370_927 173
29 3300048927 Ga0496124_0048904 Ga0496124_0048904_103_687 173
30 3300049587 Ga0501071_0248729 Ga0501071_0248729_607_1176 173
31 3300061719 Ga0466962_0027080 Ga0466962_0027080_1199_1777 173
32 iso_pu_bacteria 2883821847 2883824499 173
33 iso_pu_bacteria 2932398195 2932399197 173
34 3300003203 JGI25406J46586_10037567 JGI25406J46586_100375673 174
35 3300005985 Ga0081539_10000127 Ga0081539_1000012725 174
36 3300006051 Ga0075364_10029255 Ga0075364_100292556 174
37 3300006846 Ga0075430_100122736 Ga0075430_1001227363 174
38 3300014325 Ga0163163_10709436 Ga0163163_107094362 174
39 3300031852 Ga0307410_10038061 Ga0307410_100380614 174
40 3300031901 Ga0307406_10026597 Ga0307406_100265974 174
41 3300031903 Ga0307407_10005801 Ga0307407_100058013 174
42 3300031911 Ga0307412_10025274 Ga0307412_100252743 174
43 3300031995 Ga0307409_100182419 Ga0307409_1001824192 174
44 3300031995 Ga0307409_100371204 Ga0307409_1003712042 174
45 3300032002 Ga0307416_100249440 Ga0307416_1002494403 174
46 3300032002 Ga0307416_100599351 Ga0307416_1005993512 174
47 3300032005 Ga0307411_10018683 Ga0307411_100186832 174
48 3300041452 Ga0451793_1107916 Ga0451793_1107916_2548_3123 174
49 3300041453 Ga0451797_0053692 Ga0451797_0053692_524_1099 174
50 3300041492 Ga0451835_0972303 Ga0451835_0972303_67_603 174
51 3300041498 Ga0451841_0298374 Ga0451841_0298374_42_617 174
52 3300041501 Ga0451845_0011386 Ga0451845_0011386_186_761 174
53 3300041505 Ga0451849_0240205 Ga0451849_0240205_245_820 174
54 3300041512 Ga0451853_3478986 Ga0451853_3478986_1066_1641 174
55 3300047318 Ga0495636_0236535 Ga0495636_0236535_125_682 174
56 3300048917 Ga0496114_0809464 Ga0496114_0809464_61_618 174
57 3300049568 Ga0501031_0059948 Ga0501031_0059948_1235_1780 174
58 3300049577 Ga0501041_0239250 Ga0501041_0239250_489_1034 174
59 3300049580 Ga0501046_0391504 Ga0501046_0391504_256_801 174
60 3300049592 Ga0501076_0369508 Ga0501076_0369508_459_1004 174
61 3300050490 nmdc:mga03n38_2943_c1 nmdc:mga03n38_2943_c1_983_1507 174
62 3300050491 nmdc:mga00v17_43129_c1 nmdc:mga00v17_43129_c1_268_792 174
63 3300050492 nmdc:mga0yw44_219113_c1 nmdc:mga0yw44_219113_c1_396_920 174
64 3300050509 nmdc:mga0qj67_114869_c1 nmdc:mga0qj67_114869_c1_238_798 174
65 3300054114 Ga0501084_0096568 Ga0501084_0096568_1615_2160 174
66 3300061734 Ga0530510_0497816 Ga0530510_0497816_160_705 174
67 iso_pu_bacteria 2643221679 2644445301 174
68 iso_pu_bacteria 2738541272 2738696132 174
69 iso_pu_bacteria 2739367654 2739605725 174
70 iso_pu_bacteria 2808606394 2809028965 174
71 3300005333 Ga0070677_10527349 Ga0070677_105273491 175
72 3300005338 Ga0068868_100474494 Ga0068868_1004744942 175
73 3300005341 Ga0070691_10211470 Ga0070691_102114702 175
74 3300005345 Ga0070692_10167961 Ga0070692_101679612 175
75 3300005347 Ga0070668_100038354 Ga0070668_1000383542 175
76 3300005353 Ga0070669_100519814 Ga0070669_1005198142 175
77 3300005356 Ga0070674_100372881 Ga0070674_1003728812 175
78 3300005356 Ga0070674_100660122 Ga0070674_1006601222 175
79 3300005366 Ga0070659_100151301 Ga0070659_1001513013 175
80 3300005366 Ga0070659_100220864 Ga0070659_1002208642 175
81 3300005456 Ga0070678_100545200 Ga0070678_1005452001 175
82 3300005457 Ga0070662_100077975 Ga0070662_1000779752 175
83 3300005459 Ga0068867_100585424 Ga0068867_1005854241 175
84 3300005543 Ga0070672_100322308 Ga0070672_1003223082 175
85 3300005615 Ga0070702_100371621 Ga0070702_1003716212 175
86 3300005718 Ga0068866_10187280 Ga0068866_101872802 175
87 3300005718 Ga0068866_10552840 Ga0068866_105528402 175
88 3300005719 Ga0068861_100122199 Ga0068861_1001221994 175
89 3300005719 Ga0068861_100166954 Ga0068861_1001669542 175
90 3300005843 Ga0068860_100182941 Ga0068860_1001829412 175
91 3300006038 Ga0075365_10116088 Ga0075365_101160884 175
92 3300006038 Ga0075365_10128106 Ga0075365_101281063 175
93 3300006048 Ga0075363_100041754 Ga0075363_1000417543 175
94 3300006051 Ga0075364_10054928 Ga0075364_100549282 175
95 3300006844 Ga0075428_100034251 Ga0075428_1000342516 175
96 3300006847 Ga0075431_100033384 Ga0075431_1000333844 175
97 3300006852 Ga0075433_10020818 Ga0075433_100208186 175
98 3300006871 Ga0075434_100394158 Ga0075434_1003941582 175
99 3300006880 Ga0075429_100040766 Ga0075429_1000407665 175
100 3300006881 Ga0068865_100093593 Ga0068865_1000935932 175
101 3300007076 Ga0075435_100102388 Ga0075435_1001023883 175
102 3300009098 Ga0105245_10106760 Ga0105245_101067602 175
103 3300009101 Ga0105247_11199498 Ga0105247_111994981 175
104 3300009148 Ga0105243_10016977 Ga0105243_100169772 175
105 3300009176 Ga0105242_10010999 Ga0105242_100109997 175
106 3300009551 Ga0105238_10161975 Ga0105238_101619752 175
107 3300010375 Ga0105239_10200467 Ga0105239_102004672 175
108 3300013102 Ga0157371_10105206 Ga0157371_101052062 175
109 3300013306 Ga0163162_10025921 Ga0163162_100259215 175
110 3300013307 Ga0157372_10153423 Ga0157372_101534232 175
111 3300013308 Ga0157375_10070276 Ga0157375_100702764 175
112 3300014326 Ga0157380_11241815 Ga0157380_112418152 175
113 3300017792 Ga0163161_10137655 Ga0163161_101376552 175
114 3300025901 Ga0207688_10104875 Ga0207688_101048753 175
115 3300025901 Ga0207688_10113802 Ga0207688_101138022 175
116 3300025904 Ga0207647_10087049 Ga0207647_100870493 175
117 3300025908 Ga0207643_10052044 Ga0207643_100520442 175
118 3300025918 Ga0207662_10454993 Ga0207662_104549932 175
119 3300025923 Ga0207681_10091553 Ga0207681_100915532 175
120 3300025927 Ga0207687_10082718 Ga0207687_100827182 175
121 3300025927 Ga0207687_10973287 Ga0207687_109732872 175
122 3300025932 Ga0207690_10019354 Ga0207690_100193545 175
123 3300025932 Ga0207690_10435393 Ga0207690_104353931 175
124 3300025935 Ga0207709_10055188 Ga0207709_100551883 175
125 3300025938 Ga0207704_10151578 Ga0207704_101515782 175
126 3300025938 Ga0207704_10154297 Ga0207704_101542972 175
127 3300025940 Ga0207691_10338395 Ga0207691_103383952 175
128 3300025949 Ga0207667_11164928 Ga0207667_111649281 175
129 3300025961 Ga0207712_10030760 Ga0207712_100307605 175
130 3300025961 Ga0207712_10080238 Ga0207712_100802382 175
131 3300025972 Ga0207668_10044522 Ga0207668_100445223 175
132 3300025972 Ga0207668_10303735 Ga0207668_103037352 175
133 3300025972 Ga0207668_10489347 Ga0207668_104893471 175
134 3300026041 Ga0207639_10568765 Ga0207639_105687652 175
135 3300026089 Ga0207648_10022104 Ga0207648_100221042 175
136 3300026118 Ga0207675_100009269 Ga0207675_1000092697 175
137 3300026118 Ga0207675_100011648 Ga0207675_1000116484 175
138 3300026121 Ga0207683_10050535 Ga0207683_100505352 175
139 3300026142 Ga0207698_10219567 Ga0207698_102195671 175
140 3300027866 Ga0209813_10166573 Ga0209813_101665732 175
141 3300027907 Ga0207428_10008400 Ga0207428_100084007 175
142 3300031251 Ga0265327_10000062 Ga0265327_10000062151 175
143 3300031852 Ga0307410_10494167 Ga0307410_104941672 175
144 3300031901 Ga0307406_10457930 Ga0307406_104579303 175
145 3300031901 Ga0307406_10649252 Ga0307406_106492522 175
146 3300031995 Ga0307409_100089280 Ga0307409_1000892802 175
147 3300032005 Ga0307411_10249378 Ga0307411_102493782 175
148 3300041509 Ga0451843_0456137 Ga0451843_0456137_34_600 175
149 3300041512 Ga0451853_2225099 Ga0451853_2225099_148_714 175
150 3300042016 Ga0439463_020975 Ga0439463_020975_267_842 175
151 3300044658 Ga0466972_0030451 Ga0466972_0030451_1485_2030 175
152 3300044683 Ga0466965_0022651 Ga0466965_0022651_573_1118 175
153 3300044684 Ga0466966_0295829 Ga0466966_0295829_146_691 175
154 3300044693 Ga0466961_0020218 Ga0466961_0020218_3039_3584 175
155 3300044719 Ga0466971_0093046 Ga0466971_0093046_729_1274 175
156 3300044842 Ga0466957_0035939 Ga0466957_0035939_487_1032 175
157 3300044901 Ga0466960_0089070 Ga0466960_0089070_806_1351 175
158 3300045049 Ga0466959_0144576 Ga0466959_0144576_190_735 175
159 3300045836 Ga0466958_0063052 Ga0466958_0063052_1054_1599 175
160 3300046511 Ga0495608_0077615 Ga0495608_0077615_1125_1706 175
161 3300047319 Ga0495674_0843883 Ga0495674_0843883_25_660 175
162 3300048907 Ga0496104_0565384 Ga0496104_0565384_200_766 175
163 3300048909 Ga0496106_0611233 Ga0496106_0611233_44_685 175
164 3300048911 Ga0496108_0069740 Ga0496108_0069740_575_1279 175
165 3300048912 Ga0496109_0004950 Ga0496109_0004950_4994_5650 175
166 3300048913 Ga0496110_0033429 Ga0496110_0033429_1595_2380 175
167 3300048917 Ga0496114_0073275 Ga0496114_0073275_2130_2696 175
168 3300048917 Ga0496114_0434833 Ga0496114_0434833_322_849 175
169 3300048917 Ga0496114_0452097 Ga0496114_0452097_393_962 175
170 3300049568 Ga0501031_0000074 Ga0501031_0000074_2534_3118 175
171 3300049569 Ga0501032_0001064 Ga0501032_0001064_17408_17992 175
172 3300049569 Ga0501032_0010169 Ga0501032_0010169_1523_2059 175
173 3300049570 Ga0501033_0000637 Ga0501033_0000637_29053_29637 175
174 3300049571 Ga0501034_0034458 Ga0501034_0034458_4106_4690 175
175 3300049572 Ga0501036_0000629 Ga0501036_0000629_4106_4690 175
176 3300049572 Ga0501036_0012142 Ga0501036_0012142_5622_6158 175
177 3300049573 Ga0501037_0000235 Ga0501037_0000235_3903_4487 175
178 3300049573 Ga0501037_0084923 Ga0501037_0084923_1500_2036 175
179 3300049574 Ga0501038_0000196 Ga0501038_0000196_4289_4873 175
180 3300049575 Ga0501039_0000124 Ga0501039_0000124_49882_50466 175
181 3300049575 Ga0501039_0041251 Ga0501039_0041251_859_1395 175
182 3300049577 Ga0501041_0021665 Ga0501041_0021665_2779_3315 175
183 3300049578 Ga0501042_0019976 Ga0501042_0019976_793_1329 175
184 3300049579 Ga0501043_0000762 Ga0501043_0000762_25604_26188 175
185 3300049579 Ga0501043_0583489 Ga0501043_0583489_98_634 175
186 3300049580 Ga0501046_0001934 Ga0501046_0001934_15247_15831 175
187 3300049581 Ga0501047_0000378 Ga0501047_0000378_3715_4299 175
188 3300049582 Ga0501048_0000096 Ga0501048_0000096_43698_44282 175
189 3300049582 Ga0501048_0016922 Ga0501048_0016922_1361_1897 175
190 3300049583 Ga0501067_0026505 Ga0501067_0026505_459_1043 175
191 3300049583 Ga0501067_0088819 Ga0501067_0088819_264_791 175
192 3300049584 Ga0501068_0036008 Ga0501068_0036008_737_1321 175
193 3300049584 Ga0501068_0075027 Ga0501068_0075027_761_1288 175
194 3300049585 Ga0501069_0000615 Ga0501069_0000615_15094_15678 175
195 3300049585 Ga0501069_0243531 Ga0501069_0243531_429_965 175
196 3300049586 Ga0501070_0000216 Ga0501070_0000216_50464_51048 175
197 3300049587 Ga0501071_0014469 Ga0501071_0014469_1501_2037 175
198 3300049588 Ga0501072_0100650 Ga0501072_0100650_444_980 175
199 3300049589 Ga0501073_0000629 Ga0501073_0000629_1547_2131 175
200 3300049590 Ga0501074_0009232 Ga0501074_0009232_4727_5263 175
201 3300049590 Ga0501074_0041234 Ga0501074_0041234_2295_2879 175
202 3300049593 Ga0501077_0260982 Ga0501077_0260982_315_851 175
203 3300049741 Ga0501079_0036380 Ga0501079_0036380_3023_3559 175
204 3300049742 Ga0501080_0000177 Ga0501080_0000177_3098_3682 175
205 3300049744 Ga0501083_0067514 Ga0501083_0067514_307_891 175
206 3300049822 Ga0501035_0000648 Ga0501035_0000648_35636_36220 175
207 3300049822 Ga0501035_0234058 Ga0501035_0234058_228_764 175
208 3300049823 Ga0501044_0000585 Ga0501044_0000585_1331_1915 175
209 3300049824 Ga0501045_0005967 Ga0501045_0005967_271_807 175
210 3300050492 nmdc:mga0yw44_499053_c1 nmdc:mga0yw44_499053_c1_85_621 175
211 3300050495 nmdc:mga04h51_186837_c1 nmdc:mga04h51_186837_c1_219_755 175
212 3300053077 Ga0495601_0658705 Ga0495601_0658705_10_645 175
213 3300054114 Ga0501084_0000922 Ga0501084_0000922_1171_1755 175
214 3300054114 Ga0501084_0023992 Ga0501084_0023992_3304_3840 175
215 3300060353 Ga0501082_0022251 Ga0501082_0022251_3101_3637 175
216 3300061719 Ga0466962_0005346 Ga0466962_0005346_2369_2914 175
217 iso_pu_bacteria 2773857762 2774392242 175
218 iso_pu_bacteria 2811994878 2812351816 175
219 iso_pu_bacteria 2857481737 2857485798 175
220 3300005337 Ga0070682_100021170 Ga0070682_1000211702 176
221 3300005338 Ga0068868_100303417 Ga0068868_1003034172 176
222 3300005366 Ga0070659_100186222 Ga0070659_1001862222 176
223 3300005535 Ga0070684_100182623 Ga0070684_1001826232 176
224 3300005615 Ga0070702_100936790 Ga0070702_1009367901 176
225 3300005840 Ga0068870_10072069 Ga0068870_100720692 176
226 3300006038 Ga0075365_10081115 Ga0075365_100811154 176
227 3300006042 Ga0075368_10096895 Ga0075368_100968953 176
228 3300006048 Ga0075363_100003180 Ga0075363_1000031806 176
229 3300006178 Ga0075367_10163545 Ga0075367_101635453 176
230 3300009094 Ga0111539_11657968 Ga0111539_116579682 176
231 3300009098 Ga0105245_10164000 Ga0105245_101640002 176
232 3300009551 Ga0105238_10143226 Ga0105238_101432263 176
233 3300009553 Ga0105249_10506625 Ga0105249_105066252 176
234 3300013307 Ga0157372_10239890 Ga0157372_102398902 176
235 3300014745 Ga0157377_10182210 Ga0157377_101822103 176
236 3300017792 Ga0163161_10261628 Ga0163161_102616283 176
237 3300025901 Ga0207688_10496920 Ga0207688_104969201 176
238 3300025924 Ga0207694_10412217 Ga0207694_104122172 176
239 3300025926 Ga0207659_10401898 Ga0207659_104018981 176
240 3300025927 Ga0207687_10136195 Ga0207687_101361952 176
241 3300025932 Ga0207690_10198671 Ga0207690_101986712 176
242 3300025944 Ga0207661_11145772 Ga0207661_111457722 176
243 3300026078 Ga0207702_11205919 Ga0207702_112059192 176
244 3300026142 Ga0207698_12045546 Ga0207698_120455461 176
245 3300027866 Ga0209813_10002147 Ga0209813_100021473 176
246 3300031852 Ga0307410_10718625 Ga0307410_107186252 176
247 3300031903 Ga0307407_10112694 Ga0307407_101126942 176
248 3300031995 Ga0307409_100112482 Ga0307409_1001124822 176
249 3300032002 Ga0307416_100020809 Ga0307416_1000208095 176
250 3300032002 Ga0307416_100692880 Ga0307416_1006928801 176
251 3300032126 Ga0307415_100003106 Ga0307415_1000031066 176
252 3300044693 Ga0466961_0095105 Ga0466961_0095105_1211_1789 176
253 3300044765 Ga0466970_0006407 Ga0466970_0006407_2928_3506 176
254 3300044842 Ga0466957_0016137 Ga0466957_0016137_1347_1925 176
255 3300044901 Ga0466960_0008282 Ga0466960_0008282_1573_2151 176
256 3300044901 Ga0466960_0073936 Ga0466960_0073936_603_1151 176
257 3300045976 Ga0466967_0398715 Ga0466967_0398715_729_1307 176
258 3300048904 Ga0496101_0074891 Ga0496101_0074891_141_677 176
259 3300048905 Ga0496102_0062692 Ga0496102_0062692_2160_2696 176
260 3300048906 Ga0496103_0073461 Ga0496103_0073461_624_1160 176
261 3300048908 Ga0496105_0477604 Ga0496105_0477604_156_692 176
262 3300048909 Ga0496106_0120268 Ga0496106_0120268_141_677 176
263 3300048910 Ga0496107_0051667 Ga0496107_0051667_992_1528 176
264 3300048911 Ga0496108_0028403 Ga0496108_0028403_2740_3276 176
265 3300048912 Ga0496109_0592239 Ga0496109_0592239_74_616 176
266 3300048914 Ga0496111_0189377 Ga0496111_0189377_768_1304 176
267 3300048914 Ga0496111_0387157 Ga0496111_0387157_181_849 176
268 3300048916 Ga0496113_0012785 Ga0496113_0012785_3776_4312 176
269 3300049572 Ga0501036_0344928 Ga0501036_0344928_416_1066 176
270 3300049583 Ga0501067_0126781 Ga0501067_0126781_402_938 176
271 3300050490 nmdc:mga03n38_21569_c1 nmdc:mga03n38_21569_c1_1241_1771 176
272 3300050494 nmdc:mga06z11_1232_c1 nmdc:mga06z11_1232_c1_3047_3589 176
273 3300050495 nmdc:mga04h51_11257_c1 nmdc:mga04h51_11257_c1_756_1298 176
274 3300053088 Ga0500644_0000129 Ga0500644_0000129_38665_39201 176
275 3300061734 Ga0530510_0203278 Ga0530510_0203278_284_820 176
276 iso_pu_bacteria 2855386786 2855386889 176
277 3300005327 Ga0070658_11303750 Ga0070658_113037501 177
278 3300005329 Ga0070683_100424109 Ga0070683_1004241092 177
279 3300005340 Ga0070689_100808097 Ga0070689_1008080972 177
280 3300005367 Ga0070667_100013554 Ga0070667_1000135549 177
281 3300005441 Ga0070700_100855050 Ga0070700_1008550501 177
282 3300005577 Ga0068857_100566875 Ga0068857_1005668751 177
283 3300005719 Ga0068861_100063324 Ga0068861_1000633243 177
284 3300006038 Ga0075365_10033077 Ga0075365_100330774 177
285 3300006038 Ga0075365_10070173 Ga0075365_100701733 177
286 3300006048 Ga0075363_100066044 Ga0075363_1000660442 177
287 3300006051 Ga0075364_10285756 Ga0075364_102857562 177
288 3300006881 Ga0068865_100158941 Ga0068865_1001589412 177
289 3300009098 Ga0105245_10858002 Ga0105245_108580022 177
290 3300010375 Ga0105239_11592511 Ga0105239_115925112 177
291 3300011119 Ga0105246_11002962 Ga0105246_110029621 177
292 3300014326 Ga0157380_10203181 Ga0157380_102031812 177
293 3300025907 Ga0207645_10898807 Ga0207645_108988071 177
294 3300026075 Ga0207708_10173670 Ga0207708_101736703 177
295 3300026118 Ga0207675_100108800 Ga0207675_1001088004 177
296 3300028381 Ga0268264_10000576 Ga0268264_1000057633 177
297 3300031824 Ga0307413_10762144 Ga0307413_107621441 177
298 3300031911 Ga0307412_10988301 Ga0307412_109883011 177
299 3300032005 Ga0307411_10126893 Ga0307411_101268931 177
300 3300037466 Ga0395898_0033637 Ga0395898_0033637_1438_1989 177
301 3300038443 Ga0395901_0111700 Ga0395901_0111700_436_987 177
302 3300044684 Ga0466966_0033730 Ga0466966_0033730_604_1164 177
303 3300044684 Ga0466966_0138379 Ga0466966_0138379_258_818 177
304 3300044693 Ga0466961_0016493 Ga0466961_0016493_4160_4720 177
305 3300044693 Ga0466961_0171204 Ga0466961_0171204_68_628 177
306 3300044765 Ga0466970_0207474 Ga0466970_0207474_473_1033 177
307 3300044842 Ga0466957_0150234 Ga0466957_0150234_507_1049 177
308 3300044842 Ga0466957_0303068 Ga0466957_0303068_205_792 177
309 3300044901 Ga0466960_0087243 Ga0466960_0087243_470_1030 177
310 3300045049 Ga0466959_0331086 Ga0466959_0331086_68_628 177
311 3300045836 Ga0466958_0076799 Ga0466958_0076799_970_1542 177
312 3300045836 Ga0466958_0138042 Ga0466958_0138042_452_1012 177
313 3300045976 Ga0466967_0023189 Ga0466967_0023189_196_756 177
314 3300045976 Ga0466967_0104448 Ga0466967_0104448_1820_2362 177
315 3300045976 Ga0466967_1072997 Ga0466967_1072997_111_653 177
316 3300046511 Ga0495608_0228118 Ga0495608_0228118_230_781 177
317 3300046515 Ga0495620_0130358 Ga0495620_0130358_114_662 177
318 3300046663 Ga0495635_0259239 Ga0495635_0259239_185_736 177
319 3300048903 Ga0496100_0154912 Ga0496100_0154912_1068_1610 177
320 3300048905 Ga0496102_0143205 Ga0496102_0143205_1376_1918 177
321 3300048905 Ga0496102_0419110 Ga0496102_0419110_141_683 177
322 3300048906 Ga0496103_0431274 Ga0496103_0431274_151_702 177
323 3300048908 Ga0496105_0139518 Ga0496105_0139518_563_1105 177
324 3300048910 Ga0496107_0209047 Ga0496107_0209047_108_656 177
325 3300048910 Ga0496107_0458702 Ga0496107_0458702_291_833 177
326 3300048912 Ga0496109_0342773 Ga0496109_0342773_760_1302 177
327 3300048913 Ga0496110_0230098 Ga0496110_0230098_564_1109 177
328 3300048914 Ga0496111_0102729 Ga0496111_0102729_1538_2083 177
329 3300048917 Ga0496114_0004325 Ga0496114_0004325_7583_8125 177
330 3300049569 Ga0501032_0142509 Ga0501032_0142509_465_1007 177
331 3300049571 Ga0501034_0012497 Ga0501034_0012497_877_1419 177
332 3300049571 Ga0501034_0272343 Ga0501034_0272343_1031_1579 177
333 3300049572 Ga0501036_0047151 Ga0501036_0047151_2407_2949 177
334 3300049573 Ga0501037_0214751 Ga0501037_0214751_734_1276 177
335 3300049574 Ga0501038_0008938 Ga0501038_0008938_764_1306 177
336 3300049576 Ga0501040_0415423 Ga0501040_0415423_44_598 177
337 3300049578 Ga0501042_0164022 Ga0501042_0164022_747_1289 177
338 3300049578 Ga0501042_0365055 Ga0501042_0365055_158_712 177
339 3300049579 Ga0501043_0833815 Ga0501043_0833815_53_595 177
340 3300049580 Ga0501046_0012936 Ga0501046_0012936_3596_4138 177
341 3300049581 Ga0501047_0088505 Ga0501047_0088505_1553_2095 177
342 3300049582 Ga0501048_0138160 Ga0501048_0138160_992_1534 177
343 3300049583 Ga0501067_0002075 Ga0501067_0002075_5618_6184 177
344 3300049586 Ga0501070_0106948 Ga0501070_0106948_1358_1903 177
345 3300049586 Ga0501070_0211075 Ga0501070_0211075_751_1299 177
346 3300049589 Ga0501073_0133820 Ga0501073_0133820_770_1315 177
347 3300049822 Ga0501035_0053935 Ga0501035_0053935_773_1315 177
348 3300049822 Ga0501035_0247782 Ga0501035_0247782_775_1323 177
349 3300049823 Ga0501044_0102473 Ga0501044_0102473_1625_2167 177
350 3300049824 Ga0501045_0182239 Ga0501045_0182239_114_656 177
351 3300050490 nmdc:mga03n38_132928_c1 nmdc:mga03n38_132928_c1_466_1047 177
352 3300050491 nmdc:mga00v17_220503_c1 nmdc:mga00v17_220503_c1_661_1206 177
353 3300050492 nmdc:mga0yw44_29165_c1 nmdc:mga0yw44_29165_c1_1592_2134 177
354 3300050492 nmdc:mga0yw44_326555_c1 nmdc:mga0yw44_326555_c1_412_996 177
355 3300053077 Ga0495601_0060877 Ga0495601_0060877_415_966 177
356 3300053088 Ga0500644_0027017 Ga0500644_0027017_968_1516 177
357 3300061719 Ga0466962_0032527 Ga0466962_0032527_504_1064 177
358 iso_pu_bacteria 2808606439 2809196049 177
359 iso_pu_bacteria 2891968417 2891970548 177
360 3300001990 JGI24737J22298_10100807 JGI24737J22298_101008071 178
361 3300006038 Ga0075365_10172013 Ga0075365_101720132 178
362 3300006038 Ga0075365_10492899 Ga0075365_104928992 178
363 3300014326 Ga0157380_11196820 Ga0157380_111968202 178
364 3300025944 Ga0207661_10207351 Ga0207661_102073512 178
365 3300025944 Ga0207661_10446666 Ga0207661_104466662 178
366 3300030744 Ga0316181_1019724 Ga0316181_10197242 178
367 3300030745 Ga0316182_1384724 Ga0316182_13847241 178
368 3300031903 Ga0307407_10405024 Ga0307407_104050242 178
369 3300031995 Ga0307409_100685121 Ga0307409_1006851212 178
370 3300037418 Ga0395900_0027470 Ga0395900_0027470_1277_1828 178
371 3300037418 Ga0395900_0208137 Ga0395900_0208137_411_989 178
372 3300037466 Ga0395898_0009822 Ga0395898_0009822_8301_8879 178
373 3300037466 Ga0395898_0185297 Ga0395898_0185297_1049_1600 178
374 3300037471 Ga0395905_0030766 Ga0395905_0030766_1562_2134 178
375 3300038443 Ga0395901_0052553 Ga0395901_0052553_2352_2930 178
376 3300038443 Ga0395901_0260071 Ga0395901_0260071_562_1119 178
377 3300041441 Ga0451787_738908 Ga0451787_738908_92_643 178
378 3300044658 Ga0466972_0024035 Ga0466972_0024035_1113_1658 178
379 3300044683 Ga0466965_0051804 Ga0466965_0051804_1355_1915 178
380 3300044683 Ga0466965_0067095 Ga0466965_0067095_118_663 178
381 3300044765 Ga0466970_0008863 Ga0466970_0008863_4441_4986 178
382 3300044765 Ga0466970_0115977 Ga0466970_0115977_661_1239 178
383 3300044765 Ga0466970_0294185 Ga0466970_0294185_129_674 178
384 3300044842 Ga0466957_0595387 Ga0466957_0595387_184_741 178
385 3300045049 Ga0466959_0473839 Ga0466959_0473839_38_598 178
386 3300045976 Ga0466967_0164099 Ga0466967_0164099_1263_1832 178
387 3300045976 Ga0466967_0170434 Ga0466967_0170434_501_1046 178
388 3300045976 Ga0466967_0363748 Ga0466967_0363748_618_1163 178
389 3300048912 Ga0496109_0137914 Ga0496109_0137914_1680_2243 178
390 3300049576 Ga0501040_0804928 Ga0501040_0804928_88_645 178
391 3300049583 Ga0501067_0048989 Ga0501067_0048989_471_1010 178
392 3300049583 Ga0501067_0448923 Ga0501067_0448923_15_566 178
393 3300049584 Ga0501068_0015371 Ga0501068_0015371_3766_4305 178
394 3300049585 Ga0501069_0261117 Ga0501069_0261117_462_1001 178
395 3300049585 Ga0501069_0604305 Ga0501069_0604305_70_621 178
396 3300049586 Ga0501070_0132232 Ga0501070_0132232_673_1233 178
397 3300049590 Ga0501074_0634896 Ga0501074_0634896_190_741 178
398 3300049824 Ga0501045_0215124 Ga0501045_0215124_512_1075 178
399 3300050492 nmdc:mga0yw44_190499_c1 nmdc:mga0yw44_190499_c1_191_745 178
400 3300050492 nmdc:mga0yw44_20939_c1 nmdc:mga0yw44_20939_c1_382_930 178
401 3300001979 JGI24740J21852_10082217 JGI24740J21852_100822172 179
402 3300002067 JGI24735J21928_10020671 JGI24735J21928_100206711 179
403 3300005327 Ga0070658_10124374 Ga0070658_101243743 179
404 3300005327 Ga0070658_10202272 Ga0070658_102022722 179
405 3300005329 Ga0070683_100004167 Ga0070683_1000041672 179
406 3300005329 Ga0070683_100146494 Ga0070683_1001464942 179
407 3300005337 Ga0070682_100015633 Ga0070682_1000156333 179
408 3300005338 Ga0068868_100204962 Ga0068868_1002049623 179
409 3300005339 Ga0070660_100005730 Ga0070660_1000057303 179
410 3300005339 Ga0070660_100084791 Ga0070660_1000847913 179
411 3300005343 Ga0070687_100070259 Ga0070687_1000702592 179
412 3300005355 Ga0070671_101469066 Ga0070671_1014690661 179
413 3300005366 Ga0070659_100014011 Ga0070659_1000140113 179
414 3300005457 Ga0070662_100934529 Ga0070662_1009345291 179
415 3300005458 Ga0070681_10170818 Ga0070681_101708183 179
416 3300005458 Ga0070681_10319133 Ga0070681_103191332 179
417 3300005530 Ga0070679_100007194 Ga0070679_1000071943 179
418 3300005535 Ga0070684_100021693 Ga0070684_1000216932 179
419 3300005535 Ga0070684_100146426 Ga0070684_1001464261 179
420 3300005535 Ga0070684_100191932 Ga0070684_1001919323 179
421 3300005535 Ga0070684_100222488 Ga0070684_1002224882 179
422 3300005535 Ga0070684_100356386 Ga0070684_1003563862 179
423 3300005546 Ga0070696_100624587 Ga0070696_1006245872 179
424 3300005564 Ga0070664_100058520 Ga0070664_1000585202 179
425 3300005577 Ga0068857_100005137 Ga0068857_1000051373 179
426 3300005577 Ga0068857_100957081 Ga0068857_1009570812 179
427 3300005615 Ga0070702_100513674 Ga0070702_1005136742 179
428 3300005617 Ga0068859_101294702 Ga0068859_1012947022 179
429 3300005618 Ga0068864_100056624 Ga0068864_1000566242 179
430 3300005719 Ga0068861_100648335 Ga0068861_1006483352 179
431 3300005834 Ga0068851_10522364 Ga0068851_105223641 179
432 3300006881 Ga0068865_100039942 Ga0068865_1000399424 179
433 3300006931 Ga0097620_101294513 Ga0097620_1012945132 179
434 3300009098 Ga0105245_10037145 Ga0105245_100371452 179
435 3300009098 Ga0105245_11106731 Ga0105245_111067312 179
436 3300009148 Ga0105243_10094842 Ga0105243_100948422 179
437 3300009176 Ga0105242_10252204 Ga0105242_102522042 179
438 3300009177 Ga0105248_10522364 Ga0105248_105223642 179
439 3300009177 Ga0105248_10547129 Ga0105248_105471292 179
440 3300009553 Ga0105249_10044913 Ga0105249_100449133 179
441 3300009553 Ga0105249_10407576 Ga0105249_104075762 179
442 3300010375 Ga0105239_10011816 Ga0105239_100118162 179
443 3300013102 Ga0157371_10144228 Ga0157371_101442283 179
444 3300013105 Ga0157369_10250356 Ga0157369_102503562 179
445 3300013296 Ga0157374_11049549 Ga0157374_110495492 179
446 3300013297 Ga0157378_10479134 Ga0157378_104791342 179
447 3300013306 Ga0163162_10584497 Ga0163162_105844972 179
448 3300013307 Ga0157372_10005055 Ga0157372_100050553 179
449 3300013308 Ga0157375_10022317 Ga0157375_100223175 179
450 3300013308 Ga0157375_10178795 Ga0157375_101787951 179
451 3300013308 Ga0157375_10184116 Ga0157375_101841163 179
452 3300013308 Ga0157375_11288104 Ga0157375_112881041 179
453 3300014325 Ga0163163_10025986 Ga0163163_100259863 179
454 3300025321 Ga0207656_10357834 Ga0207656_103578342 179
455 3300025901 Ga0207688_10009974 Ga0207688_100099743 179
456 3300025904 Ga0207647_10009136 Ga0207647_100091363 179
457 3300025904 Ga0207647_10257451 Ga0207647_102574511 179
458 3300025908 Ga0207643_10299036 Ga0207643_102990362 179
459 3300025909 Ga0207705_10121134 Ga0207705_101211342 179
460 3300025909 Ga0207705_10320334 Ga0207705_103203342 179
461 3300025912 Ga0207707_10081176 Ga0207707_100811763 179
462 3300025912 Ga0207707_10203939 Ga0207707_102039392 179
463 3300025919 Ga0207657_10058676 Ga0207657_100586763 179
464 3300025919 Ga0207657_10210956 Ga0207657_102109563 179
465 3300025921 Ga0207652_10039890 Ga0207652_100398902 179
466 3300025927 Ga0207687_10010253 Ga0207687_100102539 179
467 3300025927 Ga0207687_10157060 Ga0207687_101570602 179
468 3300025938 Ga0207704_10033521 Ga0207704_100335214 179
469 3300025938 Ga0207704_10184202 Ga0207704_101842022 179
470 3300025941 Ga0207711_10383964 Ga0207711_103839642 179
471 3300025944 Ga0207661_10085539 Ga0207661_100855392 179
472 3300025944 Ga0207661_10298524 Ga0207661_102985243 179
473 3300025944 Ga0207661_10444249 Ga0207661_104442492 179
474 3300025945 Ga0207679_10042248 Ga0207679_100422482 179
475 3300025949 Ga0207667_10157068 Ga0207667_101570682 179
476 3300025961 Ga0207712_10018134 Ga0207712_100181342 179
477 3300025961 Ga0207712_10296892 Ga0207712_102968922 179
478 3300026095 Ga0207676_10385213 Ga0207676_103852132 179
479 3300026116 Ga0207674_10007885 Ga0207674_100078853 179
480 3300026116 Ga0207674_10712800 Ga0207674_107128002 179
481 3300044694 Ga0466963_0254294 Ga0466963_0254294_371_916 179
482 3300044694 Ga0466963_0305952 Ga0466963_0305952_456_1001 179
483 3300045976 Ga0466967_0045637 Ga0466967_0045637_1967_2506 179
484 3300045976 Ga0466967_0393938 Ga0466967_0393938_712_1251 179
485 3300046683 Ga0495658_0377471 Ga0495658_0377471_164_718 179
486 3300048903 Ga0496100_0077880 Ga0496100_0077880_175_750 179
487 3300048904 Ga0496101_0321452 Ga0496101_0321452_316_891 179
488 3300048905 Ga0496102_0006010 Ga0496102_0006010_8212_8751 179
489 3300048905 Ga0496102_0077546 Ga0496102_0077546_1146_1721 179
490 3300048905 Ga0496102_0177192 Ga0496102_0177192_13_627 179
491 3300048906 Ga0496103_0246221 Ga0496103_0246221_509_1084 179
492 3300048907 Ga0496104_0009172 Ga0496104_0009172_1563_2138 179
493 3300048908 Ga0496105_0534942 Ga0496105_0534942_306_881 179
494 3300048909 Ga0496106_0025998 Ga0496106_0025998_1795_2370 179
495 3300048909 Ga0496106_0472994 Ga0496106_0472994_50_589 179
496 3300048910 Ga0496107_0334594 Ga0496107_0334594_186_800 179
497 3300048911 Ga0496108_0029647 Ga0496108_0029647_401_940 179
498 3300048911 Ga0496108_0232545 Ga0496108_0232545_659_1273 179
499 3300048912 Ga0496109_0068878 Ga0496109_0068878_707_1246 179
500 3300048912 Ga0496109_0071412 Ga0496109_0071412_2287_2901 179
501 3300048912 Ga0496109_0399366 Ga0496109_0399366_475_1029 179
502 3300048913 Ga0496110_0035173 Ga0496110_0035173_3243_3782 179
503 3300048913 Ga0496110_0467715 Ga0496110_0467715_376_951 179
504 3300048917 Ga0496114_0015700 Ga0496114_0015700_4822_5397 179
505 3300048917 Ga0496114_0268158 Ga0496114_0268158_506_1045 179
506 3300048917 Ga0496114_0481168 Ga0496114_0481168_427_981 179
507 3300048917 Ga0496114_0537263 Ga0496114_0537263_40_615 179
508 3300048918 Ga0496115_0011541 Ga0496115_0011541_5700_6275 179
509 3300048918 Ga0496115_0202424 Ga0496115_0202424_477_1052 179
510 3300049571 Ga0501034_0076745 Ga0501034_0076745_831_1388 179
511 3300049574 Ga0501038_0230606 Ga0501038_0230606_774_1331 179
512 3300049581 Ga0501047_0139856 Ga0501047_0139856_316_873 179
513 3300049583 Ga0501067_0002914 Ga0501067_0002914_4722_5276 179
514 3300049583 Ga0501067_0016195 Ga0501067_0016195_2855_3412 179
515 3300049584 Ga0501068_0012143 Ga0501068_0012143_2585_3142 179
516 3300049585 Ga0501069_0091339 Ga0501069_0091339_373_927 179
517 3300049585 Ga0501069_0134807 Ga0501069_0134807_245_784 179
518 3300049586 Ga0501070_0000763 Ga0501070_0000763_19013_19552 179
519 3300049586 Ga0501070_0005725 Ga0501070_0005725_4173_4727 179
520 3300049586 Ga0501070_0037832 Ga0501070_0037832_1006_1563 179
521 3300049589 Ga0501073_0010094 Ga0501073_0010094_2708_3262 179
522 3300049589 Ga0501073_0052092 Ga0501073_0052092_666_1223 179
523 3300049590 Ga0501074_0007116 Ga0501074_0007116_3395_3949 179
524 3300049590 Ga0501074_0044876 Ga0501074_0044876_871_1428 179
525 3300049592 Ga0501076_0140375 Ga0501076_0140375_861_1418 179
526 3300049593 Ga0501077_0017281 Ga0501077_0017281_2867_3424 179
527 3300049741 Ga0501079_0116865 Ga0501079_0116865_824_1378 179
528 3300049741 Ga0501079_0189098 Ga0501079_0189098_963_1502 179
529 3300049741 Ga0501079_0288400 Ga0501079_0288400_630_1187 179
530 3300049742 Ga0501080_0003278 Ga0501080_0003278_4719_5273 179
531 3300049742 Ga0501080_0052948 Ga0501080_0052948_2846_3403 179
532 3300049742 Ga0501080_0135030 Ga0501080_0135030_826_1365 179
533 3300049744 Ga0501083_0001818 Ga0501083_0001818_9265_9819 179
534 3300049744 Ga0501083_0122392 Ga0501083_0122392_632_1189 179
535 3300060353 Ga0501082_0002096 Ga0501082_0002096_4139_4693 179
536 3300060353 Ga0501082_0110036 Ga0501082_0110036_797_1354 179
537 3300060353 Ga0501082_0249741 Ga0501082_0249741_363_902 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

76

170

0.94

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

63

172

0.88

PF04677

CwfJ_C_1

Protein similar to CwfJ C-terminus 1

51

167

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6af2-assembly1.cif.gz_C crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8695 40 174
5cs2-assembly1.cif.gz_A-2 crystal structure of plasmodium falciparum diadenosine triphosphate hydrolase in complex with cyclomarin a 0.8663 55 172
6af2-assembly1.cif.gz_B-2 crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8646 40 174
1fit-assembly1.cif.gz_A fhit (fragile histidine triad protein) 0.8473 55 175
4fit-assembly1.cif.gz_A-2 fhit-apo 0.8444 55 172
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9116 56 143 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9002 56 146 3.30.428.10
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8543 77 148 3.30.428.10
1emsB02 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8458 54 172 3.30.428.10
2fhiA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.842 55 172 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A2I1PHY7-F1-model_v4 deleted 0.8972 41 146
AF-A0A7X8ZE03-F1-model_v4 HIT domain-containing protein 0.8967 42 174 GO:0000166
GO:0003824
AF-A0A1G2U672-F1-model_v4 HIT domain-containing protein 0.8953 41 146 GO:0003824
GO:0009117
AF-A0A2H9NW59-F1-model_v4 HIT domain-containing protein 0.8893 39 146 GO:0003824
AF-X1E0D2-F1-model_v4 HIT domain-containing protein 0.8868 41 143 GO:0000166
GO:0003824

Feature Viewer

pLDDT pTM Quality
75.35 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map