F460952

General Info

Members Datasets Scaffolds Average Seq Length
537 267 1072 171

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0000980|Ga0496121_0000980_27816_28445
Length 209
Sequence MSKTSALGARWPDIFFQSFAWNNVRVIDFLSGAKQQEDVMATNTFTDAIALLKADHRKVEELFDQFETRKAATKKQQIAHQICTELKIHTSIEEEIFYPAFRGKIEDDTLDEAYVEHDGAKVLINDIEAGSAEDDFYAAKVKVLSEEVKHHVHEEEMPSEGMFAQCRKTDVDLVALRDQMMARKEELLALATTSGLPAAKPSVVNLIAA

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
91 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
161 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
162 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
163 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
164 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
165 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
166 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
167 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
168 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
169 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
170 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
171 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
172 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
175 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
176 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
177 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
178 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
179 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
180 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
183 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
187 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
188 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
192 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
193 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
198 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
199 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
228 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
232 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
233 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
234 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
235 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
236 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
237 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
238 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
239 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
250 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
251 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
252 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
253 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
254 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
255 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
256 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
257 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
258 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
259 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
263 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
264 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
265 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
266 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
267 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 1.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.98
Nodule 0.37
Rhizoplane 1.68
Rhizosphere 57.91
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0000980 3300048924 Bacteria 51090
2 ARcpr5oldR_c002125 3300000041 Bacteria 1870
3 ARcpr5yngRDRAFT_c004603 3300000043 Bacteria 1299
4 ARCol0yngRDRAFT_1004974 3300000652 Bacteria 958
5 JGI24736J21556_1000150 3300001904 Bacteria 12238
6 JGI24741J21665_1001648 3300001915 Bacteria 6219
7 JGI24741J21665_1001888 3300001915 Bacteria 5688
8 JGI24740J21852_10008802 3300001979 Bacteria 4001
9 JGI24740J21852_10012416 3300001979 Bacteria 3210
10 JGI24739J22299_10000517 3300001989 Bacteria 13765
11 JGI24739J22299_10029931 3300001989 Bacteria 1890
12 JGI24739J22299_10056979 3300001989 Bacteria 1245
13 JGI24735J21928_10052048 3300002067 Bacteria 1181
14 JGI24738J21930_10003757 3300002075 Bacteria 3793
15 JGI24738J21930_10009583 3300002075 Bacteria 2175
16 JGI24738J21930_10065527 3300002075 Bacteria 748
17 JGI25152J39213_1015597 3300002773 Bacteria 1494
18 JGI25152J39213_1016924 3300002773 Bacteria 1390
19 JGI25150J39212_1000140 3300002774 Bacteria 40705
20 JGI25150J39212_1000202 3300002774 Bacteria 32734
21 JGI25150J39212_1023255 3300002774 Bacteria 923
22 JGI25151J46595_10007315 3300003187 Bacteria 5431
23 JGI25151J46595_10035761 3300003187 Bacteria 1882
24 JGI25153J46596_10000064 3300003215 Bacteria 125642
25 JGI25153J46596_10000109 3300003215 Bacteria 93661
26 JGI25153J46596_10005166 3300003215 Bacteria 6875
27 JGI25153J46596_10050931 3300003215 Bacteria 1190
28 rootH2_10100151 3300003320 Bacteria 2293
29 Ga0055526_1001044 3300003771 Bacteria 20207
30 Ga0055526_1009741 3300003771 Bacteria 4572
31 Ga0055537_1001276 3300003773 Bacteria 10463
32 Ga0055537_1002857 3300003773 Bacteria 5535
33 Ga0055537_1003817 3300003773 Bacteria 4513
34 Ga0055524_1000276 3300003775 Bacteria 50977
35 Ga0055524_1000416 3300003775 Bacteria 35958
36 Ga0055536_1015352 3300003781 Bacteria 2627
37 Ga0055536_1048563 3300003781 Bacteria 948
38 Ga0055528_1012095 3300003790 Bacteria 3376
39 Ga0055528_1018315 3300003790 Bacteria 2378
40 Ga0055528_1045654 3300003790 Bacteria 932
41 Ga0055530_10001271 3300003791 Bacteria 19049
42 Ga0055530_10005032 3300003791 Bacteria 6504
43 Ga0055530_10007090 3300003791 Bacteria 4809
44 Ga0055530_10027406 3300003791 Bacteria 1557
45 Ga0055540_1000185 3300003792 Bacteria 60356
46 Ga0055540_1000667 3300003792 Bacteria 23816
47 Ga0055531_10000088 3300003794 Bacteria 100973
48 Ga0055531_10000260 3300003794 Bacteria 55686
49 Ga0055531_10001272 3300003794 Bacteria 19049
50 Ga0055531_10002774 3300003794 Bacteria 11500
51 Ga0055531_10009307 3300003794 Bacteria 5038
52 Ga0055531_10012145 3300003794 Bacteria 4078
53 Ga0055531_10027193 3300003794 Bacteria 2014
54 Ga0065165_1000712 3300005262 Bacteria 46910
55 Ga0065165_1003761 3300005262 Bacteria 10189
56 Ga0065165_1004847 3300005262 Bacteria 7999
57 Ga0065165_1013993 3300005262 Bacteria 3142
58 Ga0065704_10001975 3300005289 Bacteria 9225
59 Ga0065704_10089679 3300005289 Bacteria 2818
60 Ga0065704_10188778 3300005289 Bacteria 1200
61 Ga0065704_10307525 3300005289 Bacteria 852
62 Ga0065707_10091281 3300005295 Bacteria 3974
63 Ga0065707_10245414 3300005295 Bacteria 1142
64 Ga0070658_10289940 3300005327 Bacteria 1394
65 Ga0070670_100013816 3300005331 Bacteria 6922
66 Ga0070666_10022481 3300005335 Bacteria 4094
67 Ga0070666_10387827 3300005335 Bacteria 1003
68 Ga0070682_100936421 3300005337 Bacteria 714
69 Ga0070660_100061185 3300005339 Bacteria 2923
70 Ga0070661_100126523 3300005344 Bacteria 1917
71 Ga0070668_100001336 3300005347 Bacteria 17622
72 Ga0070668_100005107 3300005347 Bacteria 9722
73 Ga0070668_100019637 3300005347 Bacteria 5088
74 Ga0070668_100028523 3300005347 Bacteria 4237
75 Ga0070669_100022424 3300005353 Bacteria 4513
76 Ga0070669_100028373 3300005353 Bacteria 4031
77 Ga0070669_100055411 3300005353 Bacteria 2905
78 Ga0070671_100114959 3300005355 Bacteria 2262
79 Ga0070659_100212753 3300005366 Bacteria 1593
80 Ga0070667_100000062 3300005367 Bacteria 143729
81 Ga0070667_100000195 3300005367 Bacteria 72280
82 Ga0070663_100052471 3300005455 Bacteria 2908
83 Ga0070663_100590755 3300005455 Bacteria 933
84 Ga0070662_100080675 3300005457 Bacteria 2423
85 Ga0070662_101283154 3300005457 Bacteria 630
86 Ga0070685_10025294 3300005466 Bacteria 3268
87 Ga0068853_100057594 3300005539 Bacteria 3354
88 Ga0068853_100393282 3300005539 Bacteria 1296
89 Ga0070665_100001120 3300005548 Bacteria 32952
90 Ga0070665_100702992 3300005548 Bacteria 1024
91 Ga0068855_100040340 3300005563 Bacteria 5542
92 Ga0068855_100321773 3300005563 Bacteria 1709
93 Ga0068855_100498095 3300005563 Bacteria 1324
94 Ga0070664_100075897 3300005564 Bacteria 2887
95 Ga0068857_100034972 3300005577 Bacteria 4446
96 Ga0068857_100307270 3300005577 Bacteria 1463
97 Ga0068854_100018351 3300005578 Bacteria 4696
98 Ga0068854_100120760 3300005578 Bacteria 1989
99 Ga0068856_100047754 3300005614 Bacteria 4218
100 Ga0068852_100001556 3300005616 Bacteria 15590
101 Ga0068859_100048969 3300005617 Bacteria 4244
102 Ga0068864_100000088 3300005618 Bacteria 98366
103 Ga0068864_100132283 3300005618 Bacteria 2242
104 Ga0068861_100026356 3300005719 Bacteria 4225
105 Ga0068851_10218629 3300005834 Bacteria 1069
106 Ga0068863_100000016 3300005841 Bacteria 213575
107 Ga0068863_100000054 3300005841 Bacteria 124495
108 Ga0068860_100000168 3300005843 Bacteria 107408
109 Ga0068860_100000284 3300005843 Bacteria 72294
110 Ga0068860_100018339 3300005843 Bacteria 6809
111 Ga0068862_100011038 3300005844 Bacteria 7461
112 Ga0068862_100236778 3300005844 Bacteria 1658
113 Ga0075368_10000072 3300006042 Bacteria 24174
114 Ga0075368_10000110 3300006042 Bacteria 21315
115 Ga0075363_100000003 3300006048 Bacteria 61893
116 Ga0075363_100010361 3300006048 Bacteria 4423
117 Ga0075364_10000536 3300006051 Bacteria 19351
118 Ga0075362_10000048 3300006177 Bacteria 40628
119 Ga0075367_10000060 3300006178 Bacteria 26825
120 Ga0075367_10000121 3300006178 Bacteria 22681
121 Ga0075369_10000658 3300006186 Bacteria 10998
122 Ga0075366_10023707 3300006195 Bacteria 3576
123 Ga0075366_10046391 3300006195 Bacteria 2575
124 Ga0075366_10138025 3300006195 Bacteria 1473
125 Ga0075370_10007829 3300006353 Bacteria 5464
126 Ga0075370_10053931 3300006353 Bacteria 2282
127 Ga0097620_100048968 3300006931 Bacteria 4244
128 Ga0099826_10191341 3300006948 Bacteria 1129
129 Ga0105251_10113816 3300009011 Bacteria 1231
130 Ga0105240_10008865 3300009093 Bacteria 14316
131 Ga0105240_10016433 3300009093 Bacteria 10020
132 Ga0105240_10514901 3300009093 Bacteria 1328
133 Ga0105243_10471340 3300009148 Bacteria 1183
134 Ga0105241_10010587 3300009174 Bacteria 6765
135 Ga0105242_11267554 3300009176 Bacteria 759
136 Ga0105248_10050467 3300009177 Bacteria 4666
137 Ga0105248_10061725 3300009177 Bacteria 4209
138 Ga0105248_10910580 3300009177 Bacteria 993
139 Ga0105237_10021790 3300009545 Bacteria 6582
140 Ga0105238_10162188 3300009551 Bacteria 2211
141 Ga0105238_10210568 3300009551 Bacteria 1920
142 Ga0105238_11479457 3300009551 Bacteria 707
143 Ga0105249_10386795 3300009553 Bacteria 1426
144 Ga0105249_10490351 3300009553 Bacteria 1272
145 Ga0105148_100031 3300009978 Bacteria 20228
146 Ga0105239_10001630 3300010375 Bacteria 29606
147 Ga0105246_11339301 3300011119 Bacteria 665
148 Ga0157371_10076545 3300013102 Bacteria 2369
149 Ga0157370_10046826 3300013104 Bacteria 4146
150 Ga0157370_10664947 3300013104 Bacteria 952
151 Ga0157369_10064755 3300013105 Bacteria 3936
152 Ga0157369_10252886 3300013105 Bacteria 1839
153 Ga0157374_10721522 3300013296 Bacteria 1011
154 Ga0157378_10001980 3300013297 Bacteria 18324
155 Ga0163162_10065679 3300013306 Bacteria 3676
156 Ga0157372_10432581 3300013307 Bacteria 1534
157 Ga0157375_11041419 3300013308 Bacteria 956
158 Ga0157380_10000976 3300014326 Bacteria 18134
159 Ga0157380_10013963 3300014326 Bacteria 5864
160 Ga0163161_10104155 3300017792 Bacteria 2115
161 Ga0163161_10112078 3300017792 Bacteria 2041
162 Ga0163161_10170207 3300017792 Bacteria 1665
163 Ga0206356_11335779 3300020070 Bacteria 661
164 Ga0206349_1066120 3300020075 Bacteria 649
165 Ga0206355_1538906 3300020076 Bacteria 823
166 Ga0206351_10972283 3300020077 Bacteria 757
167 Ga0206352_10880385 3300020078 Bacteria 709
168 Ga0206354_11150845 3300020081 Bacteria 653
169 Ga0154015_1405376 3300020610 Bacteria 717
170 Ga0209147_100926 3300025229 Bacteria 13115
171 Ga0209147_101263 3300025229 Bacteria 9908
172 Ga0207425_1000073 3300025245 Bacteria 113233
173 Ga0207425_1000095 3300025245 Bacteria 84955
174 Ga0207425_1012800 3300025245 Bacteria 1955
175 Ga0209129_1000435 3300025258 Bacteria 31097
176 Ga0209129_1001494 3300025258 Bacteria 13003
177 Ga0209565_1000008 3300025263 Bacteria 774179
178 Ga0209565_1000010 3300025263 Bacteria 687724
179 Ga0209565_1000062 3300025263 Bacteria 184007
180 Ga0209565_1000206 3300025263 Bacteria 68867
181 Ga0209565_1026100 3300025263 Bacteria 1175
182 Ga0209673_1001509 3300025273 Bacteria 21455
183 Ga0209673_1006714 3300025273 Bacteria 5488
184 Ga0209673_1028751 3300025273 Bacteria 1783
185 Ga0209673_1038661 3300025273 Bacteria 1386
186 Ga0209675_1016592 3300025291 Bacteria 2136
187 Ga0209675_1021346 3300025291 Bacteria 1729
188 Ga0209675_1064216 3300025291 Bacteria 716
189 Ga0209676_1000288 3300025292 Bacteria 103217
190 Ga0209676_1000588 3300025292 Bacteria 54210
191 Ga0209676_1001454 3300025292 Bacteria 22208
192 Ga0209025_1000202 3300025294 Bacteria 145750
193 Ga0209025_1000421 3300025294 Bacteria 84693
194 Ga0209564_1000378 3300025295 Bacteria 81676
195 Ga0209564_1001476 3300025295 Bacteria 23770
196 Ga0209564_1006959 3300025295 Bacteria 5939
197 Ga0209758_1000019 3300025297 Bacteria 743682
198 Ga0209758_1000242 3300025297 Bacteria 113233
199 Ga0209758_1002052 3300025297 Bacteria 21592
200 Ga0209758_1008054 3300025297 Bacteria 6956
201 Ga0209758_1021546 3300025297 Bacteria 3000
202 Ga0209758_1029035 3300025297 Bacteria 2324
203 Ga0209050_1000001 3300025298 Bacteria 3563507
204 Ga0209050_1000619 3300025298 Bacteria 55726
205 Ga0209050_1002682 3300025298 Bacteria 14509
206 Ga0209050_1003221 3300025298 Bacteria 12348
207 Ga0209050_1006051 3300025298 Bacteria 7325
208 Ga0209256_1000009 3300025299 Bacteria 922071
209 Ga0209256_1000010 3300025299 Bacteria 912110
210 Ga0209256_1000293 3300025299 Bacteria 87792
211 Ga0207426_1028300 3300025302 Bacteria 1859
212 Ga0207426_1059224 3300025302 Bacteria 1108
213 Ga0209051_1000193 3300025303 Bacteria 108391
214 Ga0209051_1000209 3300025303 Bacteria 102832
215 Ga0209051_1003122 3300025303 Bacteria 11163
216 Ga0209051_1035551 3300025303 Bacteria 1852
217 Ga0209257_1000111 3300025304 Bacteria 234809
218 Ga0209257_1000551 3300025304 Bacteria 64327
219 Ga0209257_1001505 3300025304 Bacteria 27373
220 Ga0209257_1001533 3300025304 Bacteria 26941
221 Ga0209257_1001950 3300025304 Bacteria 22274
222 Ga0209257_1005579 3300025304 Bacteria 8743
223 Ga0209257_1008081 3300025304 Bacteria 6123
224 Ga0209257_1084734 3300025304 Bacteria 805
225 Ga0207656_10120580 3300025321 Bacteria 1220
226 Ga0207713_1075333 3300025735 Bacteria 1231
227 Ga0207680_10011928 3300025903 Bacteria 4411
228 Ga0207647_10039943 3300025904 Bacteria 2958
229 Ga0207705_10051672 3300025909 Bacteria 2958
230 Ga0207654_10212672 3300025911 Bacteria 1279
231 Ga0207695_10012916 3300025913 Bacteria 9994
232 Ga0207695_10058776 3300025913 Bacteria 3991
233 Ga0207671_10004540 3300025914 Bacteria 13190
234 Ga0207671_10256428 3300025914 Bacteria 1376
235 Ga0207657_10016794 3300025919 Bacteria 7047
236 Ga0207681_10019166 3300025923 Bacteria 4321
237 Ga0207681_10039619 3300025923 Bacteria 3130
238 Ga0207694_10085891 3300025924 Bacteria 2477
239 Ga0207694_10259529 3300025924 Bacteria 1423
240 Ga0207650_10015123 3300025925 Bacteria 5370
241 Ga0207690_10073383 3300025932 Bacteria 2366
242 Ga0207706_10029825 3300025933 Bacteria 4868
243 Ga0207706_10887088 3300025933 Bacteria 754
244 Ga0207711_10095352 3300025941 Bacteria 2624
245 Ga0207711_10139966 3300025941 Bacteria 2176
246 Ga0207711_10249746 3300025941 Bacteria 1629
247 Ga0207661_10509935 3300025944 Bacteria 1099
248 Ga0207667_10105802 3300025949 Bacteria 2903
249 Ga0207667_10270753 3300025949 Bacteria 1736
250 Ga0207712_10018015 3300025961 Bacteria 4595
251 Ga0207712_10225421 3300025961 Bacteria 1501
252 Ga0207712_10828726 3300025961 Bacteria 814
253 Ga0207668_10000924 3300025972 Bacteria 17639
254 Ga0207668_10001714 3300025972 Bacteria 12826
255 Ga0207668_10038877 3300025972 Bacteria 3197
256 Ga0207668_10079978 3300025972 Bacteria 2366
257 Ga0207640_10012692 3300025981 Bacteria 4806
258 Ga0207640_10132772 3300025981 Bacteria 1802
259 Ga0207640_10924260 3300025981 Bacteria 763
260 Ga0207658_10000039 3300025986 Bacteria 143707
261 Ga0207658_10000279 3300025986 Bacteria 53475
262 Ga0207639_10001103 3300026041 Bacteria 18327
263 Ga0207639_10003148 3300026041 Bacteria 11093
264 Ga0207639_10207004 3300026041 Bacteria 1686
265 Ga0207639_10325529 3300026041 Bacteria 1366
266 Ga0207639_11276231 3300026041 Bacteria 689
267 Ga0207678_10013773 3300026067 Bacteria 7105
268 Ga0207678_10143631 3300026067 Bacteria 2037
269 Ga0207702_10031905 3300026078 Bacteria 4394
270 Ga0207641_10000095 3300026088 Bacteria 124498
271 Ga0207641_10000315 3300026088 Bacteria 60017
272 Ga0207641_10011272 3300026088 Bacteria 7333
273 Ga0207676_10000146 3300026095 Bacteria 61729
274 Ga0207676_10557578 3300026095 Bacteria 1095
275 Ga0207674_10000748 3300026116 Bacteria 42600
276 Ga0207674_10348765 3300026116 Bacteria 1431
277 Ga0207675_100111951 3300026118 Bacteria 2576
278 Ga0207698_10027801 3300026142 Bacteria 4021
279 Ga0207698_10031490 3300026142 Bacteria 3828
280 Ga0209371_1042637 3300027312 Bacteria 912
281 Ga0209282_1205568 3300027666 Bacteria 903
282 Ga0209813_10000018 3300027866 Bacteria 75656
283 Ga0209813_10000070 3300027866 Bacteria 38898
284 Ga0268266_10004104 3300028379 Bacteria 14067
285 Ga0268266_10015509 3300028379 Bacteria 6536
286 Ga0268266_10378504 3300028379 Bacteria 1335
287 Ga0268265_10249775 3300028380 Bacteria 1570
288 Ga0268265_10602618 3300028380 Bacteria 1050
289 Ga0268264_10000040 3300028381 Bacteria 373714
290 Ga0268264_10000337 3300028381 Bacteria 72308
291 Ga0268264_10006874 3300028381 Bacteria 9548
292 Ga0268264_11223732 3300028381 Bacteria 761
293 Ga0265338_10373704 3300028800 Bacteria 1021
294 Ga0268256_1048230 3300030500 Bacteria 912
295 Ga0265331_10043123 3300031250 Bacteria 2186
296 Ga0307408_100049519 3300031548 Bacteria 3018
297 Ga0307408_100105106 3300031548 Bacteria 2158
298 Ga0307405_10045470 3300031731 Bacteria 2691
299 Ga0307405_10230287 3300031731 Bacteria 1365
300 Ga0307405_10457219 3300031731 Bacteria 1014
301 Ga0307413_10028648 3300031824 Bacteria 3105
302 Ga0307413_10217660 3300031824 Bacteria 1392
303 Ga0307413_10382340 3300031824 Bacteria 1097
304 Ga0307413_10610252 3300031824 Bacteria 894
305 Ga0307410_10147209 3300031852 Bacteria 1749
306 Ga0307406_10150356 3300031901 Bacteria 1660
307 Ga0307406_10550010 3300031901 Bacteria 944
308 Ga0307407_10227774 3300031903 Bacteria 1264
309 Ga0307412_10044068 3300031911 Bacteria 2909
310 Ga0307412_10055930 3300031911 Bacteria 2627
311 Ga0307412_10110948 3300031911 Bacteria 1958
312 Ga0307412_10210710 3300031911 Bacteria 1482
313 Ga0307412_10989597 3300031911 Bacteria 742
314 Ga0307412_11333108 3300031911 Bacteria 647
315 Ga0307409_100080191 3300031995 Bacteria 2633
316 Ga0307409_100269579 3300031995 Bacteria 1567
317 Ga0307409_100722406 3300031995 Bacteria 997
318 Ga0307416_100115728 3300032002 Bacteria 2375
319 Ga0307416_100183320 3300032002 Bacteria 1965
320 Ga0307416_101054622 3300032002 Bacteria 917
321 Ga0307416_101727726 3300032002 Bacteria 730
322 Ga0307414_10071381 3300032004 Bacteria 2504
323 Ga0307414_10894099 3300032004 Bacteria 814
324 Ga0307411_10118637 3300032005 Bacteria 1909
325 Ga0307411_10254232 3300032005 Bacteria 1383
326 Ga0307411_10615948 3300032005 Bacteria 935
327 Ga0307411_11004862 3300032005 Bacteria 747
328 Ga0307415_100660734 3300032126 Bacteria 938
329 Ga0237819_01265 3300038705 Bacteria 6937
330 Ga0439436_0025403 3300041404 Bacteria 1740
331 Ga0439439_0040776 3300041406 Bacteria 1202
332 Ga0439461_0000552 3300041410 Bacteria 5430
333 Ga0439461_0049546 3300041410 Bacteria 928
334 Ga0439465_0000182 3300041413 Bacteria 16171
335 Ga0439465_0001027 3300041413 Bacteria 8889
336 Ga0451791_1112956 3300041451 Bacteria 644
337 Ga0451793_0250625 3300041452 Bacteria 784
338 Ga0451802_1705853 3300041460 Bacteria 754
339 Ga0451837_0324922 3300041494 Bacteria 622
340 Ga0451843_1101219 3300041509 Bacteria 1016
341 Ga0439431_0001452 3300041997 Bacteria 5238
342 Ga0439431_0005865 3300041997 Bacteria 2713
343 Ga0439445_0012307 3300042004 Bacteria 2053
344 Ga0439445_0012778 3300042004 Bacteria 2022
345 Ga0439445_0022655 3300042004 Bacteria 1585
346 Ga0439445_0175612 3300042004 Bacteria 628
347 Ga0439432_000375 3300042006 Bacteria 16484
348 Ga0439449_0038369 3300042007 Bacteria 1781
349 Ga0439452_062964 3300042010 Bacteria 828
350 Ga0439457_042048 3300042014 Bacteria 1019
351 Ga0439462_0002527 3300042015 Bacteria 4263
352 Ga0439462_0013022 3300042015 Bacteria 2129
353 Ga0450912_001740 3300042116 Bacteria 1380
354 Ga0450920_025405 3300042122 Bacteria 1154
355 Ga0450898_114462 3300042134 Bacteria 572
356 Ga0439446_0068365 3300042156 Bacteria 1083
357 Ga0439434_0000263 3300042435 Bacteria 14861
358 Ga0439434_0009302 3300042435 Bacteria 2887
359 Ga0495617_129675 3300046452 Bacteria 809
360 Ga0495627_053212 3300046453 Bacteria 1212
361 Ga0495627_126914 3300046453 Bacteria 719
362 Ga0495638_0086197 3300046460 Bacteria 1898
363 Ga0495638_0086228 3300046460 Bacteria 1898
364 Ga0495638_0453740 3300046460 Bacteria 654
365 Ga0495650_0096049 3300046471 Bacteria 1119
366 Ga0495596_0000543 3300046500 Bacteria 23656
367 Ga0495607_0105495 3300046501 Bacteria 1502
368 Ga0495583_0000054 3300046506 Bacteria 208592
369 Ga0495583_0000236 3300046506 Bacteria 91911
370 Ga0495583_0035686 3300046506 Bacteria 2371
371 Ga0495583_0102652 3300046506 Bacteria 1219
372 Ga0495606_0002566 3300046507 Bacteria 20851
373 Ga0495606_0050205 3300046507 Bacteria 2730
374 Ga0495606_0067017 3300046507 Bacteria 2274
375 Ga0495610_0001035 3300046512 Bacteria 25555
376 Ga0495610_0017208 3300046512 Bacteria 4126
377 Ga0495616_0000066 3300046513 Bacteria 90234
378 Ga0495632_0000722 3300046519 Bacteria 30013
379 Ga0495637_0000036 3300046520 Bacteria 122003
380 Ga0495643_0000037 3300046522 Bacteria 237688
381 Ga0495643_0042862 3300046522 Bacteria 2464
382 Ga0495648_0011837 3300046524 Bacteria 6544
383 Ga0495663_0000001 3300046525 Bacteria 595264
384 Ga0495663_0057764 3300046525 Bacteria 1214
385 Ga0495663_0122722 3300046525 Bacteria 871
386 Ga0495654_0000418 3300046530 Bacteria 36299
387 Ga0495598_0040021 3300046537 Bacteria 1365
388 Ga0495609_0005526 3300046538 Bacteria 6608
389 Ga0495621_0166950 3300046539 Bacteria 873
390 Ga0495597_0070616 3300046542 Bacteria 1505
391 Ga0495633_0000179 3300046558 Bacteria 82201
392 Ga0495633_0045861 3300046558 Bacteria 2069
393 Ga0495633_0073804 3300046558 Bacteria 1590
394 Ga0495633_0125959 3300046558 Bacteria 1185
395 Ga0495668_0002154 3300046616 Bacteria 16905
396 Ga0495668_0023152 3300046616 Bacteria 3545
397 Ga0495668_0073891 3300046616 Bacteria 1872
398 Ga0495625_0052732 3300046660 Bacteria 2911
399 Ga0495625_0061678 3300046660 Bacteria 2653
400 Ga0495625_0178734 3300046660 Bacteria 1413
401 Ga0495670_0000034 3300046691 Bacteria 80461
402 Ga0495671_0000004 3300046692 Bacteria 545630
403 Ga0495671_0000025 3300046692 Bacteria 240277
404 Ga0495671_0000045 3300046692 Bacteria 159097
405 Ga0495671_0020076 3300046692 Bacteria 3525
406 Ga0495671_0197582 3300046692 Bacteria 976
407 Ga0495673_0000021 3300047469 Bacteria 545523
408 Ga0495673_0000063 3300047469 Bacteria 225912
409 Ga0495673_0094367 3300047469 Bacteria 1218
410 Ga0495681_0000036 3300047470 Bacteria 124207
411 Ga0495686_0000245 3300047472 Bacteria 97784
412 Ga0495686_0001354 3300047472 Bacteria 27379
413 Ga0495686_0001864 3300047472 Bacteria 21160
414 Ga0495686_0260660 3300047472 Bacteria 970
415 Ga0495686_0394604 3300047472 Bacteria 744
416 Ga0495626_0004465 3300048091 Bacteria 8580
417 Ga0496101_0653397 3300048904 Bacteria 831
418 Ga0496104_0111336 3300048907 Bacteria 2625
419 Ga0496108_0003893 3300048911 Bacteria 11988
420 Ga0496109_0070619 3300048912 Bacteria 3205
421 Ga0496111_0269522 3300048914 Bacteria 1263
422 Ga0496113_0031380 3300048916 Bacteria 3856
423 Ga0496116_0000976 3300048919 Bacteria 35105
424 Ga0496116_0024603 3300048919 Bacteria 4448
425 Ga0496117_0005672 3300048920 Bacteria 13009
426 Ga0496117_0086754 3300048920 Bacteria 2032
427 Ga0496118_0003499 3300048921 Bacteria 19694
428 Ga0496118_0019597 3300048921 Bacteria 6040
429 Ga0496118_0031285 3300048921 Bacteria 4415
430 Ga0496118_0173579 3300048921 Bacteria 1313
431 Ga0496118_0187908 3300048921 Bacteria 1239
432 Ga0496119_0255290 3300048922 Bacteria 882
433 Ga0496119_0261067 3300048922 Bacteria 869
434 Ga0496120_0047341 3300048923 Bacteria 2480
435 Ga0496120_0110482 3300048923 Bacteria 1437
436 Ga0496120_0290027 3300048923 Bacteria 753
437 Ga0496121_0002091 3300048924 Bacteria 31505
438 Ga0496121_0004175 3300048924 Bacteria 19748
439 Ga0496121_0005584 3300048924 Bacteria 16063
440 Ga0496121_0014298 3300048924 Bacteria 8439
441 Ga0496121_0028465 3300048924 Bacteria 5200
442 Ga0496122_0000094 3300048925 Bacteria 202047
443 Ga0496122_0004599 3300048925 Bacteria 16989
444 Ga0496122_0267232 3300048925 Bacteria 945
445 Ga0496122_0375015 3300048925 Bacteria 732
446 Ga0496122_0478206 3300048925 Bacteria 611
447 Ga0496123_0000626 3300048926 Bacteria 59189
448 Ga0496123_0011325 3300048926 Bacteria 7746
449 Ga0496123_0123699 3300048926 Bacteria 1449
450 Ga0496123_0229462 3300048926 Bacteria 930
451 Ga0496123_0255524 3300048926 Bacteria 862
452 Ga0496123_0333982 3300048926 Bacteria 711
453 Ga0496124_0007774 3300048927 Bacteria 11325
454 Ga0496124_0011656 3300048927 Bacteria 8773
455 Ga0496124_0012526 3300048927 Bacteria 8362
456 Ga0496124_0024753 3300048927 Bacteria 5450
457 Ga0496124_0028123 3300048927 Bacteria 5032
458 Ga0496124_0047335 3300048927 Bacteria 3679
459 Ga0496124_0152327 3300048927 Bacteria 1812
460 Ga0496124_0863429 3300048927 Unclassified 553
461 Ga0496125_0015761 3300048928 Bacteria 7287
462 Ga0496125_0026092 3300048928 Bacteria 5335
463 Ga0496125_0030376 3300048928 Bacteria 4835
464 Ga0496125_0031310 3300048928 Bacteria 4742
465 Ga0496125_0031816 3300048928 Bacteria 4695
466 Ga0496125_0054551 3300048928 Bacteria 3265
467 Ga0496125_0156750 3300048928 Bacteria 1554
468 Ga0496125_0253650 3300048928 Bacteria 1108
469 Ga0496126_0000517 3300048929 Bacteria 75042
470 Ga0496126_0057729 3300048929 Bacteria 3502
471 Ga0496126_0292503 3300048929 Bacteria 1346
472 Ga0495678_054690 3300049459 Bacteria 1527
473 Ga0501335_004394 3300049551 Bacteria 1230
474 Ga0501034_0001122 3300049571 Bacteria 37416
475 Ga0501043_0013634 3300049579 Bacteria 6360
476 Ga0501206_010182 3300049653 Bacteria 1257
477 Ga0501211_001557 3300049658 Bacteria 2455
478 Ga0501223_000084 3300049663 Bacteria 28507
479 Ga0501235_099629 3300049669 Bacteria 708
480 Ga0501242_032367 3300049674 Bacteria 713
481 Ga0501255_009650 3300049684 Bacteria 1075
482 Ga0501221_029127 3300049704 Bacteria 1141
483 Ga0501225_0000044 3300049705 Bacteria 41695
484 Ga0501225_0000352 3300049705 Bacteria 14565
485 Ga0501225_0019805 3300049705 Bacteria 1860
486 Ga0501281_02702 3300049777 Bacteria 1283
487 nmdc:mga03683_45_c1 3300050489 Bacteria 58869
488 nmdc:mga03n38_24821_c1 3300050490 Bacteria 2455
489 nmdc:mga03n38_2_c1 3300050490 Bacteria 83515
490 nmdc:mga00v17_20_c1 3300050491 Bacteria 110672
491 nmdc:mga00v17_324461_c1 3300050491 Bacteria 1000
492 nmdc:mga0k408_17584_c1 3300050493 Bacteria 3985
493 nmdc:mga0k408_19280_c1 3300050493 Bacteria 3810
494 nmdc:mga0k408_19601_c1 3300050493 Bacteria 3782
495 nmdc:mga06z11_29_c1 3300050494 Bacteria 60343
496 nmdc:mga06z11_88_c1 3300050494 Bacteria 38889
497 nmdc:mga04h51_51_c1 3300050495 Bacteria 37763
498 nmdc:mga04h51_68_c1 3300050495 Bacteria 33109
499 nmdc:mga07m45_22189_c1 3300050496 Bacteria 3464
500 nmdc:mga07m45_24_c1 3300050496 Bacteria 110671
501 nmdc:mga07m45_464050_c1 3300050496 Bacteria 734
502 nmdc:mga0sz30_160_c1 3300050516 Bacteria 24830
503 Ga0500643_000226 3300053087 Bacteria 52820
504 Ga0500643_000244 3300053087 Bacteria 49957
505 Ga0500643_002018 3300053087 Bacteria 10919
506 Ga0500643_002028 3300053087 Bacteria 10875
507 Ga0500641_0002276 3300053096 Bacteria 6809
508 Ga0500650_0004187 3300053098 Bacteria 5173
509 Ga0500650_0160476 3300053098 Bacteria 1037
510 Ga0500556_0000025 3300053104 Bacteria 167307
511 Ga0500556_0224731 3300053104 Bacteria 740
512 Ga0500562_011424 3300053108 Bacteria 2256
513 Ga0500617_075937 3300053124 Bacteria 1464
514 Ga0500642_0000001 3300053130 Bacteria 1468402
515 Ga0500658_0000261 3300053134 Bacteria 24255
516 Ga0500559_0002494 3300053136 Bacteria 9462
517 Ga0500568_0077195 3300053139 Bacteria 1268
518 Ga0500568_0120288 3300053139 Bacteria 979
519 Ga0500568_0160261 3300053139 Bacteria 830
520 Ga0500577_0047417 3300053142 Bacteria 1597
521 Ga0500604_0003011 3300053151 Bacteria 4523
522 Ga0500604_0064853 3300053151 Bacteria 1154
523 Ga0500616_0014942 3300053153 Bacteria 4450
524 Ga0500616_0017837 3300053153 Bacteria 4021
525 Ga0500622_0000356 3300053156 Bacteria 44558
526 Ga0500622_0271135 3300053156 Bacteria 735
527 Ga0500627_0000174 3300053158 Bacteria 18780
528 Ga0500627_0000816 3300053158 Bacteria 8336
529 Ga0500627_0263600 3300053158 Bacteria 760
530 Ga0500611_002336 3300053727 Bacteria 2253
531 Ga0500611_014200 3300053727 Bacteria 1384
532 Ga0500645_000299 3300053730 Bacteria 35470
533 Ga0500645_001285 3300053730 Bacteria 13110
534 Ga0500587_002876 3300053739 Bacteria 2436
535 Ga0500661_000080 3300055283 Bacteria 15230
536 Ga0587098_009775 3300059604 Bacteria 1049
537 Ga0496121_0000980
538 ARcpr5oldR_c002125
539 ARcpr5yngRDRAFT_c004603
540 ARCol0yngRDRAFT_1004974
541 JGI24736J21556_1000150
542 JGI24741J21665_1001648
543 JGI24741J21665_1001888
544 JGI24740J21852_10008802
545 JGI24740J21852_10012416
546 JGI24739J22299_10000517
547 JGI24739J22299_10029931
548 JGI24739J22299_10056979
549 JGI24735J21928_10052048
550 JGI24738J21930_10003757
551 JGI24738J21930_10009583
552 JGI24738J21930_10065527
553 JGI25152J39213_1015597
554 JGI25152J39213_1016924
555 JGI25150J39212_1000140
556 JGI25150J39212_1000202
557 JGI25150J39212_1023255
558 JGI25151J46595_10007315
559 JGI25151J46595_10035761
560 JGI25153J46596_10000064
561 JGI25153J46596_10000109
562 JGI25153J46596_10005166
563 JGI25153J46596_10050931
564 rootH2_10100151
565 Ga0055526_1001044
566 Ga0055526_1009741
567 Ga0055537_1001276
568 Ga0055537_1002857
569 Ga0055537_1003817
570 Ga0055524_1000276
571 Ga0055524_1000416
572 Ga0055536_1015352
573 Ga0055536_1048563
574 Ga0055528_1012095
575 Ga0055528_1018315
576 Ga0055528_1045654
577 Ga0055530_10001271
578 Ga0055530_10005032
579 Ga0055530_10007090
580 Ga0055530_10027406
581 Ga0055540_1000185
582 Ga0055540_1000667
583 Ga0055531_10000088
584 Ga0055531_10000260
585 Ga0055531_10001272
586 Ga0055531_10002774
587 Ga0055531_10009307
588 Ga0055531_10012145
589 Ga0055531_10027193
590 Ga0065165_1000712
591 Ga0065165_1003761
592 Ga0065165_1004847
593 Ga0065165_1013993
594 Ga0065704_10001975
595 Ga0065704_10089679
596 Ga0065704_10188778
597 Ga0065704_10307525
598 Ga0065707_10091281
599 Ga0065707_10245414
600 Ga0070658_10289940
601 Ga0070670_100013816
602 Ga0070666_10022481
603 Ga0070666_10387827
604 Ga0070682_100936421
605 Ga0070660_100061185
606 Ga0070661_100126523
607 Ga0070668_100001336
608 Ga0070668_100005107
609 Ga0070668_100019637
610 Ga0070668_100028523
611 Ga0070669_100022424
612 Ga0070669_100028373
613 Ga0070669_100055411
614 Ga0070671_100114959
615 Ga0070659_100212753
616 Ga0070667_100000062
617 Ga0070667_100000195
618 Ga0070663_100052471
619 Ga0070663_100590755
620 Ga0070662_100080675
621 Ga0070662_101283154
622 Ga0070685_10025294
623 Ga0068853_100057594
624 Ga0068853_100393282
625 Ga0070665_100001120
626 Ga0070665_100702992
627 Ga0068855_100040340
628 Ga0068855_100321773
629 Ga0068855_100498095
630 Ga0070664_100075897
631 Ga0068857_100034972
632 Ga0068857_100307270
633 Ga0068854_100018351
634 Ga0068854_100120760
635 Ga0068856_100047754
636 Ga0068852_100001556
637 Ga0068859_100048969
638 Ga0068864_100000088
639 Ga0068864_100132283
640 Ga0068861_100026356
641 Ga0068851_10218629
642 Ga0068863_100000016
643 Ga0068863_100000054
644 Ga0068860_100000168
645 Ga0068860_100000284
646 Ga0068860_100018339
647 Ga0068862_100011038
648 Ga0068862_100236778
649 Ga0075368_10000072
650 Ga0075368_10000110
651 Ga0075363_100000003
652 Ga0075363_100010361
653 Ga0075364_10000536
654 Ga0075362_10000048
655 Ga0075367_10000060
656 Ga0075367_10000121
657 Ga0075369_10000658
658 Ga0075366_10023707
659 Ga0075366_10046391
660 Ga0075366_10138025
661 Ga0075370_10007829
662 Ga0075370_10053931
663 Ga0097620_100048968
664 Ga0099826_10191341
665 Ga0105251_10113816
666 Ga0105240_10008865
667 Ga0105240_10016433
668 Ga0105240_10514901
669 Ga0105243_10471340
670 Ga0105241_10010587
671 Ga0105242_11267554
672 Ga0105248_10050467
673 Ga0105248_10061725
674 Ga0105248_10910580
675 Ga0105237_10021790
676 Ga0105238_10162188
677 Ga0105238_10210568
678 Ga0105238_11479457
679 Ga0105249_10386795
680 Ga0105249_10490351
681 Ga0105148_100031
682 Ga0105239_10001630
683 Ga0105246_11339301
684 Ga0157371_10076545
685 Ga0157370_10046826
686 Ga0157370_10664947
687 Ga0157369_10064755
688 Ga0157369_10252886
689 Ga0157374_10721522
690 Ga0157378_10001980
691 Ga0163162_10065679
692 Ga0157372_10432581
693 Ga0157375_11041419
694 Ga0157380_10000976
695 Ga0157380_10013963
696 Ga0163161_10104155
697 Ga0163161_10112078
698 Ga0163161_10170207
699 Ga0206356_11335779
700 Ga0206349_1066120
701 Ga0206355_1538906
702 Ga0206351_10972283
703 Ga0206352_10880385
704 Ga0206354_11150845
705 Ga0154015_1405376
706 Ga0209147_100926
707 Ga0209147_101263
708 Ga0207425_1000073
709 Ga0207425_1000095
710 Ga0207425_1012800
711 Ga0209129_1000435
712 Ga0209129_1001494
713 Ga0209565_1000008
714 Ga0209565_1000010
715 Ga0209565_1000062
716 Ga0209565_1000206
717 Ga0209565_1026100
718 Ga0209673_1001509
719 Ga0209673_1006714
720 Ga0209673_1028751
721 Ga0209673_1038661
722 Ga0209675_1016592
723 Ga0209675_1021346
724 Ga0209675_1064216
725 Ga0209676_1000288
726 Ga0209676_1000588
727 Ga0209676_1001454
728 Ga0209025_1000202
729 Ga0209025_1000421
730 Ga0209564_1000378
731 Ga0209564_1001476
732 Ga0209564_1006959
733 Ga0209758_1000019
734 Ga0209758_1000242
735 Ga0209758_1002052
736 Ga0209758_1008054
737 Ga0209758_1021546
738 Ga0209758_1029035
739 Ga0209050_1000001
740 Ga0209050_1000619
741 Ga0209050_1002682
742 Ga0209050_1003221
743 Ga0209050_1006051
744 Ga0209256_1000009
745 Ga0209256_1000010
746 Ga0209256_1000293
747 Ga0207426_1028300
748 Ga0207426_1059224
749 Ga0209051_1000193
750 Ga0209051_1000209
751 Ga0209051_1003122
752 Ga0209051_1035551
753 Ga0209257_1000111
754 Ga0209257_1000551
755 Ga0209257_1001505
756 Ga0209257_1001533
757 Ga0209257_1001950
758 Ga0209257_1005579
759 Ga0209257_1008081
760 Ga0209257_1084734
761 Ga0207656_10120580
762 Ga0207713_1075333
763 Ga0207680_10011928
764 Ga0207647_10039943
765 Ga0207705_10051672
766 Ga0207654_10212672
767 Ga0207695_10012916
768 Ga0207695_10058776
769 Ga0207671_10004540
770 Ga0207671_10256428
771 Ga0207657_10016794
772 Ga0207681_10019166
773 Ga0207681_10039619
774 Ga0207694_10085891
775 Ga0207694_10259529
776 Ga0207650_10015123
777 Ga0207690_10073383
778 Ga0207706_10029825
779 Ga0207706_10887088
780 Ga0207711_10095352
781 Ga0207711_10139966
782 Ga0207711_10249746
783 Ga0207661_10509935
784 Ga0207667_10105802
785 Ga0207667_10270753
786 Ga0207712_10018015
787 Ga0207712_10225421
788 Ga0207712_10828726
789 Ga0207668_10000924
790 Ga0207668_10001714
791 Ga0207668_10038877
792 Ga0207668_10079978
793 Ga0207640_10012692
794 Ga0207640_10132772
795 Ga0207640_10924260
796 Ga0207658_10000039
797 Ga0207658_10000279
798 Ga0207639_10001103
799 Ga0207639_10003148
800 Ga0207639_10207004
801 Ga0207639_10325529
802 Ga0207639_11276231
803 Ga0207678_10013773
804 Ga0207678_10143631
805 Ga0207702_10031905
806 Ga0207641_10000095
807 Ga0207641_10000315
808 Ga0207641_10011272
809 Ga0207676_10000146
810 Ga0207676_10557578
811 Ga0207674_10000748
812 Ga0207674_10348765
813 Ga0207675_100111951
814 Ga0207698_10027801
815 Ga0207698_10031490
816 Ga0209371_1042637
817 Ga0209282_1205568
818 Ga0209813_10000018
819 Ga0209813_10000070
820 Ga0268266_10004104
821 Ga0268266_10015509
822 Ga0268266_10378504
823 Ga0268265_10249775
824 Ga0268265_10602618
825 Ga0268264_10000040
826 Ga0268264_10000337
827 Ga0268264_10006874
828 Ga0268264_11223732
829 Ga0265338_10373704
830 Ga0268256_1048230
831 Ga0265331_10043123
832 Ga0307408_100049519
833 Ga0307408_100105106
834 Ga0307405_10045470
835 Ga0307405_10230287
836 Ga0307405_10457219
837 Ga0307413_10028648
838 Ga0307413_10217660
839 Ga0307413_10382340
840 Ga0307413_10610252
841 Ga0307410_10147209
842 Ga0307406_10150356
843 Ga0307406_10550010
844 Ga0307407_10227774
845 Ga0307412_10044068
846 Ga0307412_10055930
847 Ga0307412_10110948
848 Ga0307412_10210710
849 Ga0307412_10989597
850 Ga0307412_11333108
851 Ga0307409_100080191
852 Ga0307409_100269579
853 Ga0307409_100722406
854 Ga0307416_100115728
855 Ga0307416_100183320
856 Ga0307416_101054622
857 Ga0307416_101727726
858 Ga0307414_10071381
859 Ga0307414_10894099
860 Ga0307411_10118637
861 Ga0307411_10254232
862 Ga0307411_10615948
863 Ga0307411_11004862
864 Ga0307415_100660734
865 Ga0237819_01265
866 Ga0439436_0025403
867 Ga0439439_0040776
868 Ga0439461_0000552
869 Ga0439461_0049546
870 Ga0439465_0000182
871 Ga0439465_0001027
872 Ga0451791_1112956
873 Ga0451793_0250625
874 Ga0451802_1705853
875 Ga0451837_0324922
876 Ga0451843_1101219
877 Ga0439431_0001452
878 Ga0439431_0005865
879 Ga0439445_0012307
880 Ga0439445_0012778
881 Ga0439445_0022655
882 Ga0439445_0175612
883 Ga0439432_000375
884 Ga0439449_0038369
885 Ga0439452_062964
886 Ga0439457_042048
887 Ga0439462_0002527
888 Ga0439462_0013022
889 Ga0450912_001740
890 Ga0450920_025405
891 Ga0450898_114462
892 Ga0439446_0068365
893 Ga0439434_0000263
894 Ga0439434_0009302
895 Ga0495617_129675
896 Ga0495627_053212
897 Ga0495627_126914
898 Ga0495638_0086197
899 Ga0495638_0086228
900 Ga0495638_0453740
901 Ga0495650_0096049
902 Ga0495596_0000543
903 Ga0495607_0105495
904 Ga0495583_0000054
905 Ga0495583_0000236
906 Ga0495583_0035686
907 Ga0495583_0102652
908 Ga0495606_0002566
909 Ga0495606_0050205
910 Ga0495606_0067017
911 Ga0495610_0001035
912 Ga0495610_0017208
913 Ga0495616_0000066
914 Ga0495632_0000722
915 Ga0495637_0000036
916 Ga0495643_0000037
917 Ga0495643_0042862
918 Ga0495648_0011837
919 Ga0495663_0000001
920 Ga0495663_0057764
921 Ga0495663_0122722
922 Ga0495654_0000418
923 Ga0495598_0040021
924 Ga0495609_0005526
925 Ga0495621_0166950
926 Ga0495597_0070616
927 Ga0495633_0000179
928 Ga0495633_0045861
929 Ga0495633_0073804
930 Ga0495633_0125959
931 Ga0495668_0002154
932 Ga0495668_0023152
933 Ga0495668_0073891
934 Ga0495625_0052732
935 Ga0495625_0061678
936 Ga0495625_0178734
937 Ga0495670_0000034
938 Ga0495671_0000004
939 Ga0495671_0000025
940 Ga0495671_0000045
941 Ga0495671_0020076
942 Ga0495671_0197582
943 Ga0495673_0000021
944 Ga0495673_0000063
945 Ga0495673_0094367
946 Ga0495681_0000036
947 Ga0495686_0000245
948 Ga0495686_0001354
949 Ga0495686_0001864
950 Ga0495686_0260660
951 Ga0495686_0394604
952 Ga0495626_0004465
953 Ga0496101_0653397
954 Ga0496104_0111336
955 Ga0496108_0003893
956 Ga0496109_0070619
957 Ga0496111_0269522
958 Ga0496113_0031380
959 Ga0496116_0000976
960 Ga0496116_0024603
961 Ga0496117_0005672
962 Ga0496117_0086754
963 Ga0496118_0003499
964 Ga0496118_0019597
965 Ga0496118_0031285
966 Ga0496118_0173579
967 Ga0496118_0187908
968 Ga0496119_0255290
969 Ga0496119_0261067
970 Ga0496120_0047341
971 Ga0496120_0110482
972 Ga0496120_0290027
973 Ga0496121_0002091
974 Ga0496121_0004175
975 Ga0496121_0005584
976 Ga0496121_0014298
977 Ga0496121_0028465
978 Ga0496122_0000094
979 Ga0496122_0004599
980 Ga0496122_0267232
981 Ga0496122_0375015
982 Ga0496122_0478206
983 Ga0496123_0000626
984 Ga0496123_0011325
985 Ga0496123_0123699
986 Ga0496123_0229462
987 Ga0496123_0255524
988 Ga0496123_0333982
989 Ga0496124_0007774
990 Ga0496124_0011656
991 Ga0496124_0012526
992 Ga0496124_0024753
993 Ga0496124_0028123
994 Ga0496124_0047335
995 Ga0496124_0152327
996 Ga0496124_0863429
997 Ga0496125_0015761
998 Ga0496125_0026092
999 Ga0496125_0030376
1000 Ga0496125_0031310
1001 Ga0496125_0031816
1002 Ga0496125_0054551
1003 Ga0496125_0156750
1004 Ga0496125_0253650
1005 Ga0496126_0000517
1006 Ga0496126_0057729
1007 Ga0496126_0292503
1008 Ga0495678_054690
1009 Ga0501335_004394
1010 Ga0501034_0001122
1011 Ga0501043_0013634
1012 Ga0501206_010182
1013 Ga0501211_001557
1014 Ga0501223_000084
1015 Ga0501235_099629
1016 Ga0501242_032367
1017 Ga0501255_009650
1018 Ga0501221_029127
1019 Ga0501225_0000044
1020 Ga0501225_0000352
1021 Ga0501225_0019805
1022 Ga0501281_02702
1023 nmdc:mga03683_45_c1
1024 nmdc:mga03n38_24821_c1
1025 nmdc:mga03n38_2_c1
1026 nmdc:mga00v17_20_c1
1027 nmdc:mga00v17_324461_c1
1028 nmdc:mga0k408_17584_c1
1029 nmdc:mga0k408_19280_c1
1030 nmdc:mga0k408_19601_c1
1031 nmdc:mga06z11_29_c1
1032 nmdc:mga06z11_88_c1
1033 nmdc:mga04h51_51_c1
1034 nmdc:mga04h51_68_c1
1035 nmdc:mga07m45_22189_c1
1036 nmdc:mga07m45_24_c1
1037 nmdc:mga07m45_464050_c1
1038 nmdc:mga0sz30_160_c1
1039 Ga0500643_000226
1040 Ga0500643_000244
1041 Ga0500643_002018
1042 Ga0500643_002028
1043 Ga0500641_0002276
1044 Ga0500650_0004187
1045 Ga0500650_0160476
1046 Ga0500556_0000025
1047 Ga0500556_0224731
1048 Ga0500562_011424
1049 Ga0500617_075937
1050 Ga0500642_0000001
1051 Ga0500658_0000261
1052 Ga0500559_0002494
1053 Ga0500568_0077195
1054 Ga0500568_0120288
1055 Ga0500568_0160261
1056 Ga0500577_0047417
1057 Ga0500604_0003011
1058 Ga0500604_0064853
1059 Ga0500616_0014942
1060 Ga0500616_0017837
1061 Ga0500622_0000356
1062 Ga0500622_0271135
1063 Ga0500627_0000174
1064 Ga0500627_0000816
1065 Ga0500627_0263600
1066 Ga0500611_002336
1067 Ga0500611_014200
1068 Ga0500645_000299
1069 Ga0500645_001285
1070 Ga0500587_002876
1071 Ga0500661_000080
1072 Ga0587098_009775

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01814

Hemerythrin

Hemerythrin HHE cation binding domain

47

158

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u3l-assembly1.cif.gz_A crystal structure of hemerythrin hhe cation binding domain-containing protein: rv2633c homolog from mycobacterium kansasii 0.7988 8 157
6u3l-assembly1.cif.gz_A crystal structure of hemerythrin hhe cation binding domain-containing protein: rv2633c homolog from mycobacterium kansasii 0.7417 8 157
3waq-assembly1.cif.gz_A hemerythrin-like domain of dcrh i119e mutant (met) 0.7091 13 131
4xpw-assembly1.cif.gz_A crystal structures of leu114f mutant 0.6468 1 130
4xpx-assembly1.cif.gz_A crystal structure of hemerythrin:wild-type 0.6443 1 130
ID Description Score Start End Superfamily
af_Q9URY9_21_165_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.8763 5 145 1.20.120.520
af_Q9URY9_21_165_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.8482 5 145 1.20.120.520
af_P9WL59_1_138_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.7721 8 144 1.20.120.520
af_P9WL59_1_138_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.7575 8 144 1.20.120.520
af_Q5N7H0_149_347_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.6659 12 154 1.20.120.520
ID Description Score Start End GO Terms
AF-A0A521SMD0-F1-model_v4 deleted 0.994 42 170
AF-A0A519KSD0-F1-model_v4 Hemerythrin domain-containing protein 0.9934 8 134
AF-G2IL40-F1-model_v4 Hemerythrin-like domain-containing protein 0.9907 1 170
AF-A0A6G7ZDW5-F1-model_v4 Hemerythrin domain-containing protein 0.9904 8 168
AF-A0A7W7F7Q7-F1-model_v4 Hemerythrin-like domain-containing protein 0.9898 5 170

Map