F460975

General Info

Members Datasets Scaffolds Average Seq Length
538 330 1076 87

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10245041|rootH2_102450412
Length 99
Sequence LRSGKIDEENAVATGWAGDGAVQDQIDATVHDAVMRAKNNLPTGPSLTHCEECQAEIPEARRVAMPGVHLCVTCQEHHDRETQNFSGYNRRGSKDSQLR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
159 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
168 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
169 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
182 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
183 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
198 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
201 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
202 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
207 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
208 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
209 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
210 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
211 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
212 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
213 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
214 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
215 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
216 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
288 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
289 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
290 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
291 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
292 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
293 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
297 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
298 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
299 2636415599 Klebsiella variicola DX120E Isolate Unclassified
300 2643221559 Lysobacter sp. Root559 Isolate Unclassified
301 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
302 2643221586 Lysobacter sp. Root667 Isolate Unclassified
303 2643221612 Lysobacter sp. Root76 Isolate Unclassified
304 2643221727 Lysobacter sp. Root96 Isolate Unclassified
305 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
306 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
307 2775507074 Klebsiella sp. D5A Isolate Unclassified
308 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
309 2818991457 Xanthomonas translucens 569 Isolate Unclassified
310 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
311 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
312 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
313 2884411467 Dyella sp. AD56 Isolate Rhizosphere
314 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
315 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
316 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
317 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
318 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
319 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
320 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
321 2952252522 Salinicola sp. DM10 Isolate Unclassified
322 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
323 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
324 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
325 640753048 Serratia proteamaculans 568 Isolate Endosphere
326 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
327 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
328 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
329 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
330 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.75
Metatranscriptomes 0.93
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 6.13
Nodule 0.37
Rhizoplane 2.42
Rhizosphere 79.93
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10245041 3300003320 Bacteria 1096
2 SwRhRL3b_contig_859695 2162886006 Bacteria 1823
3 SwRhRL2b_contig_1363613 2162886007 Bacteria 2227
4 JGI24737J22298_10089389 3300001990 Bacteria 914
5 JGI24735J21928_10003683 3300002067 Bacteria 5194
6 rootH2_10131900 3300003320 Bacteria 1641
7 Ga0055536_1000970 3300003781 Bacteria 18283
8 Ga0055536_1011213 3300003781 Bacteria 3465
9 Ga0055530_10000993 3300003791 Bacteria 22741
10 Ga0055531_10013615 3300003794 Bacteria 3734
11 Ga0055531_10048434 3300003794 Bacteria 1146
12 Ga0058692_1000055 3300003856 Bacteria 105550
13 Ga0065704_10071085 3300005289 Bacteria 13278
14 Ga0065715_10967946 3300005293 Bacteria 544
15 Ga0065707_10082037 3300005295 Bacteria 23924
16 Ga0065707_10083710 3300005295 Bacteria 8403
17 Ga0070658_11023626 3300005327 Bacteria 718
18 Ga0070670_100004160 3300005331 Bacteria 12104
19 Ga0070670_100202268 3300005331 Bacteria 1726
20 Ga0070670_101595674 3300005331 Bacteria 600
21 Ga0068869_100053188 3300005334 Bacteria 2942
22 Ga0070666_10065753 3300005335 Bacteria 2460
23 Ga0070666_10182935 3300005335 Bacteria 1470
24 Ga0070682_100072394 3300005337 Bacteria 2209
25 Ga0068868_100118245 3300005338 Bacteria 2160
26 Ga0068868_100521948 3300005338 Bacteria 1043
27 Ga0070689_100098231 3300005340 Bacteria 2316
28 Ga0070691_10123409 3300005341 Bacteria 1306
29 Ga0070692_10331493 3300005345 Bacteria 939
30 Ga0070668_100411904 3300005347 Bacteria 1156
31 Ga0070668_101185923 3300005347 Unclassified 691
32 Ga0070668_101533488 3300005347 Bacteria 609
33 Ga0070669_100076573 3300005353 Bacteria 2483
34 Ga0070669_100217975 3300005353 Bacteria 1508
35 Ga0070675_100040018 3300005354 Bacteria 3826
36 Ga0070671_100001380 3300005355 Bacteria 18139
37 Ga0070674_100064798 3300005356 Bacteria 2562
38 Ga0070673_100020751 3300005364 Bacteria 4744
39 Ga0070688_100032930 3300005365 Bacteria 3130
40 Ga0070688_100671076 3300005365 Bacteria 800
41 Ga0070667_100077067 3300005367 Bacteria 2847
42 Ga0070713_101603764 3300005436 Bacteria 632
43 Ga0070700_100232517 3300005441 Bacteria 1313
44 Ga0070678_100073688 3300005456 Bacteria 2563
45 Ga0070662_100290273 3300005457 Bacteria 1326
46 Ga0068867_100041432 3300005459 Bacteria 3366
47 Ga0068867_100055110 3300005459 Bacteria 2939
48 Ga0070685_10252352 3300005466 Bacteria 1169
49 Ga0070679_100017777 3300005530 Bacteria 6884
50 Ga0070679_100045539 3300005530 Bacteria 4371
51 Ga0068853_100726574 3300005539 Bacteria 948
52 Ga0070672_100104839 3300005543 Bacteria 2298
53 Ga0070672_100221160 3300005543 Bacteria 1588
54 Ga0070686_100057119 3300005544 Bacteria 2506
55 Ga0070686_100101699 3300005544 Bacteria 1943
56 Ga0070665_100054361 3300005548 Bacteria 4016
57 Ga0070665_100123241 3300005548 Bacteria 2594
58 Ga0070665_100364906 3300005548 Bacteria 1450
59 Ga0070665_101292238 3300005548 Bacteria 740
60 Ga0070665_101901222 3300005548 Bacteria 601
61 Ga0068855_100074335 3300005563 Bacteria 3948
62 Ga0068855_101698437 3300005563 Bacteria 644
63 Ga0068855_102517679 3300005563 Bacteria 512
64 Ga0070664_101347100 3300005564 Bacteria 674
65 Ga0068857_101698805 3300005577 Bacteria 617
66 Ga0068854_100033542 3300005578 Bacteria 3580
67 Ga0068856_100041848 3300005614 Bacteria 4504
68 Ga0068856_102547393 3300005614 Bacteria 518
69 Ga0068852_100392849 3300005616 Bacteria 1363
70 Ga0068852_101049734 3300005616 Bacteria 834
71 Ga0068859_100001453 3300005617 Bacteria 24054
72 Ga0068859_100713974 3300005617 Bacteria 1093
73 Ga0068859_101670018 3300005617 Bacteria 704
74 Ga0068864_100163574 3300005618 Bacteria 2024
75 Ga0068864_102274242 3300005618 Bacteria 549
76 Ga0068861_100000904 3300005719 Bacteria 18021
77 Ga0068861_100157462 3300005719 Bacteria 1870
78 Ga0068861_100223257 3300005719 Bacteria 1593
79 Ga0068861_100790355 3300005719 Bacteria 890
80 Ga0068870_10181253 3300005840 Bacteria 1264
81 Ga0068863_100005193 3300005841 Bacteria 12847
82 Ga0068863_100094897 3300005841 Bacteria 2831
83 Ga0068863_100229123 3300005841 Bacteria 1792
84 Ga0068863_102005194 3300005841 Bacteria 589
85 Ga0068858_100001329 3300005842 Bacteria 25527
86 Ga0068858_100062404 3300005842 Bacteria 3445
87 Ga0068860_100012186 3300005843 Bacteria 8470
88 Ga0068860_100181873 3300005843 Bacteria 2032
89 Ga0068860_101040997 3300005843 Bacteria 837
90 Ga0068862_100071800 3300005844 Bacteria 2989
91 Ga0068862_100622121 3300005844 Unclassified 1039
92 Ga0081540_1003092 3300005983 Bacteria 13333
93 Ga0070712_100375695 3300006175 Bacteria 1169
94 Ga0070712_101520287 3300006175 Bacteria 585
95 Ga0097621_100107958 3300006237 Bacteria 2349
96 Ga0097621_100351340 3300006237 Bacteria 1311
97 Ga0097621_100541663 3300006237 Bacteria 1058
98 Ga0097621_100745152 3300006237 Bacteria 904
99 Ga0097621_101107441 3300006237 Bacteria 744
100 Ga0068871_100043575 3300006358 Bacteria 3605
101 Ga0068871_100070677 3300006358 Bacteria 2869
102 Ga0068871_100378886 3300006358 Bacteria 1256
103 Ga0068871_101707333 3300006358 Bacteria 597
104 Ga0075430_100016289 3300006846 Bacteria 6332
105 Ga0075429_100001826 3300006880 Bacteria 17622
106 Ga0068865_100088371 3300006881 Bacteria 2242
107 Ga0068865_100108835 3300006881 Bacteria 2041
108 Ga0068865_100557206 3300006881 Bacteria 963
109 Ga0097620_100001453 3300006931 Bacteria 24054
110 Ga0097620_100713989 3300006931 Bacteria 1093
111 Ga0097620_101669980 3300006931 Bacteria 704
112 Ga0079104_1019822 3300006946 Bacteria 1867
113 Ga0105251_10369950 3300009011 Bacteria 656
114 Ga0105250_10134755 3300009092 Unclassified 1021
115 Ga0105240_10020797 3300009093 Bacteria 8741
116 Ga0105240_10130509 3300009093 Bacteria 3015
117 Ga0111539_10780109 3300009094 Bacteria 1112
118 Ga0105245_10040120 3300009098 Bacteria 4169
119 Ga0105247_10000173 3300009101 Bacteria 63815
120 Ga0114129_10001307 3300009147 Bacteria 33269
121 Ga0105243_10343169 3300009148 Bacteria 1369
122 Ga0105243_12041926 3300009148 Bacteria 608
123 Ga0105242_10015093 3300009176 Bacteria 5994
124 Ga0105242_10059544 3300009176 Bacteria 3134
125 Ga0105248_10088557 3300009177 Bacteria 3484
126 Ga0105248_10500174 3300009177 Bacteria 1370
127 Ga0105248_10772837 3300009177 Bacteria 1084
128 Ga0105237_11035356 3300009545 Bacteria 828
129 Ga0105237_11454168 3300009545 Bacteria 692
130 Ga0105249_10095447 3300009553 Bacteria 2788
131 Ga0105249_10211249 3300009553 Bacteria 1905
132 Ga0105249_10364541 3300009553 Bacteria 1467
133 Ga0105249_11158665 3300009553 Bacteria 844
134 Ga0105239_10746083 3300010375 Bacteria 1120
135 Ga0157370_11226914 3300013104 Bacteria 676
136 Ga0157369_10003548 3300013105 Bacteria 18530
137 Ga0157369_10114420 3300013105 Bacteria 2865
138 Ga0157369_10186208 3300013105 Bacteria 2183
139 Ga0157374_10007594 3300013296 Bacteria 9253
140 Ga0157374_10178227 3300013296 Bacteria 2075
141 Ga0157378_10039081 3300013297 Bacteria 4208
142 Ga0163162_10005422 3300013306 Bacteria 12327
143 Ga0163162_10085655 3300013306 Bacteria 3228
144 Ga0163162_10402679 3300013306 Bacteria 1501
145 Ga0163162_11956208 3300013306 Bacteria 671
146 Ga0157372_10026587 3300013307 Bacteria 6297
147 Ga0157375_10004067 3300013308 Bacteria 12686
148 Ga0157375_10304155 3300013308 Bacteria 1758
149 Ga0157375_10345189 3300013308 Bacteria 1654
150 Ga0163163_10189932 3300014325 Bacteria 2102
151 Ga0163163_11347006 3300014325 Bacteria 775
152 Ga0163163_13252395 3300014325 Bacteria 507
153 Ga0157380_10005230 3300014326 Bacteria 9068
154 Ga0157380_10454427 3300014326 Bacteria 1231
155 Ga0157380_10816708 3300014326 Bacteria 951
156 Ga0157380_11246572 3300014326 Bacteria 789
157 Ga0157380_11331314 3300014326 Bacteria 766
158 Ga0182008_10060436 3300014497 Bacteria 1868
159 Ga0157379_12231870 3300014968 Bacteria 544
160 Ga0157376_10012509 3300014969 Bacteria 6301
161 Ga0157376_10261278 3300014969 Bacteria 1622
162 Ga0157376_12746831 3300014969 Bacteria 532
163 Ga0163161_10077016 3300017792 Bacteria 2449
164 Ga0163161_10574447 3300017792 Bacteria 927
165 Ga0197907_10031805 3300020069 Bacteria 1070
166 Ga0206356_10157927 3300020070 Bacteria 781
167 Ga0206356_11401385 3300020070 Bacteria 683
168 Ga0206349_1138132 3300020075 Bacteria 625
169 Ga0206353_10662671 3300020082 Bacteria 941
170 Ga0209674_100016 3300025226 Bacteria 696756
171 Ga0207427_100117 3300025231 Bacteria 102251
172 Ga0209437_100240 3300025233 Bacteria 89740
173 Ga0209646_1005732 3300025246 Bacteria 2141
174 Ga0209026_1000207 3300025250 Bacteria 81332
175 Ga0209759_1056689 3300025256 Bacteria 571
176 Ga0209233_1000083 3300025261 Bacteria 336016
177 Ga0209233_1000417 3300025261 Bacteria 32180
178 Ga0209455_1000535 3300025272 Bacteria 26363
179 Ga0209130_1006914 3300025284 Bacteria 3592
180 Ga0209675_1009967 3300025291 Bacteria 3294
181 Ga0209676_1000196 3300025292 Bacteria 135726
182 Ga0209676_1001468 3300025292 Bacteria 21920
183 Ga0209676_1002369 3300025292 Bacteria 13564
184 Ga0209676_1002638 3300025292 Bacteria 12223
185 Ga0209025_1040515 3300025294 Bacteria 2013
186 Ga0209564_1003676 3300025295 Bacteria 10130
187 Ga0209564_1050524 3300025295 Bacteria 1017
188 Ga0209050_1001267 3300025298 Bacteria 29081
189 Ga0209256_1001647 3300025299 Bacteria 21722
190 Ga0209051_1017574 3300025303 Bacteria 3192
191 Ga0209257_1000356 3300025304 Bacteria 93656
192 Ga0209257_1002260 3300025304 Bacteria 19684
193 Ga0209257_1063166 3300025304 Bacteria 999
194 Ga0207697_10414252 3300025315 Bacteria 598
195 Ga0207682_10002667 3300025893 Bacteria 7948
196 Ga0207642_10249906 3300025899 Bacteria 1006
197 Ga0207710_10000666 3300025900 Bacteria 19351
198 Ga0207680_10058161 3300025903 Bacteria 2342
199 Ga0207680_10142508 3300025903 Bacteria 1590
200 Ga0207680_10290828 3300025903 Bacteria 1137
201 Ga0207647_10053567 3300025904 Bacteria 2485
202 Ga0207645_10145355 3300025907 Bacteria 1546
203 Ga0207645_11065424 3300025907 Bacteria 546
204 Ga0207643_10005180 3300025908 Bacteria 6972
205 Ga0207695_10665359 3300025913 Bacteria 922
206 Ga0207671_10382900 3300025914 Bacteria 1118
207 Ga0207671_10844770 3300025914 Bacteria 725
208 Ga0207663_10005990 3300025916 Bacteria 6182
209 Ga0207660_10175567 3300025917 Bacteria 1661
210 Ga0207681_10218612 3300025923 Bacteria 1473
211 Ga0207694_10349512 3300025924 Bacteria 1224
212 Ga0207650_10062181 3300025925 Bacteria 2789
213 Ga0207650_10158305 3300025925 Bacteria 1792
214 Ga0207650_10200945 3300025925 Bacteria 1597
215 Ga0207659_10124650 3300025926 Bacteria 1979
216 Ga0207659_11311859 3300025926 Bacteria 621
217 Ga0207687_10129410 3300025927 Bacteria 1900
218 Ga0207700_11274102 3300025928 Bacteria 655
219 Ga0207644_10004431 3300025931 Bacteria 9113
220 Ga0207644_11213184 3300025931 Bacteria 634
221 Ga0207706_10139977 3300025933 Bacteria 2129
222 Ga0207706_10156871 3300025933 Bacteria 2001
223 Ga0207686_10026819 3300025934 Bacteria 3366
224 Ga0207686_10062876 3300025934 Bacteria 2359
225 Ga0207670_10111926 3300025936 Bacteria 1969
226 Ga0207669_10613784 3300025937 Bacteria 885
227 Ga0207704_10019984 3300025938 Bacteria 3532
228 Ga0207704_10089159 3300025938 Bacteria 2020
229 Ga0207704_10207107 3300025938 Bacteria 1440
230 Ga0207704_11664913 3300025938 Bacteria 548
231 Ga0207691_10064050 3300025940 Bacteria 3332
232 Ga0207711_10113149 3300025941 Bacteria 2416
233 Ga0207711_10614322 3300025941 Bacteria 1014
234 Ga0207689_10047696 3300025942 Bacteria 3534
235 Ga0207679_11844793 3300025945 Bacteria 552
236 Ga0207667_10448962 3300025949 Bacteria 1310
237 Ga0207651_10044633 3300025960 Bacteria 2968
238 Ga0207712_10019704 3300025961 Bacteria 4408
239 Ga0207712_10042121 3300025961 Bacteria 3142
240 Ga0207712_10601830 3300025961 Bacteria 951
241 Ga0207668_10364515 3300025972 Bacteria 1212
242 Ga0207640_10193977 3300025981 Bacteria 1533
243 Ga0207640_10902652 3300025981 Bacteria 772
244 Ga0207658_10004450 3300025986 Bacteria 9742
245 Ga0207658_10364542 3300025986 Bacteria 1262
246 Ga0207658_11362096 3300025986 Bacteria 649
247 Ga0207677_10007213 3300026023 Bacteria 6128
248 Ga0207677_11979991 3300026023 Bacteria 541
249 Ga0207677_12008107 3300026023 Unclassified 538
250 Ga0207703_10000855 3300026035 Bacteria 29877
251 Ga0207703_10904714 3300026035 Bacteria 845
252 Ga0207639_10681611 3300026041 Bacteria 953
253 Ga0207678_10006781 3300026067 Bacteria 10151
254 Ga0207678_10618807 3300026067 Bacteria 950
255 Ga0207708_10243051 3300026075 Bacteria 1448
256 Ga0207702_10374878 3300026078 Bacteria 1367
257 Ga0207702_11158382 3300026078 Bacteria 767
258 Ga0207641_10064577 3300026088 Bacteria 3129
259 Ga0207641_10828004 3300026088 Bacteria 916
260 Ga0207641_11745301 3300026088 Bacteria 624
261 Ga0207641_12626015 3300026088 Bacteria 501
262 Ga0207648_10014132 3300026089 Bacteria 7383
263 Ga0207648_10091881 3300026089 Bacteria 2654
264 Ga0207676_10214421 3300026095 Bacteria 1710
265 Ga0207676_10495252 3300026095 Bacteria 1160
266 Ga0207674_12198847 3300026116 Bacteria 515
267 Ga0207675_100010773 3300026118 Bacteria 8568
268 Ga0207675_100019991 3300026118 Bacteria 6248
269 Ga0207675_100188519 3300026118 Bacteria 1977
270 Ga0207675_100308367 3300026118 Bacteria 1543
271 Ga0207675_100456389 3300026118 Bacteria 1267
272 Ga0207683_10098943 3300026121 Bacteria 2603
273 Ga0207683_10391788 3300026121 Bacteria 1277
274 Ga0207698_11060015 3300026142 Bacteria 822
275 Ga0207698_12169898 3300026142 Bacteria 568
276 Ga0207698_12227785 3300026142 Bacteria 560
277 Ga0209281_1012480 3300027111 Bacteria 1864
278 Ga0209371_1000075 3300027312 Bacteria 196676
279 Ga0268266_10045112 3300028379 Bacteria 3770
280 Ga0268266_10310249 3300028379 Bacteria 1474
281 Ga0268266_10331544 3300028379 Bacteria 1426
282 Ga0268266_10988078 3300028379 Bacteria 814
283 Ga0268265_10228255 3300028380 Bacteria 1634
284 Ga0268265_10239976 3300028380 Bacteria 1599
285 Ga0268265_10730565 3300028380 Unclassified 959
286 Ga0268264_10014540 3300028381 Bacteria 6466
287 Ga0268264_10061954 3300028381 Bacteria 3140
288 Ga0268264_10800077 3300028381 Bacteria 942
289 Ga0268264_11163249 3300028381 Bacteria 781
290 Ga0265319_1048759 3300028563 Bacteria 1405
291 Ga0265334_10000089 3300028573 Bacteria 65336
292 Ga0265318_10010901 3300028577 Bacteria 3938
293 Ga0265338_10007138 3300028800 Bacteria 13985
294 Ga0265324_10104971 3300029957 Bacteria 960
295 Ga0268256_1000068 3300030500 Bacteria 196676
296 Ga0307511_10000112 3300030521 Bacteria 73319
297 Ga0307511_10060866 3300030521 Bacteria 2884
298 Ga0265330_10002999 3300031235 Bacteria 8979
299 Ga0265330_10463576 3300031235 Unclassified 538
300 Ga0265332_10004069 3300031238 Bacteria 6938
301 Ga0265332_10183024 3300031238 Bacteria 872
302 Ga0265328_10245454 3300031239 Bacteria 685
303 Ga0265320_10199525 3300031240 Bacteria 893
304 Ga0265325_10001937 3300031241 Bacteria 14276
305 Ga0265339_10054812 3300031249 Bacteria 2164
306 Ga0265339_10108665 3300031249 Bacteria 1437
307 Ga0265331_10060184 3300031250 Bacteria 1794
308 Ga0265327_10000027 3300031251 Bacteria 364541
309 Ga0265316_10436333 3300031344 Unclassified 940
310 Ga0307513_10055934 3300031456 Bacteria 4218
311 Ga0307513_11108846 3300031456 Unclassified 504
312 Ga0307408_100272797 3300031548 Bacteria 1405
313 Ga0265313_10019234 3300031595 Bacteria 3809
314 Ga0307508_10312605 3300031616 Bacteria 1163
315 Ga0307508_10549218 3300031616 Bacteria 753
316 Ga0316575_10174474 3300031665 Bacteria 892
317 Ga0265314_10014486 3300031711 Bacteria 6304
318 Ga0265314_10205592 3300031711 Unclassified 1160
319 Ga0265342_10012744 3300031712 Bacteria 5680
320 Ga0265342_10018193 3300031712 Bacteria 4558
321 Ga0316576_10645674 3300031727 Bacteria 770
322 Ga0316576_10756393 3300031727 Bacteria 701
323 Ga0316576_10907942 3300031727 Bacteria 630
324 Ga0316578_10110274 3300031728 Bacteria 1652
325 Ga0307516_10021678 3300031730 Bacteria 6606
326 Ga0307413_10993479 3300031824 Bacteria 719
327 Ga0307410_10148771 3300031852 Bacteria 1741
328 Ga0307406_10395120 3300031901 Bacteria 1094
329 Ga0307406_10703895 3300031901 Bacteria 844
330 Ga0307407_10243223 3300031903 Bacteria 1229
331 Ga0307412_11658496 3300031911 Bacteria 585
332 Ga0307412_12189446 3300031911 Bacteria 514
333 Ga0307409_100401395 3300031995 Bacteria 1309
334 Ga0307416_101529984 3300032002 Bacteria 773
335 Ga0307411_10139084 3300032005 Bacteria 1788
336 Ga0307411_11111043 3300032005 Bacteria 713
337 Ga0316580_10016325 3300032139 Bacteria 2278
338 Ga0373938_0172900 3300034957 Bacteria 586
339 Ga0373936_0002456 3300035113 Bacteria 6934
340 Ga0316574_0018957 3300035398 Bacteria 4052
341 Ga0316574_0992750 3300035398 Bacteria 505
342 Ga0316582_0087525 3300036647 Bacteria 2044
343 Ga0316584_0137508 3300036712 Bacteria 1823
344 Ga0395898_0174813 3300037466 Bacteria 2052
345 Ga0395905_0055313 3300037471 Bacteria 3714
346 Ga0395901_0008721 3300038443 Bacteria 10247
347 Ga0451791_0330967 3300041451 Bacteria 1163
348 Ga0451797_0525625 3300041453 Bacteria 1122
349 Ga0451839_0926928 3300041496 Bacteria 807
350 Ga0451841_0143415 3300041498 Bacteria 953
351 Ga0451841_1299822 3300041498 Bacteria 776
352 Ga0451845_0161850 3300041501 Bacteria 554
353 Ga0451849_0461382 3300041505 Bacteria 1222
354 Ga0451849_0957858 3300041505 Bacteria 584
355 Ga0451851_0438943 3300041507 Bacteria 700
356 Ga0451843_1222740 3300041509 Bacteria 809
357 Ga0451843_1529574 3300041509 Bacteria 930
358 Ga0439452_010484 3300042010 Bacteria 2693
359 Ga0450906_044706 3300042145 Bacteria 782
360 Ga0439460_0215589 3300042461 Bacteria 657
361 Ga0451577_0015537 3300042876 Bacteria 7080
362 Ga0466969_0032559 3300044656 Bacteria 2650
363 Ga0466972_0188148 3300044658 Bacteria 968
364 Ga0466966_0010105 3300044684 Bacteria 6261
365 Ga0453684_0010616 3300044712 Bacteria 15699
366 Ga0453684_1315259 3300044712 Bacteria 753
367 Ga0466970_0931331 3300044765 Bacteria 511
368 Ga0466959_0002148 3300045049 Bacteria 12507
369 Ga0466959_0042999 3300045049 Bacteria 3332
370 Ga0451576_2630017 3300045051 Bacteria 513
371 Ga0495638_0078582 3300046460 Bacteria 2007
372 Ga0495638_0440958 3300046460 Bacteria 667
373 Ga0495650_0016936 3300046471 Bacteria 3668
374 Ga0495650_0199536 3300046471 Bacteria 696
375 Ga0495632_0141625 3300046519 Bacteria 1115
376 Ga0495621_0136370 3300046539 Bacteria 958
377 Ga0495621_0227454 3300046539 Bacteria 757
378 Ga0495633_0040355 3300046558 Bacteria 2224
379 Ga0495625_0028658 3300046660 Bacteria 4173
380 Ga0495625_0045648 3300046660 Bacteria 3166
381 Ga0495657_0620187 3300046675 Bacteria 625
382 Ga0495670_0726387 3300046691 Bacteria 542
383 Ga0495649_0156203 3300046694 Bacteria 1197
384 Ga0495680_0877039 3300047322 Unclassified 581
385 Ga0496100_1479706 3300048903 Bacteria 536
386 Ga0496101_0160462 3300048904 Bacteria 1724
387 Ga0496104_0047693 3300048907 Bacteria 4038
388 Ga0496104_0611785 3300048907 Bacteria 1000
389 Ga0496104_1836392 3300048907 Bacteria 508
390 Ga0496105_0082258 3300048908 Bacteria 2659
391 Ga0496107_0108188 3300048910 Bacteria 2042
392 Ga0496112_0452055 3300048915 Bacteria 1222
393 Ga0496113_0055996 3300048916 Bacteria 2958
394 Ga0496115_0000782 3300048918 Bacteria 23341
395 Ga0496116_0241377 3300048919 Bacteria 907
396 Ga0496117_0001663 3300048920 Bacteria 31146
397 Ga0496118_0031793 3300048921 Bacteria 4365
398 Ga0496118_0035543 3300048921 Bacteria 4043
399 Ga0496118_0114282 3300048921 Bacteria 1780
400 Ga0496119_0000177 3300048922 Bacteria 89166
401 Ga0496119_0001108 3300048922 Bacteria 33950
402 Ga0496119_0350274 3300048922 Bacteria 715
403 Ga0496120_0000188 3300048923 Bacteria 105545
404 Ga0496120_0000328 3300048923 Bacteria 79028
405 Ga0496120_0109591 3300048923 Bacteria 1444
406 Ga0496121_0025636 3300048924 Bacteria 5588
407 Ga0496121_0151460 3300048924 Bacteria 1706
408 Ga0496122_0000209 3300048925 Bacteria 130440
409 Ga0496122_0242202 3300048925 Bacteria 1016
410 Ga0496123_0000106 3300048926 Bacteria 167799
411 Ga0496123_0341377 3300048926 Bacteria 700
412 Ga0496124_0000401 3300048927 Bacteria 79057
413 Ga0496125_0002206 3300048928 Bacteria 25985
414 Ga0496125_0038336 3300048928 Bacteria 4149
415 Ga0496126_0002462 3300048929 Bacteria 24953
416 Ga0495678_230501 3300049459 Bacteria 558
417 Ga0501031_0001097 3300049568 Bacteria 16491
418 Ga0501031_0213687 3300049568 Bacteria 1256
419 Ga0501032_0005261 3300049569 Bacteria 9626
420 Ga0501032_0014161 3300049569 Bacteria 5653
421 Ga0501032_0756536 3300049569 Bacteria 614
422 Ga0501033_0000720 3300049570 Bacteria 30337
423 Ga0501033_0014033 3300049570 Bacteria 6095
424 Ga0501033_0031736 3300049570 Bacteria 3966
425 Ga0501034_0002484 3300049571 Bacteria 22159
426 Ga0501034_0004188 3300049571 Bacteria 16100
427 Ga0501034_0714230 3300049571 Bacteria 900
428 Ga0501034_1252587 3300049571 Bacteria 619
429 Ga0501036_0007244 3300049572 Bacteria 9033
430 Ga0501036_0007930 3300049572 Bacteria 8687
431 Ga0501036_0160322 3300049572 Bacteria 1896
432 Ga0501036_0284259 3300049572 Bacteria 1384
433 Ga0501037_0001245 3300049573 Bacteria 18769
434 Ga0501037_0283164 3300049573 Bacteria 1154
435 Ga0501038_0000673 3300049574 Bacteria 30442
436 Ga0501038_0842244 3300049574 Bacteria 679
437 Ga0501039_0002430 3300049575 Bacteria 13866
438 Ga0501039_0005379 3300049575 Bacteria 9681
439 Ga0501039_0052721 3300049575 Bacteria 3146
440 Ga0501040_0030210 3300049576 Bacteria 3660
441 Ga0501042_0000212 3300049578 Bacteria 27705
442 Ga0501042_0703901 3300049578 Bacteria 735
443 Ga0501043_0003203 3300049579 Bacteria 13541
444 Ga0501043_0014430 3300049579 Bacteria 6182
445 Ga0501043_0028000 3300049579 Bacteria 4422
446 Ga0501043_0088572 3300049579 Bacteria 2432
447 Ga0501046_0002962 3300049580 Bacteria 15706
448 Ga0501046_0013109 3300049580 Bacteria 7036
449 Ga0501046_0013611 3300049580 Bacteria 6880
450 Ga0501047_0005546 3300049581 Bacteria 11875
451 Ga0501047_0034653 3300049581 Bacteria 4874
452 Ga0501047_0107772 3300049581 Bacteria 2668
453 Ga0501047_0208807 3300049581 Bacteria 1811
454 Ga0501048_0069337 3300049582 Bacteria 2490
455 Ga0501048_0095168 3300049582 Bacteria 2100
456 Ga0501067_0009020 3300049583 Bacteria 5528
457 Ga0501067_0041945 3300049583 Bacteria 2541
458 Ga0501067_0233470 3300049583 Bacteria 1024
459 Ga0501069_0055903 3300049585 Bacteria 2198
460 Ga0501069_0126607 3300049585 Bacteria 1461
461 Ga0501070_0056925 3300049586 Bacteria 3241
462 Ga0501070_0059406 3300049586 Bacteria 3170
463 Ga0501070_0138229 3300049586 Bacteria 2011
464 Ga0501070_0227269 3300049586 Bacteria 1529
465 Ga0501071_0008741 3300049587 Bacteria 6704
466 Ga0501071_0095677 3300049587 Bacteria 2185
467 Ga0501072_0071696 3300049588 Bacteria 2737
468 Ga0501073_0016778 3300049589 Bacteria 5306
469 Ga0501073_0050715 3300049589 Bacteria 2907
470 Ga0501073_0989987 3300049589 Bacteria 578
471 Ga0501074_0008025 3300049590 Bacteria 7644
472 Ga0501074_0025724 3300049590 Bacteria 4270
473 Ga0501075_0240312 3300049591 Bacteria 1381
474 Ga0501079_0016173 3300049741 Bacteria 5702
475 Ga0501079_0034570 3300049741 Bacteria 3889
476 Ga0501080_0021473 3300049742 Bacteria 5975
477 Ga0501080_0390689 3300049742 Bacteria 1252
478 Ga0501080_0460279 3300049742 Bacteria 1139
479 Ga0501081_0082346 3300049743 Bacteria 2254
480 Ga0501083_0016466 3300049744 Bacteria 5174
481 Ga0501035_0004344 3300049822 Bacteria 13451
482 Ga0501035_0021681 3300049822 Bacteria 5907
483 Ga0501035_0028763 3300049822 Bacteria 5071
484 Ga0501044_0006784 3300049823 Bacteria 12621
485 Ga0501044_0016545 3300049823 Bacteria 7916
486 Ga0501044_0114223 3300049823 Bacteria 2706
487 Ga0501045_0078084 3300049824 Bacteria 2440
488 Ga0501045_0447055 3300049824 Bacteria 961
489 nmdc:mga05p37_35518_c1 3300050507 Bacteria 6112
490 nmdc:mga09592_1185621_c1 3300050508 Bacteria 632
491 nmdc:mga0qj67_40234_c1 3300050509 Bacteria 3675
492 nmdc:mga0qj67_9876_c1 3300050509 Bacteria 7115
493 Ga0495655_0188233 3300053083 Bacteria 669
494 Ga0500644_0029071 3300053088 Bacteria 1735
495 Ga0500557_102851 3300053105 Bacteria 949
496 Ga0500572_093531 3300053111 Bacteria 955
497 Ga0500591_144680 3300053115 Bacteria 931
498 Ga0500630_070629 3300053159 Bacteria 1652
499 Ga0500639_198171 3300053163 Bacteria 866
500 Ga0501084_0062028 3300054114 Bacteria 3130
501 Ga0501084_0198135 3300054114 Bacteria 1694
502 Ga0501082_0054243 3300060353 Bacteria 3455
503 Ga0501082_0348151 3300060353 Bacteria 1291
504 Ga0530510_0087572 3300061734 Bacteria 2269
505 2508851459 2508501071 Bacteria 5454741
506 2609913705 2609459761 Bacteria 5513740
507 2637226305 2636415599 Bacteria 5718434
508 2643817430 2643221559 Bacteria 4424915
509 2643907924 2643221579 Bacteria 4443405
510 2643938141 2643221586 Bacteria 4446529
511 2644079213 2643221612 Bacteria 4361984
512 2644694657 2643221727 Bacteria 4415595
513 2707101407 2706794495 Bacteria 4536932
514 2738714570 2738541276 Bacteria 4690596
515 2777020378 2775507074 Bacteria 5532402
516 2807179584 2806310673 Bacteria 4801221
517 2819660207 2818991457 Bacteria 5323295
518 2836163947 2836160341 Unclassified 5867367
519 2852684979 2852684882 Bacteria 5463342
520 2857444683 2857442823 Bacteria 4562550
521 2884415486 2884411467 Bacteria 5246714
522 2895396794 2895395659 Bacteria 3983269
523 2904517305 2904513164 Bacteria 5476410
524 2919130520 2919130084 Bacteria 5301837
525 2923518595 2923516293 Bacteria 3716336
526 2929198476 2929195423 Bacteria 5325372
527 2941476747 2941475908 Bacteria 4145589
528 2945878859 2945874760 Bacteria 5527237
529 2952254536 2952252522 Bacteria 4171745
530 2969083284 2969079654 Bacteria 5439582
531 2984560301 2984559226 Bacteria 5683096
532 2984598378 2984595703 Bacteria 5682994
533 640937012 640753048 Bacteria 5495657
534 8003015870 8003014200 Bacteria 4059994
535 8021625614 8021622325 Bacteria 4844743
536 8021626985 8021626552 Bacteria 4665214
537 8021652104 8021648035 Bacteria 4772378
538 8055695393 8055693939 Bacteria 4772047
539 rootH2_10245041
540 SwRhRL3b_contig_859695
541 SwRhRL2b_contig_1363613
542 JGI24737J22298_10089389
543 JGI24735J21928_10003683
544 rootH2_10131900
545 Ga0055536_1000970
546 Ga0055536_1011213
547 Ga0055530_10000993
548 Ga0055531_10013615
549 Ga0055531_10048434
550 Ga0058692_1000055
551 Ga0065704_10071085
552 Ga0065715_10967946
553 Ga0065707_10082037
554 Ga0065707_10083710
555 Ga0070658_11023626
556 Ga0070670_100004160
557 Ga0070670_100202268
558 Ga0070670_101595674
559 Ga0068869_100053188
560 Ga0070666_10065753
561 Ga0070666_10182935
562 Ga0070682_100072394
563 Ga0068868_100118245
564 Ga0068868_100521948
565 Ga0070689_100098231
566 Ga0070691_10123409
567 Ga0070692_10331493
568 Ga0070668_100411904
569 Ga0070668_101185923
570 Ga0070668_101533488
571 Ga0070669_100076573
572 Ga0070669_100217975
573 Ga0070675_100040018
574 Ga0070671_100001380
575 Ga0070674_100064798
576 Ga0070673_100020751
577 Ga0070688_100032930
578 Ga0070688_100671076
579 Ga0070667_100077067
580 Ga0070713_101603764
581 Ga0070700_100232517
582 Ga0070678_100073688
583 Ga0070662_100290273
584 Ga0068867_100041432
585 Ga0068867_100055110
586 Ga0070685_10252352
587 Ga0070679_100017777
588 Ga0070679_100045539
589 Ga0068853_100726574
590 Ga0070672_100104839
591 Ga0070672_100221160
592 Ga0070686_100057119
593 Ga0070686_100101699
594 Ga0070665_100054361
595 Ga0070665_100123241
596 Ga0070665_100364906
597 Ga0070665_101292238
598 Ga0070665_101901222
599 Ga0068855_100074335
600 Ga0068855_101698437
601 Ga0068855_102517679
602 Ga0070664_101347100
603 Ga0068857_101698805
604 Ga0068854_100033542
605 Ga0068856_100041848
606 Ga0068856_102547393
607 Ga0068852_100392849
608 Ga0068852_101049734
609 Ga0068859_100001453
610 Ga0068859_100713974
611 Ga0068859_101670018
612 Ga0068864_100163574
613 Ga0068864_102274242
614 Ga0068861_100000904
615 Ga0068861_100157462
616 Ga0068861_100223257
617 Ga0068861_100790355
618 Ga0068870_10181253
619 Ga0068863_100005193
620 Ga0068863_100094897
621 Ga0068863_100229123
622 Ga0068863_102005194
623 Ga0068858_100001329
624 Ga0068858_100062404
625 Ga0068860_100012186
626 Ga0068860_100181873
627 Ga0068860_101040997
628 Ga0068862_100071800
629 Ga0068862_100622121
630 Ga0081540_1003092
631 Ga0070712_100375695
632 Ga0070712_101520287
633 Ga0097621_100107958
634 Ga0097621_100351340
635 Ga0097621_100541663
636 Ga0097621_100745152
637 Ga0097621_101107441
638 Ga0068871_100043575
639 Ga0068871_100070677
640 Ga0068871_100378886
641 Ga0068871_101707333
642 Ga0075430_100016289
643 Ga0075429_100001826
644 Ga0068865_100088371
645 Ga0068865_100108835
646 Ga0068865_100557206
647 Ga0097620_100001453
648 Ga0097620_100713989
649 Ga0097620_101669980
650 Ga0079104_1019822
651 Ga0105251_10369950
652 Ga0105250_10134755
653 Ga0105240_10020797
654 Ga0105240_10130509
655 Ga0111539_10780109
656 Ga0105245_10040120
657 Ga0105247_10000173
658 Ga0114129_10001307
659 Ga0105243_10343169
660 Ga0105243_12041926
661 Ga0105242_10015093
662 Ga0105242_10059544
663 Ga0105248_10088557
664 Ga0105248_10500174
665 Ga0105248_10772837
666 Ga0105237_11035356
667 Ga0105237_11454168
668 Ga0105249_10095447
669 Ga0105249_10211249
670 Ga0105249_10364541
671 Ga0105249_11158665
672 Ga0105239_10746083
673 Ga0157370_11226914
674 Ga0157369_10003548
675 Ga0157369_10114420
676 Ga0157369_10186208
677 Ga0157374_10007594
678 Ga0157374_10178227
679 Ga0157378_10039081
680 Ga0163162_10005422
681 Ga0163162_10085655
682 Ga0163162_10402679
683 Ga0163162_11956208
684 Ga0157372_10026587
685 Ga0157375_10004067
686 Ga0157375_10304155
687 Ga0157375_10345189
688 Ga0163163_10189932
689 Ga0163163_11347006
690 Ga0163163_13252395
691 Ga0157380_10005230
692 Ga0157380_10454427
693 Ga0157380_10816708
694 Ga0157380_11246572
695 Ga0157380_11331314
696 Ga0182008_10060436
697 Ga0157379_12231870
698 Ga0157376_10012509
699 Ga0157376_10261278
700 Ga0157376_12746831
701 Ga0163161_10077016
702 Ga0163161_10574447
703 Ga0197907_10031805
704 Ga0206356_10157927
705 Ga0206356_11401385
706 Ga0206349_1138132
707 Ga0206353_10662671
708 Ga0209674_100016
709 Ga0207427_100117
710 Ga0209437_100240
711 Ga0209646_1005732
712 Ga0209026_1000207
713 Ga0209759_1056689
714 Ga0209233_1000083
715 Ga0209233_1000417
716 Ga0209455_1000535
717 Ga0209130_1006914
718 Ga0209675_1009967
719 Ga0209676_1000196
720 Ga0209676_1001468
721 Ga0209676_1002369
722 Ga0209676_1002638
723 Ga0209025_1040515
724 Ga0209564_1003676
725 Ga0209564_1050524
726 Ga0209050_1001267
727 Ga0209256_1001647
728 Ga0209051_1017574
729 Ga0209257_1000356
730 Ga0209257_1002260
731 Ga0209257_1063166
732 Ga0207697_10414252
733 Ga0207682_10002667
734 Ga0207642_10249906
735 Ga0207710_10000666
736 Ga0207680_10058161
737 Ga0207680_10142508
738 Ga0207680_10290828
739 Ga0207647_10053567
740 Ga0207645_10145355
741 Ga0207645_11065424
742 Ga0207643_10005180
743 Ga0207695_10665359
744 Ga0207671_10382900
745 Ga0207671_10844770
746 Ga0207663_10005990
747 Ga0207660_10175567
748 Ga0207681_10218612
749 Ga0207694_10349512
750 Ga0207650_10062181
751 Ga0207650_10158305
752 Ga0207650_10200945
753 Ga0207659_10124650
754 Ga0207659_11311859
755 Ga0207687_10129410
756 Ga0207700_11274102
757 Ga0207644_10004431
758 Ga0207644_11213184
759 Ga0207706_10139977
760 Ga0207706_10156871
761 Ga0207686_10026819
762 Ga0207686_10062876
763 Ga0207670_10111926
764 Ga0207669_10613784
765 Ga0207704_10019984
766 Ga0207704_10089159
767 Ga0207704_10207107
768 Ga0207704_11664913
769 Ga0207691_10064050
770 Ga0207711_10113149
771 Ga0207711_10614322
772 Ga0207689_10047696
773 Ga0207679_11844793
774 Ga0207667_10448962
775 Ga0207651_10044633
776 Ga0207712_10019704
777 Ga0207712_10042121
778 Ga0207712_10601830
779 Ga0207668_10364515
780 Ga0207640_10193977
781 Ga0207640_10902652
782 Ga0207658_10004450
783 Ga0207658_10364542
784 Ga0207658_11362096
785 Ga0207677_10007213
786 Ga0207677_11979991
787 Ga0207677_12008107
788 Ga0207703_10000855
789 Ga0207703_10904714
790 Ga0207639_10681611
791 Ga0207678_10006781
792 Ga0207678_10618807
793 Ga0207708_10243051
794 Ga0207702_10374878
795 Ga0207702_11158382
796 Ga0207641_10064577
797 Ga0207641_10828004
798 Ga0207641_11745301
799 Ga0207641_12626015
800 Ga0207648_10014132
801 Ga0207648_10091881
802 Ga0207676_10214421
803 Ga0207676_10495252
804 Ga0207674_12198847
805 Ga0207675_100010773
806 Ga0207675_100019991
807 Ga0207675_100188519
808 Ga0207675_100308367
809 Ga0207675_100456389
810 Ga0207683_10098943
811 Ga0207683_10391788
812 Ga0207698_11060015
813 Ga0207698_12169898
814 Ga0207698_12227785
815 Ga0209281_1012480
816 Ga0209371_1000075
817 Ga0268266_10045112
818 Ga0268266_10310249
819 Ga0268266_10331544
820 Ga0268266_10988078
821 Ga0268265_10228255
822 Ga0268265_10239976
823 Ga0268265_10730565
824 Ga0268264_10014540
825 Ga0268264_10061954
826 Ga0268264_10800077
827 Ga0268264_11163249
828 Ga0265319_1048759
829 Ga0265334_10000089
830 Ga0265318_10010901
831 Ga0265338_10007138
832 Ga0265324_10104971
833 Ga0268256_1000068
834 Ga0307511_10000112
835 Ga0307511_10060866
836 Ga0265330_10002999
837 Ga0265330_10463576
838 Ga0265332_10004069
839 Ga0265332_10183024
840 Ga0265328_10245454
841 Ga0265320_10199525
842 Ga0265325_10001937
843 Ga0265339_10054812
844 Ga0265339_10108665
845 Ga0265331_10060184
846 Ga0265327_10000027
847 Ga0265316_10436333
848 Ga0307513_10055934
849 Ga0307513_11108846
850 Ga0307408_100272797
851 Ga0265313_10019234
852 Ga0307508_10312605
853 Ga0307508_10549218
854 Ga0316575_10174474
855 Ga0265314_10014486
856 Ga0265314_10205592
857 Ga0265342_10012744
858 Ga0265342_10018193
859 Ga0316576_10645674
860 Ga0316576_10756393
861 Ga0316576_10907942
862 Ga0316578_10110274
863 Ga0307516_10021678
864 Ga0307413_10993479
865 Ga0307410_10148771
866 Ga0307406_10395120
867 Ga0307406_10703895
868 Ga0307407_10243223
869 Ga0307412_11658496
870 Ga0307412_12189446
871 Ga0307409_100401395
872 Ga0307416_101529984
873 Ga0307411_10139084
874 Ga0307411_11111043
875 Ga0316580_10016325
876 Ga0373938_0172900
877 Ga0373936_0002456
878 Ga0316574_0018957
879 Ga0316574_0992750
880 Ga0316582_0087525
881 Ga0316584_0137508
882 Ga0395898_0174813
883 Ga0395905_0055313
884 Ga0395901_0008721
885 Ga0451791_0330967
886 Ga0451797_0525625
887 Ga0451839_0926928
888 Ga0451841_0143415
889 Ga0451841_1299822
890 Ga0451845_0161850
891 Ga0451849_0461382
892 Ga0451849_0957858
893 Ga0451851_0438943
894 Ga0451843_1222740
895 Ga0451843_1529574
896 Ga0439452_010484
897 Ga0450906_044706
898 Ga0439460_0215589
899 Ga0451577_0015537
900 Ga0466969_0032559
901 Ga0466972_0188148
902 Ga0466966_0010105
903 Ga0453684_0010616
904 Ga0453684_1315259
905 Ga0466970_0931331
906 Ga0466959_0002148
907 Ga0466959_0042999
908 Ga0451576_2630017
909 Ga0495638_0078582
910 Ga0495638_0440958
911 Ga0495650_0016936
912 Ga0495650_0199536
913 Ga0495632_0141625
914 Ga0495621_0136370
915 Ga0495621_0227454
916 Ga0495633_0040355
917 Ga0495625_0028658
918 Ga0495625_0045648
919 Ga0495657_0620187
920 Ga0495670_0726387
921 Ga0495649_0156203
922 Ga0495680_0877039
923 Ga0496100_1479706
924 Ga0496101_0160462
925 Ga0496104_0047693
926 Ga0496104_0611785
927 Ga0496104_1836392
928 Ga0496105_0082258
929 Ga0496107_0108188
930 Ga0496112_0452055
931 Ga0496113_0055996
932 Ga0496115_0000782
933 Ga0496116_0241377
934 Ga0496117_0001663
935 Ga0496118_0031793
936 Ga0496118_0035543
937 Ga0496118_0114282
938 Ga0496119_0000177
939 Ga0496119_0001108
940 Ga0496119_0350274
941 Ga0496120_0000188
942 Ga0496120_0000328
943 Ga0496120_0109591
944 Ga0496121_0025636
945 Ga0496121_0151460
946 Ga0496122_0000209
947 Ga0496122_0242202
948 Ga0496123_0000106
949 Ga0496123_0341377
950 Ga0496124_0000401
951 Ga0496125_0002206
952 Ga0496125_0038336
953 Ga0496126_0002462
954 Ga0495678_230501
955 Ga0501031_0001097
956 Ga0501031_0213687
957 Ga0501032_0005261
958 Ga0501032_0014161
959 Ga0501032_0756536
960 Ga0501033_0000720
961 Ga0501033_0014033
962 Ga0501033_0031736
963 Ga0501034_0002484
964 Ga0501034_0004188
965 Ga0501034_0714230
966 Ga0501034_1252587
967 Ga0501036_0007244
968 Ga0501036_0007930
969 Ga0501036_0160322
970 Ga0501036_0284259
971 Ga0501037_0001245
972 Ga0501037_0283164
973 Ga0501038_0000673
974 Ga0501038_0842244
975 Ga0501039_0002430
976 Ga0501039_0005379
977 Ga0501039_0052721
978 Ga0501040_0030210
979 Ga0501042_0000212
980 Ga0501042_0703901
981 Ga0501043_0003203
982 Ga0501043_0014430
983 Ga0501043_0028000
984 Ga0501043_0088572
985 Ga0501046_0002962
986 Ga0501046_0013109
987 Ga0501046_0013611
988 Ga0501047_0005546
989 Ga0501047_0034653
990 Ga0501047_0107772
991 Ga0501047_0208807
992 Ga0501048_0069337
993 Ga0501048_0095168
994 Ga0501067_0009020
995 Ga0501067_0041945
996 Ga0501067_0233470
997 Ga0501069_0055903
998 Ga0501069_0126607
999 Ga0501070_0056925
1000 Ga0501070_0059406
1001 Ga0501070_0138229
1002 Ga0501070_0227269
1003 Ga0501071_0008741
1004 Ga0501071_0095677
1005 Ga0501072_0071696
1006 Ga0501073_0016778
1007 Ga0501073_0050715
1008 Ga0501073_0989987
1009 Ga0501074_0008025
1010 Ga0501074_0025724
1011 Ga0501075_0240312
1012 Ga0501079_0016173
1013 Ga0501079_0034570
1014 Ga0501080_0021473
1015 Ga0501080_0390689
1016 Ga0501080_0460279
1017 Ga0501081_0082346
1018 Ga0501083_0016466
1019 Ga0501035_0004344
1020 Ga0501035_0021681
1021 Ga0501035_0028763
1022 Ga0501044_0006784
1023 Ga0501044_0016545
1024 Ga0501044_0114223
1025 Ga0501045_0078084
1026 Ga0501045_0447055
1027 nmdc:mga05p37_35518_c1
1028 nmdc:mga09592_1185621_c1
1029 nmdc:mga0qj67_40234_c1
1030 nmdc:mga0qj67_9876_c1
1031 Ga0495655_0188233
1032 Ga0500644_0029071
1033 Ga0500557_102851
1034 Ga0500572_093531
1035 Ga0500591_144680
1036 Ga0500630_070629
1037 Ga0500639_198171
1038 Ga0501084_0062028
1039 Ga0501084_0198135
1040 Ga0501082_0054243
1041 Ga0501082_0348151
1042 Ga0530510_0087572
1043 2508851459
1044 2609913705
1045 2637226305
1046 2643817430
1047 2643907924
1048 2643938141
1049 2644079213
1050 2644694657
1051 2707101407
1052 2738714570
1053 2777020378
1054 2807179584
1055 2819660207
1056 2836163947
1057 2852684979
1058 2857444683
1059 2884415486
1060 2895396794
1061 2904517305
1062 2919130520
1063 2923518595
1064 2929198476
1065 2941476747
1066 2945878859
1067 2952254536
1068 2969083284
1069 2984560301
1070 2984598378
1071 640937012
1072 8003015870
1073 8021625614
1074 8021626985
1075 8021652104
1076 8055695393

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01258

zf-dskA_traR

Prokaryotic dksA/traR C4-type zinc finger

44

80

0.91

Map