F461097

General Info

Members Datasets Scaffolds Average Seq Length
539 263 536 145

Family's Representative Sequence

Representative Sequence 3300003544|Ga0007417J51691_1112541|Ga0007417J51691_11125411
Length 147
Sequence MSTPSHGHPASPESLIEPTDCHTAHFATRWLQPSMAIITAHGELDAANAQDFVDYALRHAPHTDRLVLDLTGVDFFGTAGFSALHTVNVRCAAEKIEWALAPSPAVSRLLRICDPDSALPICESVDAALAAVQGEPRRLLQLVPKSR

Samples

Sample ID Description Type Environment
1 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
2 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
3 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
186 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
189 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
192 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
193 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
214 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
239 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
249 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
250 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
251 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
252 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
253 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.66
Metatranscriptomes 2.78
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.96
Nodule 0.19
Rhizoplane 7.05
Rhizosphere 73.28
Stem 0
Stem Tuber 0
Unclassified 3.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1003788 3300001977 Bacteria 2388
2 JGI24743J22301_10001242 3300001991 Bacteria 3460
3 JGI24750J21931_1007953 3300002070 Bacteria 1341
4 JGI24750J21931_1016606 3300002070 Bacteria 1000
5 JGI24744J21845_10000282 3300002077 Bacteria 8421
6 JGI24034J26672_10032255 3300002239 Bacteria 857
7 JGI24034J26672_10039379 3300002239 Bacteria 790
8 JGI24742J22300_10011467 3300002244 Bacteria 1472
9 JGI24751J29686_10003134 3300002459 Bacteria 3331
10 Ga0007417J51691_1112541 3300003544 Bacteria 599
11 Ga0007416J51690_1063536 3300003577 Bacteria 595
12 Ga0070676_10062158 3300005328 Bacteria 2221
13 Ga0070676_10063638 3300005328 Bacteria 2198
14 Ga0070690_100015939 3300005330 Bacteria 4491
15 Ga0070690_100188540 3300005330 Bacteria 1428
16 Ga0070677_10458286 3300005333 Bacteria 683
17 Ga0068869_100052993 3300005334 Bacteria 2948
18 Ga0070666_10051576 3300005335 Bacteria 2771
19 Ga0070666_10274324 3300005335 Bacteria 1198
20 Ga0070682_100022023 3300005337 Bacteria 3769
21 Ga0070682_100091257 3300005337 Bacteria 1993
22 Ga0070682_100163502 3300005337 Bacteria 1540
23 Ga0068868_100024084 3300005338 Bacteria 4614
24 Ga0068868_100078675 3300005338 Bacteria 2640
25 Ga0070660_100582550 3300005339 Bacteria 935
26 Ga0070689_100090359 3300005340 Bacteria 2413
27 Ga0070689_100316606 3300005340 Bacteria 1302
28 Ga0070691_10119314 3300005341 Bacteria 1327
29 Ga0070687_100056035 3300005343 Bacteria 2061
30 Ga0070687_101115093 3300005343 Bacteria 578
31 Ga0070668_100000644 3300005347 Bacteria 23575
32 Ga0070668_100027252 3300005347 Bacteria 4338
33 Ga0070668_100116324 3300005347 Bacteria 2132
34 Ga0070668_100216220 3300005347 Bacteria 1579
35 Ga0070669_100038266 3300005353 Bacteria 3482
36 Ga0070669_100078819 3300005353 Bacteria 2449
37 Ga0070669_100157400 3300005353 Bacteria 1763
38 Ga0070675_100118108 3300005354 Bacteria 2252
39 Ga0070671_100020489 3300005355 Bacteria 5393
40 Ga0070671_100064694 3300005355 Bacteria 3045
41 Ga0070671_100195675 3300005355 Bacteria 1714
42 Ga0070671_100226580 3300005355 Bacteria 1586
43 Ga0070674_100018730 3300005356 Bacteria 4384
44 Ga0070673_100264785 3300005364 Bacteria 1503
45 Ga0070673_100631604 3300005364 Bacteria 979
46 Ga0070673_101045567 3300005364 Bacteria 761
47 Ga0070659_100121418 3300005366 Bacteria 2117
48 Ga0070659_100131929 3300005366 Bacteria 2029
49 Ga0070667_100000027 3300005367 Bacteria 181315
50 Ga0070667_100006471 3300005367 Bacteria 9740
51 Ga0070667_100011027 3300005367 Bacteria 7474
52 Ga0070667_100025029 3300005367 Bacteria 4960
53 Ga0070667_100029491 3300005367 Bacteria 4571
54 Ga0070667_100082525 3300005367 Bacteria 2752
55 Ga0070709_10758874 3300005434 Bacteria 758
56 Ga0070709_11225064 3300005434 Bacteria 604
57 Ga0070714_100432604 3300005435 Bacteria 1248
58 Ga0070713_100548069 3300005436 Bacteria 1095
59 Ga0070710_10009449 3300005437 Bacteria 4771
60 Ga0070710_10011254 3300005437 Bacteria 4418
61 Ga0070701_10001234 3300005438 Bacteria 9382
62 Ga0070701_10196495 3300005438 Bacteria 1190
63 Ga0070711_100002249 3300005439 Bacteria 10958
64 Ga0070711_100002973 3300005439 Bacteria 9781
65 Ga0070705_100156418 3300005440 Bacteria 1518
66 Ga0070705_100473665 3300005440 Bacteria 945
67 Ga0070700_100015066 3300005441 Bacteria 4377
68 Ga0070700_100097096 3300005441 Bacteria 1934
69 Ga0070694_100324575 3300005444 Bacteria 1186
70 Ga0070663_100025943 3300005455 Bacteria 3962
71 Ga0070663_100031005 3300005455 Bacteria 3670
72 Ga0070663_100133248 3300005455 Bacteria 1889
73 Ga0070678_100000026 3300005456 Bacteria 47333
74 Ga0070662_100003925 3300005457 Bacteria 9328
75 Ga0070662_100053679 3300005457 Bacteria 2918
76 Ga0070681_11886011 3300005458 Bacteria 525
77 Ga0068867_100051185 3300005459 Bacteria 3045
78 Ga0070685_10138026 3300005466 Bacteria 1532
79 Ga0070699_101691886 3300005518 Bacteria 579
80 Ga0068853_100011537 3300005539 Bacteria 7184
81 Ga0068853_100087678 3300005539 Bacteria 2731
82 Ga0068853_100583248 3300005539 Bacteria 1061
83 Ga0070672_100024124 3300005543 Bacteria 4489
84 Ga0070672_100166255 3300005543 Bacteria 1832
85 Ga0070686_100189281 3300005544 Bacteria 1468
86 Ga0070686_100195686 3300005544 Bacteria 1446
87 Ga0070695_100007859 3300005545 Bacteria 6318
88 Ga0070696_100010279 3300005546 Bacteria 6265
89 Ga0070696_100429707 3300005546 Bacteria 1039
90 Ga0070693_100036106 3300005547 Bacteria 2745
91 Ga0070693_100313310 3300005547 Bacteria 1062
92 Ga0070665_100006996 3300005548 Bacteria 11462
93 Ga0070665_100378591 3300005548 Bacteria 1423
94 Ga0070665_100514012 3300005548 Bacteria 1209
95 Ga0070665_100685567 3300005548 Bacteria 1038
96 Ga0070665_101020698 3300005548 Unclassified 839
97 Ga0070704_100000086 3300005549 Bacteria 31885
98 Ga0068855_100036066 3300005563 Bacteria 5887
99 Ga0068855_100072802 3300005563 Bacteria 3993
100 Ga0068855_100642285 3300005563 Bacteria 1141
101 Ga0068854_100000670 3300005578 Bacteria 20461
102 Ga0068854_100045883 3300005578 Bacteria 3109
103 Ga0068854_100101089 3300005578 Bacteria 2162
104 Ga0068856_100178883 3300005614 Bacteria 2134
105 Ga0070702_100622213 3300005615 Bacteria 812
106 Ga0070702_100736221 3300005615 Bacteria 755
107 Ga0068852_100162876 3300005616 Bacteria 2084
108 Ga0068859_100000806 3300005617 Bacteria 31838
109 Ga0068859_100018271 3300005617 Bacteria 7050
110 Ga0068859_101254518 3300005617 Bacteria 816
111 Ga0068864_100345225 3300005618 Bacteria 1403
112 Ga0068864_100760923 3300005618 Bacteria 950
113 Ga0068866_10008189 3300005718 Bacteria 4394
114 Ga0068866_10083241 3300005718 Bacteria 1723
115 Ga0068861_100007495 3300005719 Bacteria 7481
116 Ga0068861_100123562 3300005719 Bacteria 2091
117 Ga0068861_100446789 3300005719 Bacteria 1157
118 Ga0068870_10176919 3300005840 Bacteria 1278
119 Ga0068863_100046724 3300005841 Bacteria 4109
120 Ga0068863_100174668 3300005841 Bacteria 2062
121 Ga0068863_100330515 3300005841 Bacteria 1482
122 Ga0068863_101046761 3300005841 Bacteria 820
123 Ga0068858_100028603 3300005842 Bacteria 5176
124 Ga0068858_100046743 3300005842 Bacteria 4012
125 Ga0068858_100050895 3300005842 Bacteria 3834
126 Ga0068858_102578793 3300005842 Unclassified 502
127 Ga0068860_100000144 3300005843 Bacteria 116029
128 Ga0068860_100032026 3300005843 Bacteria 5055
129 Ga0068860_100108263 3300005843 Bacteria 2656
130 Ga0068860_100316909 3300005843 Bacteria 1530
131 Ga0068862_100000177 3300005844 Bacteria 70443
132 Ga0068862_100119079 3300005844 Bacteria 2325
133 Ga0068862_100272236 3300005844 Bacteria 1549
134 Ga0068862_100587331 3300005844 Bacteria 1068
135 Ga0081455_10060465 3300005937 Bacteria 3194
136 Ga0081455_10345181 3300005937 Bacteria 1052
137 Ga0081538_10061246 3300005981 Bacteria 2156
138 Ga0081538_10194269 3300005981 Bacteria 845
139 Ga0081538_10218091 3300005981 Bacteria 760
140 Ga0075365_10002900 3300006038 Bacteria 8644
141 Ga0075365_10035354 3300006038 Bacteria 3231
142 Ga0075368_10232679 3300006042 Bacteria 785
143 Ga0075363_100003254 3300006048 Bacteria 6871
144 Ga0075363_100004816 3300006048 Bacteria 5956
145 Ga0075363_100005729 3300006048 Bacteria 5568
146 Ga0075363_100044696 3300006048 Bacteria 2347
147 Ga0075363_100123306 3300006048 Bacteria 1448
148 Ga0075363_100165005 3300006048 Bacteria 1255
149 Ga0075363_100303550 3300006048 Bacteria 927
150 Ga0075363_100379349 3300006048 Bacteria 829
151 Ga0075363_100643812 3300006048 Bacteria 637
152 Ga0075364_10011668 3300006051 Bacteria 5343
153 Ga0075364_10027369 3300006051 Bacteria 3642
154 Ga0075364_10049829 3300006051 Bacteria 2732
155 Ga0075364_10169204 3300006051 Bacteria 1477
156 Ga0075364_10986687 3300006051 Bacteria 573
157 Ga0070716_100018741 3300006173 Bacteria 3609
158 Ga0070716_100285609 3300006173 Bacteria 1141
159 Ga0070712_100020726 3300006175 Bacteria 4304
160 Ga0075362_10090412 3300006177 Bacteria 1420
161 Ga0075362_10094382 3300006177 Bacteria 1392
162 Ga0075362_10123782 3300006177 Bacteria 1226
163 Ga0075367_10000643 3300006178 Bacteria 13423
164 Ga0075367_10048805 3300006178 Bacteria 2494
165 Ga0075367_10107755 3300006178 Bacteria 1707
166 Ga0075367_10190423 3300006178 Bacteria 1280
167 Ga0075367_10649486 3300006178 Bacteria 671
168 Ga0075367_10729176 3300006178 Bacteria 631
169 Ga0075369_10001234 3300006186 Bacteria 8673
170 Ga0075369_10003471 3300006186 Bacteria 5739
171 Ga0075369_10053323 3300006186 Bacteria 1755
172 Ga0075369_10087195 3300006186 Bacteria 1390
173 Ga0075369_10163781 3300006186 Bacteria 1019
174 Ga0075369_10176318 3300006186 Bacteria 983
175 Ga0075369_10177491 3300006186 Bacteria 979
176 Ga0075369_10208753 3300006186 Bacteria 902
177 Ga0075369_10216497 3300006186 Bacteria 886
178 Ga0075369_10233506 3300006186 Bacteria 852
179 Ga0075369_10282846 3300006186 Bacteria 773
180 Ga0097621_100072991 3300006237 Bacteria 2840
181 Ga0075370_10011175 3300006353 Bacteria 4713
182 Ga0075370_10011617 3300006353 Bacteria 4632
183 Ga0075370_10020325 3300006353 Bacteria 3627
184 Ga0075370_10049185 3300006353 Bacteria 2390
185 Ga0075370_10087459 3300006353 Bacteria 1795
186 Ga0075370_10125995 3300006353 Bacteria 1493
187 Ga0075370_10420908 3300006353 Bacteria 802
188 Ga0068871_100167479 3300006358 Bacteria 1882
189 Ga0075428_100557645 3300006844 Bacteria 1225
190 Ga0075430_100456165 3300006846 Bacteria 1055
191 Ga0075431_100553023 3300006847 Bacteria 1138
192 Ga0075429_100780012 3300006880 Bacteria 837
193 Ga0068865_100000236 3300006881 Bacteria 30747
194 Ga0097620_100000806 3300006931 Bacteria 31838
195 Ga0097620_100018270 3300006931 Bacteria 7050
196 Ga0097620_101254509 3300006931 Bacteria 816
197 Ga0075435_100952947 3300007076 Bacteria 749
198 Ga0105250_10155846 3300009092 Bacteria 952
199 Ga0105240_10921661 3300009093 Bacteria 939
200 Ga0105245_10000766 3300009098 Bacteria 29086
201 Ga0105247_10000113 3300009101 Bacteria 81617
202 Ga0105247_10000167 3300009101 Bacteria 64475
203 Ga0105247_10064063 3300009101 Bacteria 2283
204 Ga0114129_10071479 3300009147 Bacteria 4838
205 Ga0105243_10008152 3300009148 Bacteria 8045
206 Ga0105243_10332265 3300009148 Bacteria 1389
207 Ga0105241_10088001 3300009174 Bacteria 2445
208 Ga0105242_10004135 3300009176 Bacteria 11293
209 Ga0105242_10074893 3300009176 Bacteria 2817
210 Ga0105248_10000054 3300009177 Bacteria 143260
211 Ga0105248_10019850 3300009177 Bacteria 7443
212 Ga0105237_10001164 3300009545 Bacteria 35186
213 Ga0105237_10035568 3300009545 Bacteria 5040
214 Ga0105237_10203719 3300009545 Bacteria 1979
215 Ga0105238_10100097 3300009551 Bacteria 2882
216 Ga0105238_10518550 3300009551 Bacteria 1194
217 Ga0105238_12656531 3300009551 Bacteria 537
218 Ga0105249_10000013 3300009553 Bacteria 283609
219 Ga0105249_10008633 3300009553 Bacteria 8880
220 Ga0105249_10040990 3300009553 Bacteria 4207
221 Ga0105249_10488825 3300009553 Bacteria 1274
222 Ga0105249_10978943 3300009553 Bacteria 914
223 Ga0105239_10007550 3300010375 Bacteria 12472
224 Ga0105239_10608368 3300010375 Bacteria 1247
225 Ga0105239_10722781 3300010375 Bacteria 1139
226 Ga0105239_11535736 3300010375 Unclassified 770
227 Ga0105239_11997248 3300010375 Bacteria 673
228 Ga0105246_10033306 3300011119 Bacteria 3424
229 Ga0157371_10340036 3300013102 Bacteria 1091
230 Ga0157370_11012243 3300013104 Bacteria 752
231 Ga0157369_10902268 3300013105 Bacteria 906
232 Ga0157369_11424723 3300013105 Bacteria 705
233 Ga0157374_11766182 3300013296 Bacteria 644
234 Ga0157378_10000337 3300013297 Bacteria 46113
235 Ga0157378_10106969 3300013297 Bacteria 2559
236 Ga0163162_10020441 3300013306 Bacteria 6507
237 Ga0163162_10110560 3300013306 Bacteria 2845
238 Ga0163162_10176412 3300013306 Bacteria 2262
239 Ga0163162_10491158 3300013306 Bacteria 1359
240 Ga0163162_11017431 3300013306 Bacteria 937
241 Ga0157372_10142712 3300013307 Bacteria 2761
242 Ga0157372_10823303 3300013307 Bacteria 1078
243 Ga0157375_10007277 3300013308 Bacteria 9686
244 Ga0157375_10279100 3300013308 Bacteria 1834
245 Ga0157375_11130968 3300013308 Bacteria 917
246 Ga0157375_11817931 3300013308 Bacteria 722
247 Ga0163163_10041943 3300014325 Bacteria 4478
248 Ga0163163_10203569 3300014325 Bacteria 2028
249 Ga0163163_11335507 3300014325 Bacteria 779
250 Ga0157380_10005958 3300014326 Bacteria 8529
251 Ga0157380_10031241 3300014326 Bacteria 4087
252 Ga0157377_10189498 3300014745 Bacteria 1299
253 Ga0157379_10016713 3300014968 Bacteria 6456
254 Ga0157379_10932214 3300014968 Bacteria 825
255 Ga0157376_10030729 3300014969 Bacteria 4293
256 Ga0157376_10070364 3300014969 Bacteria 2969
257 Ga0163161_10001646 3300017792 Bacteria 16426
258 Ga0163161_10139082 3300017792 Bacteria 1837
259 Ga0163161_11237646 3300017792 Bacteria 647
260 Ga0209025_1101818 3300025294 Bacteria 907
261 Ga0207696_1046291 3300025711 Bacteria 1255
262 Ga0207692_10003610 3300025898 Bacteria 6055
263 Ga0207642_10000213 3300025899 Bacteria 17157
264 Ga0207710_10000141 3300025900 Bacteria 82771
265 Ga0207710_10015921 3300025900 Bacteria 3180
266 Ga0207710_10018428 3300025900 Bacteria 2969
267 Ga0207688_10003303 3300025901 Bacteria 8813
268 Ga0207688_10010209 3300025901 Bacteria 5112
269 Ga0207680_10016094 3300025903 Bacteria 3918
270 Ga0207680_10438750 3300025903 Bacteria 926
271 Ga0207647_10061000 3300025904 Bacteria 2303
272 Ga0207647_10212527 3300025904 Bacteria 1116
273 Ga0207685_10010450 3300025905 Bacteria 2742
274 Ga0207699_10021835 3300025906 Bacteria 3459
275 Ga0207699_10150966 3300025906 Bacteria 1537
276 Ga0207699_10843280 3300025906 Bacteria 675
277 Ga0207645_10045299 3300025907 Bacteria 2812
278 Ga0207645_10063817 3300025907 Bacteria 2353
279 Ga0207654_10049184 3300025911 Bacteria 2416
280 Ga0207654_10217267 3300025911 Bacteria 1266
281 Ga0207654_10390819 3300025911 Bacteria 965
282 Ga0207671_10034537 3300025914 Bacteria 3756
283 Ga0207671_10146995 3300025914 Bacteria 1819
284 Ga0207671_10812517 3300025914 Bacteria 741
285 Ga0207693_10001529 3300025915 Bacteria 20433
286 Ga0207693_10001755 3300025915 Bacteria 19046
287 Ga0207663_10011505 3300025916 Bacteria 4752
288 Ga0207663_10017273 3300025916 Bacteria 4016
289 Ga0207662_10717434 3300025918 Bacteria 701
290 Ga0207657_10058995 3300025919 Bacteria 3300
291 Ga0207681_10002592 3300025923 Bacteria 11453
292 Ga0207681_10370492 3300025923 Bacteria 1151
293 Ga0207659_10136341 3300025926 Bacteria 1900
294 Ga0207687_10001172 3300025927 Bacteria 17899
295 Ga0207700_11199519 3300025928 Bacteria 677
296 Ga0207644_10131454 3300025931 Bacteria 1916
297 Ga0207644_10549846 3300025931 Bacteria 955
298 Ga0207690_10061385 3300025932 Bacteria 2555
299 Ga0207690_10434823 3300025932 Bacteria 1052
300 Ga0207706_10002731 3300025933 Bacteria 17196
301 Ga0207686_10005157 3300025934 Bacteria 7024
302 Ga0207686_10375676 3300025934 Bacteria 1076
303 Ga0207709_10027794 3300025935 Bacteria 3264
304 Ga0207670_10119094 3300025936 Bacteria 1916
305 Ga0207669_10003717 3300025937 Bacteria 6637
306 Ga0207704_10012730 3300025938 Bacteria 4181
307 Ga0207704_10022463 3300025938 Bacteria 3380
308 Ga0207665_10000902 3300025939 Bacteria 20013
309 Ga0207665_10012269 3300025939 Bacteria 5627
310 Ga0207665_10162910 3300025939 Bacteria 1605
311 Ga0207691_10039539 3300025940 Bacteria 4364
312 Ga0207691_10054079 3300025940 Bacteria 3663
313 Ga0207711_10000396 3300025941 Bacteria 46050
314 Ga0207711_10002263 3300025941 Bacteria 17274
315 Ga0207711_10771479 3300025941 Bacteria 896
316 Ga0207689_10012536 3300025942 Bacteria 7242
317 Ga0207689_10443893 3300025942 Bacteria 1084
318 Ga0207667_10209977 3300025949 Bacteria 1995
319 Ga0207667_10227004 3300025949 Bacteria 1913
320 Ga0207651_11087643 3300025960 Bacteria 716
321 Ga0207651_11090052 3300025960 Bacteria 715
322 Ga0207712_10000018 3300025961 Bacteria 317921
323 Ga0207712_10001400 3300025961 Bacteria 16463
324 Ga0207712_10187062 3300025961 Bacteria 1632
325 Ga0207712_10195494 3300025961 Bacteria 1600
326 Ga0207712_11153194 3300025961 Bacteria 691
327 Ga0207668_10018436 3300025972 Bacteria 4392
328 Ga0207668_10836994 3300025972 Bacteria 816
329 Ga0207668_11285062 3300025972 Bacteria 658
330 Ga0207640_10059028 3300025981 Bacteria 2530
331 Ga0207640_10073587 3300025981 Bacteria 2309
332 Ga0207658_10000235 3300025986 Bacteria 58555
333 Ga0207658_10044384 3300025986 Bacteria 3236
334 Ga0207658_10083656 3300025986 Bacteria 2453
335 Ga0207658_10085228 3300025986 Bacteria 2433
336 Ga0207658_10096259 3300025986 Bacteria 2308
337 Ga0207658_11542663 3300025986 Bacteria 607
338 Ga0207677_10065328 3300026023 Bacteria 2538
339 Ga0207677_10074471 3300026023 Bacteria 2409
340 Ga0207703_10022828 3300026035 Bacteria 4914
341 Ga0207703_10023445 3300026035 Bacteria 4847
342 Ga0207703_10056177 3300026035 Bacteria 3205
343 Ga0207639_10167599 3300026041 Bacteria 1857
344 Ga0207678_10019829 3300026067 Bacteria 5911
345 Ga0207678_10061878 3300026067 Bacteria 3219
346 Ga0207678_10108682 3300026067 Bacteria 2366
347 Ga0207708_10000975 3300026075 Bacteria 21463
348 Ga0207708_10076943 3300026075 Bacteria 2560
349 Ga0207702_10090618 3300026078 Bacteria 2676
350 Ga0207702_10218834 3300026078 Bacteria 1774
351 Ga0207641_10014004 3300026088 Bacteria 6575
352 Ga0207641_10056853 3300026088 Bacteria 3326
353 Ga0207648_10003108 3300026089 Bacteria 17535
354 Ga0207648_10018595 3300026089 Bacteria 6288
355 Ga0207676_10238058 3300026095 Bacteria 1631
356 Ga0207675_100000200 3300026118 Bacteria 55367
357 Ga0207675_100121696 3300026118 Bacteria 2470
358 Ga0207675_100199143 3300026118 Bacteria 1923
359 Ga0207675_100399154 3300026118 Bacteria 1355
360 Ga0207675_101234945 3300026118 Bacteria 768
361 Ga0207683_10000437 3300026121 Bacteria 38578
362 Ga0207698_10036588 3300026142 Bacteria 3605
363 Ga0207698_11438158 3300026142 Bacteria 705
364 Ga0268266_10004557 3300028379 Bacteria 13239
365 Ga0268266_10013474 3300028379 Bacteria 7038
366 Ga0268266_10019242 3300028379 Bacteria 5816
367 Ga0268266_10096260 3300028379 Bacteria 2601
368 Ga0268265_10000147 3300028380 Bacteria 88026
369 Ga0268265_10091939 3300028380 Bacteria 2427
370 Ga0268265_10650093 3300028380 Bacteria 1013
371 Ga0268265_10750550 3300028380 Bacteria 947
372 Ga0268264_10000005 3300028381 Bacteria 934972
373 Ga0268264_10008081 3300028381 Bacteria 8750
374 Ga0268264_10893406 3300028381 Bacteria 891
375 Ga0268264_11586863 3300028381 Bacteria 665
376 Ga0307413_10024838 3300031824 Bacteria 3274
377 Ga0307410_10005976 3300031852 Bacteria 6516
378 Ga0307410_11278852 3300031852 Bacteria 641
379 Ga0307406_10061863 3300031901 Bacteria 2420
380 Ga0307407_10699022 3300031903 Bacteria 764
381 Ga0307407_10872538 3300031903 Bacteria 689
382 Ga0307412_10361542 3300031911 Bacteria 1169
383 Ga0307409_100046574 3300031995 Bacteria 3284
384 Ga0307416_100012724 3300032002 Bacteria 5684
385 Ga0307416_100970933 3300032002 Bacteria 952
386 Ga0307411_10040877 3300032005 Bacteria 2945
387 Ga0307415_100000828 3300032126 Bacteria 14155
388 Ga0307415_100308084 3300032126 Bacteria 1315
389 Ga0373929_0129176 3300035085 Bacteria 661
390 Ga0373949_0012365 3300035090 Bacteria 1888
391 Ga0373939_0039841 3300035114 Bacteria 1408
392 Ga0373942_0170480 3300035207 Bacteria 708
393 Ga0373961_0035174 3300035241 Bacteria 1420
394 Ga0373931_0020072 3300035691 Bacteria 3341
395 Ga0439461_0237203 3300041410 Unclassified 502
396 Ga0439466_0004690 3300041411 Bacteria 5251
397 Ga0439465_0002119 3300041413 Bacteria 6527
398 Ga0439465_0016809 3300041413 Bacteria 2283
399 Ga0439465_0060902 3300041413 Bacteria 1250
400 Ga0451789_0433449 3300041443 Bacteria 512
401 Ga0451793_1268181 3300041452 Bacteria 904
402 Ga0451833_0794404 3300041491 Bacteria 1039
403 Ga0451853_0780145 3300041512 Bacteria 547
404 Ga0439445_0011318 3300042004 Bacteria 2126
405 Ga0439445_0014793 3300042004 Bacteria 1904
406 Ga0439434_0003471 3300042435 Bacteria 4602
407 Ga0466969_0160564 3300044656 Bacteria 1033
408 Ga0466972_0181634 3300044658 Bacteria 986
409 Ga0466965_0603979 3300044683 Bacteria 623
410 Ga0466961_0087423 3300044693 Bacteria 1969
411 Ga0466971_0017221 3300044719 Bacteria 3194
412 Ga0466970_0046302 3300044765 Bacteria 2316
413 Ga0466970_0141580 3300044765 Bacteria 1325
414 Ga0466960_0007880 3300044901 Bacteria 4345
415 Ga0466959_0144757 3300045049 Bacteria 1677
416 Ga0466958_0373457 3300045836 Bacteria 919
417 Ga0466967_0154390 3300045976 Bacteria 2149
418 Ga0495606_0100391 3300046507 Bacteria 1763
419 Ga0495648_0003936 3300046524 Bacteria 12861
420 Ga0495611_0024594 3300046648 Bacteria 2621
421 Ga0495649_0180927 3300046694 Bacteria 1100
422 Ga0495589_0162442 3300046794 Bacteria 1064
423 Ga0495672_0002388 3300047320 Bacteria 17348
424 Ga0495672_0337762 3300047320 Bacteria 703
425 Ga0495673_0002662 3300047469 Bacteria 12339
426 Ga0495626_0258963 3300048091 Bacteria 696
427 Ga0496100_0000495 3300048903 Bacteria 19031
428 Ga0496100_0003167 3300048903 Bacteria 8534
429 Ga0496100_0137800 3300048903 Bacteria 1726
430 Ga0496100_0217744 3300048903 Bacteria 1400
431 Ga0496101_0000008 3300048904 Bacteria 309720
432 Ga0496101_0004704 3300048904 Bacteria 8644
433 Ga0496101_0044789 3300048904 Bacteria 3167
434 Ga0496101_0247291 3300048904 Bacteria 1389
435 Ga0496102_0000005 3300048905 Bacteria 481937
436 Ga0496102_0000063 3300048905 Bacteria 164782
437 Ga0496102_0000826 3300048905 Bacteria 29976
438 Ga0496102_0384683 3300048905 Bacteria 1320
439 Ga0496103_0000002 3300048906 Bacteria 605387
440 Ga0496103_0000783 3300048906 Bacteria 23409
441 Ga0496103_0001339 3300048906 Bacteria 16650
442 Ga0496103_0048784 3300048906 Bacteria 2617
443 Ga0496103_0441978 3300048906 Bacteria 834
444 Ga0496104_0257487 3300048907 Bacteria 1658
445 Ga0496105_0463516 3300048908 Bacteria 999
446 Ga0496106_0000621 3300048909 Bacteria 25372
447 Ga0496106_0019445 3300048909 Bacteria 5037
448 Ga0496106_0032820 3300048909 Bacteria 3871
449 Ga0496107_0039232 3300048910 Bacteria 3396
450 Ga0496107_0075576 3300048910 Bacteria 2452
451 Ga0496107_0999372 3300048910 Bacteria 607
452 Ga0496108_0184372 3300048911 Bacteria 1808
453 Ga0496109_0011850 3300048912 Bacteria 7507
454 Ga0496109_0048473 3300048912 Bacteria 3865
455 Ga0496109_0754064 3300048912 Bacteria 911
456 Ga0496112_0007702 3300048915 Bacteria 9578
457 Ga0496112_0021941 3300048915 Bacteria 6077
458 Ga0496112_0078081 3300048915 Bacteria 3274
459 Ga0496113_0069107 3300048916 Bacteria 2682
460 Ga0496113_0154942 3300048916 Bacteria 1809
461 Ga0496114_0003036 3300048917 Bacteria 12860
462 Ga0496115_0045063 3300048918 Bacteria 3520
463 Ga0496116_0000034 3300048919 Bacteria 409567
464 Ga0496117_0000003 3300048920 Bacteria 1881097
465 Ga0496117_0000552 3300048920 Bacteria 61493
466 Ga0496118_0000001 3300048921 Bacteria 1881100
467 Ga0496118_0000317 3300048921 Bacteria 83419
468 Ga0496118_0160484 3300048921 Bacteria 1391
469 Ga0496119_0000127 3300048922 Bacteria 107730
470 Ga0496119_0094099 3300048922 Bacteria 1696
471 Ga0496120_0002389 3300048923 Bacteria 19126
472 Ga0496121_0000120 3300048924 Bacteria 174571
473 Ga0496121_0002407 3300048924 Bacteria 28671
474 Ga0496125_0148854 3300048928 Bacteria 1612
475 Ga0496126_0000417 3300048929 Bacteria 86182
476 Ga0496126_0270401 3300048929 Bacteria 1410
477 Ga0496126_0830730 3300048929 Bacteria 706
478 Ga0501034_0025129 3300049571 Bacteria 6063
479 nmdc:mga03683_130925_c1 3300050489 Bacteria 1122
480 nmdc:mga03683_134115_c1 3300050489 Bacteria 1110
481 nmdc:mga03683_239824_c1 3300050489 Bacteria 840
482 nmdc:mga03683_89389_c1 3300050489 Bacteria 1341
483 nmdc:mga03n38_174766_c1 3300050490 Bacteria 1097
484 nmdc:mga03n38_302294_c1 3300050490 Bacteria 860
485 nmdc:mga03n38_31123_c1 3300050490 Bacteria 1555
486 nmdc:mga03n38_355582_c1 3300050490 Bacteria 798
487 nmdc:mga00v17_165048_c1 3300050491 Bacteria 1427
488 nmdc:mga00v17_1662_c1 3300050491 Bacteria 11583
489 nmdc:mga00v17_202270_c1 3300050491 Bacteria 1284
490 nmdc:mga00v17_281640_c1 3300050491 Bacteria 1079
491 nmdc:mga00v17_28615_c1 3300050491 Bacteria 3265
492 nmdc:mga00v17_899437_c1 3300050491 Bacteria 560
493 nmdc:mga0yw44_13981_c1 3300050492 Bacteria 4245
494 nmdc:mga0yw44_654508_c1 3300050492 Bacteria 714
495 nmdc:mga06z11_246112_c1 3300050494 Bacteria 1051
496 nmdc:mga06z11_267044_c1 3300050494 Bacteria 1011
497 nmdc:mga06z11_28014_c1 3300050494 Bacteria 2699
498 nmdc:mga06z11_47464_c1 3300050494 Bacteria 2181
499 nmdc:mga04h51_522476_c1 3300050495 Bacteria 509
500 nmdc:mga07m45_11056_c2 3300050496 Bacteria 3512
501 nmdc:mga07m45_126565_c1 3300050496 Bacteria 1034
502 nmdc:mga07m45_16854_c1 3300050496 Bacteria 3915
503 nmdc:mga07m45_211933_c1 3300050496 Bacteria 1127
504 nmdc:mga07m45_42909_c1 3300050496 Bacteria 2536
505 nmdc:mga07m45_76011_c1 3300050496 Bacteria 1914
506 nmdc:mga07m45_8774_c1 3300050496 Bacteria 5212
507 nmdc:mga05p37_278708_c1 3300050507 Bacteria 1995
508 nmdc:mga0qj67_486713_c1 3300050509 Bacteria 992
509 nmdc:mga0qj67_78158_c1 3300050509 Bacteria 2648
510 nmdc:mga08y16_747106_c1 3300050511 Bacteria 975
511 nmdc:mga0sz30_11024_c1 3300050516 Bacteria 3477
512 nmdc:mga0sz30_157995_c1 3300050516 Bacteria 1004
513 nmdc:mga0sz30_17011_c1 3300050516 Bacteria 2895
514 nmdc:mga0sz30_243511_c1 3300050516 Bacteria 800
515 nmdc:mga0sz30_356049_c1 3300050516 Bacteria 654
516 nmdc:mga0sz30_46768_c1 3300050516 Bacteria 1827
517 nmdc:mga0sz30_5566_c1 3300050516 Bacteria 4627
518 nmdc:mga0sz30_68139_c2 3300050516 Bacteria 886
519 nmdc:mga0sz30_90896_c1 3300050516 Bacteria 1328
520 Ga0500643_005206 3300053087 Bacteria 5662
521 Ga0500646_0150846 3300053090 Bacteria 769
522 Ga0500620_026574 3300053155 Bacteria 1794
523 Ga0500611_107033 3300053727 Bacteria 731
524 Ga0587066_140733 3300059490 Bacteria 589
525 Ga0587083_0183475 3300059505 Bacteria 587
526 Ga0587085_053465 3300059506 Bacteria 743
527 Ga0587085_104160 3300059506 Bacteria 603
528 Ga0587091_150864 3300059511 Bacteria 590
529 Ga0587113_012298 3300059625 Bacteria 812
530 Ga0587128_101590 3300059630 Bacteria 603
531 Ga0587128_107821 3300059630 Bacteria 592
532 Ga0587062_025301 3300059639 Bacteria 873
533 Ga0587069_091994 3300059642 Bacteria 608
534 Ga0587079_237705 3300059647 Bacteria 513
535 Ga0587107_097925 3300059652 Bacteria 576
536 Ga0587111_0173390 3300060346 Bacteria 595

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035207 Ga0373942_0170480 Ga0373942_0170480_278_691 123
2 3300050495 nmdc:mga04h51_522476_c1 nmdc:mga04h51_522476_c1_37_414 125
3 3300006186 Ga0075369_10176318 Ga0075369_101763182 133
4 3300050491 nmdc:mga00v17_202270_c1 nmdc:mga00v17_202270_c1_515_919 133
5 3300050492 nmdc:mga0yw44_654508_c1 nmdc:mga0yw44_654508_c1_159_563 133
6 3300050511 nmdc:mga08y16_747106_c1 nmdc:mga08y16_747106_c1_34_435 133
7 3300006048 Ga0075363_100005729 Ga0075363_1000057295 134
8 3300006051 Ga0075364_10049829 Ga0075364_100498295 134
9 3300006177 Ga0075362_10090412 Ga0075362_100904122 134
10 3300006353 Ga0075370_10011617 Ga0075370_100116177 134
11 3300050489 nmdc:mga03683_239824_c1 nmdc:mga03683_239824_c1_133_540 134
12 3300050490 nmdc:mga03n38_302294_c1 nmdc:mga03n38_302294_c1_340_747 134
13 3300050496 nmdc:mga07m45_11056_c2 nmdc:mga07m45_11056_c2_2952_3359 134
14 3300050516 nmdc:mga0sz30_243511_c1 nmdc:mga0sz30_243511_c1_129_536 134
15 iso_pu_bacteria 2842134933 2842137032 137
16 3300006051 Ga0075364_10169204 Ga0075364_101692043 139
17 3300025294 Ga0209025_1101818 Ga0209025_11018182 139
18 3300050491 nmdc:mga00v17_281640_c1 nmdc:mga00v17_281640_c1_635_1057 139
19 iso_pu_bacteria 2902792274 2902793722 139
20 3300005539 Ga0068853_100583248 Ga0068853_1005832482 140
21 3300005563 Ga0068855_100036066 Ga0068855_1000360663 140
22 3300006186 Ga0075369_10087195 Ga0075369_100871952 140
23 3300009148 Ga0105243_10332265 Ga0105243_103322652 140
24 3300009545 Ga0105237_10001164 Ga0105237_1000116412 140
25 3300009551 Ga0105238_10518550 Ga0105238_105185502 140
26 3300010375 Ga0105239_10007550 Ga0105239_1000755010 140
27 3300013308 Ga0157375_11817931 Ga0157375_118179311 140
28 3300025914 Ga0207671_10034537 Ga0207671_100345371 140
29 3300025949 Ga0207667_10227004 Ga0207667_102270043 140
30 3300048903 Ga0496100_0000495 Ga0496100_0000495_8319_8747 140
31 3300048904 Ga0496101_0000008 Ga0496101_0000008_174930_175358 140
32 3300048905 Ga0496102_0000005 Ga0496102_0000005_326385_326813 140
33 3300048906 Ga0496103_0000002 Ga0496103_0000002_155155_155583 140
34 3300048909 Ga0496106_0019445 Ga0496106_0019445_216_644 140
35 3300048910 Ga0496107_0075576 Ga0496107_0075576_473_901 140
36 3300048919 Ga0496116_0000034 Ga0496116_0000034_254251_254679 140
37 3300048920 Ga0496117_0000003 Ga0496117_0000003_747291_747719 140
38 3300048921 Ga0496118_0000001 Ga0496118_0000001_747294_747722 140
39 3300048922 Ga0496119_0000127 Ga0496119_0000127_103776_104204 140
40 3300048922 Ga0496119_0094099 Ga0496119_0094099_1131_1559 140
41 3300048923 Ga0496120_0002389 Ga0496120_0002389_3655_4083 140
42 3300048924 Ga0496121_0000120 Ga0496121_0000120_50021_50449 140
43 3300048929 Ga0496126_0000417 Ga0496126_0000417_71343_71771 140
44 3300048929 Ga0496126_0830730 Ga0496126_0830730_103_531 140
45 3300050516 nmdc:mga0sz30_46768_c1 nmdc:mga0sz30_46768_c1_630_1058 140
46 3300005337 Ga0070682_100022023 Ga0070682_1000220232 141
47 3300005364 Ga0070673_101045567 Ga0070673_1010455672 141
48 3300005455 Ga0070663_100025943 Ga0070663_1000259432 141
49 3300005578 Ga0068854_100101089 Ga0068854_1001010894 141
50 3300009093 Ga0105240_10921661 Ga0105240_109216612 141
51 3300009551 Ga0105238_10100097 Ga0105238_101000974 141
52 3300013296 Ga0157374_11766182 Ga0157374_117661821 141
53 3300014325 Ga0163163_10203569 Ga0163163_102035692 141
54 3300025911 Ga0207654_10390819 Ga0207654_103908192 141
55 3300025981 Ga0207640_10073587 Ga0207640_100735871 141
56 3300026023 Ga0207677_10065328 Ga0207677_100653283 141
57 3300026067 Ga0207678_10108682 Ga0207678_101086822 141
58 3300026142 Ga0207698_11438158 Ga0207698_114381582 141
59 3300041443 Ga0451789_0433449 Ga0451789_0433449_49_492 141
60 3300048912 Ga0496109_0011850 Ga0496109_0011850_1798_2241 141
61 3300048915 Ga0496112_0078081 Ga0496112_0078081_2434_2877 141
62 3300041452 Ga0451793_1268181 Ga0451793_1268181_298_729 142
63 3300041491 Ga0451833_0794404 Ga0451833_0794404_390_821 142
64 iso_pu_bacteria 2929212328 2929214129 142
65 3300005353 Ga0070669_100038266 Ga0070669_1000382665 143
66 3300005367 Ga0070667_100000027 Ga0070667_100000027138 143
67 3300005548 Ga0070665_100514012 Ga0070665_1005140122 143
68 3300005617 Ga0068859_100000806 Ga0068859_1000008062 143
69 3300005618 Ga0068864_100345225 Ga0068864_1003452252 143
70 3300005842 Ga0068858_100028603 Ga0068858_1000286036 143
71 3300005843 Ga0068860_100000144 Ga0068860_10000014426 143
72 3300005844 Ga0068862_100000177 Ga0068862_10000017755 143
73 3300006038 Ga0075365_10002900 Ga0075365_100029002 143
74 3300006048 Ga0075363_100004816 Ga0075363_1000048165 143
75 3300006048 Ga0075363_100165005 Ga0075363_1001650052 143
76 3300006051 Ga0075364_10027369 Ga0075364_100273696 143
77 3300006177 Ga0075362_10094382 Ga0075362_100943822 143
78 3300006177 Ga0075362_10123782 Ga0075362_101237822 143
79 3300006178 Ga0075367_10000643 Ga0075367_100006433 143
80 3300006178 Ga0075367_10190423 Ga0075367_101904232 143
81 3300006186 Ga0075369_10053323 Ga0075369_100533233 143
82 3300006186 Ga0075369_10216497 Ga0075369_102164972 143
83 3300006353 Ga0075370_10011175 Ga0075370_100111759 143
84 3300006353 Ga0075370_10020325 Ga0075370_100203255 143
85 3300006931 Ga0097620_100000806 Ga0097620_10000080630 143
86 3300009101 Ga0105247_10000113 Ga0105247_1000011312 143
87 3300009177 Ga0105248_10000054 Ga0105248_1000005482 143
88 3300009553 Ga0105249_10000013 Ga0105249_10000013138 143
89 3300013306 Ga0163162_10110560 Ga0163162_101105603 143
90 3300014325 Ga0163163_10041943 Ga0163163_100419435 143
91 3300014968 Ga0157379_10932214 Ga0157379_109322142 143
92 3300017792 Ga0163161_11237646 Ga0163161_112376461 143
93 3300025900 Ga0207710_10000141 Ga0207710_1000014171 143
94 3300025923 Ga0207681_10002592 Ga0207681_100025925 143
95 3300025941 Ga0207711_10000396 Ga0207711_1000039625 143
96 3300025961 Ga0207712_10000018 Ga0207712_10000018154 143
97 3300025986 Ga0207658_10000235 Ga0207658_100002352 143
98 3300026035 Ga0207703_10022828 Ga0207703_100228285 143
99 3300026095 Ga0207676_10238058 Ga0207676_102380582 143
100 3300028379 Ga0268266_10013474 Ga0268266_100134744 143
101 3300028380 Ga0268265_10000147 Ga0268265_1000014755 143
102 3300028381 Ga0268264_10000005 Ga0268264_10000005753 143
103 3300044656 Ga0466969_0160564 Ga0466969_0160564_27_461 143
104 3300046507 Ga0495606_0100391 Ga0495606_0100391_1000_1437 143
105 3300046524 Ga0495648_0003936 Ga0495648_0003936_4582_5019 143
106 3300046648 Ga0495611_0024594 Ga0495611_0024594_358_795 143
107 3300047320 Ga0495672_0002388 Ga0495672_0002388_4574_5011 143
108 3300047469 Ga0495673_0002662 Ga0495673_0002662_8338_8775 143
109 3300048903 Ga0496100_0217744 Ga0496100_0217744_458_892 143
110 3300048904 Ga0496101_0044789 Ga0496101_0044789_2410_2844 143
111 3300048905 Ga0496102_0000063 Ga0496102_0000063_75052_75486 143
112 3300048906 Ga0496103_0000783 Ga0496103_0000783_17252_17686 143
113 3300048910 Ga0496107_0999372 Ga0496107_0999372_10_444 143
114 3300048920 Ga0496117_0000552 Ga0496117_0000552_52789_53223 143
115 3300048921 Ga0496118_0000317 Ga0496118_0000317_82960_83394 143
116 3300048924 Ga0496121_0002407 Ga0496121_0002407_8288_8722 143
117 3300048928 Ga0496125_0148854 Ga0496125_0148854_1115_1549 143
118 3300048929 Ga0496126_0270401 Ga0496126_0270401_64_498 143
119 3300050489 nmdc:mga03683_130925_c1 nmdc:mga03683_130925_c1_323_757 143
120 3300050489 nmdc:mga03683_134115_c1 nmdc:mga03683_134115_c1_256_690 143
121 3300050490 nmdc:mga03n38_174766_c1 nmdc:mga03n38_174766_c1_245_679 143
122 3300050491 nmdc:mga00v17_165048_c1 nmdc:mga00v17_165048_c1_208_642 143
123 3300050491 nmdc:mga00v17_28615_c1 nmdc:mga00v17_28615_c1_363_797 143
124 3300050492 nmdc:mga0yw44_13981_c1 nmdc:mga0yw44_13981_c1_423_857 143
125 3300050494 nmdc:mga06z11_267044_c1 nmdc:mga06z11_267044_c1_390_824 143
126 3300050494 nmdc:mga06z11_28014_c1 nmdc:mga06z11_28014_c1_1677_2111 143
127 3300050496 nmdc:mga07m45_16854_c1 nmdc:mga07m45_16854_c1_3225_3659 143
128 3300050496 nmdc:mga07m45_8774_c1 nmdc:mga07m45_8774_c1_4102_4536 143
129 3300050516 nmdc:mga0sz30_68139_c2 nmdc:mga0sz30_68139_c2_84_518 143
130 3300050516 nmdc:mga0sz30_90896_c1 nmdc:mga0sz30_90896_c1_598_1032 143
131 3300053087 Ga0500643_005206 Ga0500643_005206_3016_3453 143
132 3300053090 Ga0500646_0150846 Ga0500646_0150846_100_534 143
133 3300053155 Ga0500620_026574 Ga0500620_026574_135_569 143
134 3300053727 Ga0500611_107033 Ga0500611_107033_159_593 143
135 3300005937 Ga0081455_10345181 Ga0081455_103451811 145
136 3300001977 JGI24746J21847_1003788 JGI24746J21847_10037885 146
137 3300001991 JGI24743J22301_10001242 JGI24743J22301_100012423 146
138 3300002070 JGI24750J21931_1007953 JGI24750J21931_10079532 146
139 3300002070 JGI24750J21931_1016606 JGI24750J21931_10166061 146
140 3300002077 JGI24744J21845_10000282 JGI24744J21845_100002827 146
141 3300002239 JGI24034J26672_10032255 JGI24034J26672_100322551 146
142 3300002239 JGI24034J26672_10039379 JGI24034J26672_100393791 146
143 3300002244 JGI24742J22300_10011467 JGI24742J22300_100114672 146
144 3300002459 JGI24751J29686_10003134 JGI24751J29686_100031342 146
145 3300003544 Ga0007417J51691_1112541 Ga0007417J51691_11125411 146
146 3300003577 Ga0007416J51690_1063536 Ga0007416J51690_10635361 146
147 3300005328 Ga0070676_10062158 Ga0070676_100621583 146
148 3300005328 Ga0070676_10063638 Ga0070676_100636383 146
149 3300005330 Ga0070690_100015939 Ga0070690_1000159395 146
150 3300005330 Ga0070690_100188540 Ga0070690_1001885402 146
151 3300005333 Ga0070677_10458286 Ga0070677_104582862 146
152 3300005334 Ga0068869_100052993 Ga0068869_1000529933 146
153 3300005335 Ga0070666_10051576 Ga0070666_100515763 146
154 3300005335 Ga0070666_10274324 Ga0070666_102743242 146
155 3300005337 Ga0070682_100091257 Ga0070682_1000912571 146
156 3300005337 Ga0070682_100163502 Ga0070682_1001635021 146
157 3300005338 Ga0068868_100024084 Ga0068868_1000240843 146
158 3300005338 Ga0068868_100078675 Ga0068868_1000786753 146
159 3300005339 Ga0070660_100582550 Ga0070660_1005825501 146
160 3300005340 Ga0070689_100090359 Ga0070689_1000903592 146
161 3300005340 Ga0070689_100316606 Ga0070689_1003166061 146
162 3300005341 Ga0070691_10119314 Ga0070691_101193142 146
163 3300005343 Ga0070687_100056035 Ga0070687_1000560352 146
164 3300005343 Ga0070687_101115093 Ga0070687_1011150931 146
165 3300005347 Ga0070668_100000644 Ga0070668_1000006442 146
166 3300005347 Ga0070668_100027252 Ga0070668_1000272523 146
167 3300005347 Ga0070668_100116324 Ga0070668_1001163243 146
168 3300005347 Ga0070668_100216220 Ga0070668_1002162202 146
169 3300005353 Ga0070669_100078819 Ga0070669_1000788191 146
170 3300005353 Ga0070669_100157400 Ga0070669_1001574001 146
171 3300005354 Ga0070675_100118108 Ga0070675_1001181081 146
172 3300005355 Ga0070671_100020489 Ga0070671_1000204894 146
173 3300005355 Ga0070671_100064694 Ga0070671_1000646944 146
174 3300005355 Ga0070671_100195675 Ga0070671_1001956752 146
175 3300005355 Ga0070671_100226580 Ga0070671_1002265801 146
176 3300005356 Ga0070674_100018730 Ga0070674_1000187305 146
177 3300005364 Ga0070673_100264785 Ga0070673_1002647851 146
178 3300005364 Ga0070673_100631604 Ga0070673_1006316042 146
179 3300005366 Ga0070659_100121418 Ga0070659_1001214181 146
180 3300005366 Ga0070659_100131929 Ga0070659_1001319293 146
181 3300005367 Ga0070667_100006471 Ga0070667_1000064713 146
182 3300005367 Ga0070667_100011027 Ga0070667_1000110271 146
183 3300005367 Ga0070667_100025029 Ga0070667_1000250293 146
184 3300005367 Ga0070667_100029491 Ga0070667_1000294912 146
185 3300005367 Ga0070667_100082525 Ga0070667_1000825252 146
186 3300005434 Ga0070709_10758874 Ga0070709_107588741 146
187 3300005434 Ga0070709_11225064 Ga0070709_112250641 146
188 3300005435 Ga0070714_100432604 Ga0070714_1004326042 146
189 3300005436 Ga0070713_100548069 Ga0070713_1005480691 146
190 3300005437 Ga0070710_10009449 Ga0070710_100094496 146
191 3300005437 Ga0070710_10011254 Ga0070710_100112543 146
192 3300005438 Ga0070701_10001234 Ga0070701_100012345 146
193 3300005438 Ga0070701_10196495 Ga0070701_101964952 146
194 3300005439 Ga0070711_100002249 Ga0070711_10000224911 146
195 3300005439 Ga0070711_100002973 Ga0070711_1000029736 146
196 3300005440 Ga0070705_100156418 Ga0070705_1001564181 146
197 3300005440 Ga0070705_100473665 Ga0070705_1004736652 146
198 3300005441 Ga0070700_100015066 Ga0070700_1000150664 146
199 3300005441 Ga0070700_100097096 Ga0070700_1000970961 146
200 3300005444 Ga0070694_100324575 Ga0070694_1003245752 146
201 3300005455 Ga0070663_100031005 Ga0070663_1000310056 146
202 3300005455 Ga0070663_100133248 Ga0070663_1001332481 146
203 3300005456 Ga0070678_100000026 Ga0070678_1000000262 146
204 3300005457 Ga0070662_100003925 Ga0070662_10000392510 146
205 3300005457 Ga0070662_100053679 Ga0070662_1000536791 146
206 3300005458 Ga0070681_11886011 Ga0070681_118860111 146
207 3300005459 Ga0068867_100051185 Ga0068867_1000511852 146
208 3300005466 Ga0070685_10138026 Ga0070685_101380261 146
209 3300005518 Ga0070699_101691886 Ga0070699_1016918861 146
210 3300005539 Ga0068853_100011537 Ga0068853_1000115372 146
211 3300005539 Ga0068853_100087678 Ga0068853_1000876785 146
212 3300005543 Ga0070672_100024124 Ga0070672_1000241243 146
213 3300005543 Ga0070672_100166255 Ga0070672_1001662553 146
214 3300005544 Ga0070686_100189281 Ga0070686_1001892811 146
215 3300005544 Ga0070686_100195686 Ga0070686_1001956862 146
216 3300005545 Ga0070695_100007859 Ga0070695_1000078595 146
217 3300005546 Ga0070696_100010279 Ga0070696_1000102796 146
218 3300005546 Ga0070696_100429707 Ga0070696_1004297072 146
219 3300005547 Ga0070693_100036106 Ga0070693_1000361064 146
220 3300005547 Ga0070693_100313310 Ga0070693_1003133102 146
221 3300005548 Ga0070665_100006996 Ga0070665_1000069962 146
222 3300005548 Ga0070665_100378591 Ga0070665_1003785912 146
223 3300005548 Ga0070665_100685567 Ga0070665_1006855672 146
224 3300005548 Ga0070665_101020698 Ga0070665_1010206982 146
225 3300005549 Ga0070704_100000086 Ga0070704_10000008632 146
226 3300005563 Ga0068855_100072802 Ga0068855_1000728025 146
227 3300005563 Ga0068855_100642285 Ga0068855_1006422851 146
228 3300005578 Ga0068854_100000670 Ga0068854_1000006704 146
229 3300005578 Ga0068854_100045883 Ga0068854_1000458833 146
230 3300005614 Ga0068856_100178883 Ga0068856_1001788833 146
231 3300005615 Ga0070702_100622213 Ga0070702_1006222131 146
232 3300005615 Ga0070702_100736221 Ga0070702_1007362211 146
233 3300005616 Ga0068852_100162876 Ga0068852_1001628763 146
234 3300005617 Ga0068859_100018271 Ga0068859_1000182714 146
235 3300005617 Ga0068859_101254518 Ga0068859_1012545181 146
236 3300005618 Ga0068864_100760923 Ga0068864_1007609232 146
237 3300005718 Ga0068866_10008189 Ga0068866_100081893 146
238 3300005718 Ga0068866_10083241 Ga0068866_100832412 146
239 3300005719 Ga0068861_100007495 Ga0068861_1000074958 146
240 3300005719 Ga0068861_100123562 Ga0068861_1001235624 146
241 3300005719 Ga0068861_100446789 Ga0068861_1004467891 146
242 3300005840 Ga0068870_10176919 Ga0068870_101769191 146
243 3300005841 Ga0068863_100046724 Ga0068863_1000467246 146
244 3300005841 Ga0068863_100174668 Ga0068863_1001746682 146
245 3300005841 Ga0068863_100330515 Ga0068863_1003305152 146
246 3300005841 Ga0068863_101046761 Ga0068863_1010467612 146
247 3300005842 Ga0068858_100046743 Ga0068858_1000467432 146
248 3300005842 Ga0068858_100050895 Ga0068858_1000508953 146
249 3300005842 Ga0068858_102578793 Ga0068858_1025787931 146
250 3300005843 Ga0068860_100032026 Ga0068860_1000320262 146
251 3300005843 Ga0068860_100108263 Ga0068860_1001082633 146
252 3300005843 Ga0068860_100316909 Ga0068860_1003169091 146
253 3300005844 Ga0068862_100119079 Ga0068862_1001190791 146
254 3300005844 Ga0068862_100272236 Ga0068862_1002722363 146
255 3300005844 Ga0068862_100587331 Ga0068862_1005873312 146
256 3300005937 Ga0081455_10060465 Ga0081455_100604653 146
257 3300005981 Ga0081538_10061246 Ga0081538_100612461 146
258 3300005981 Ga0081538_10194269 Ga0081538_101942691 146
259 3300005981 Ga0081538_10218091 Ga0081538_102180912 146
260 3300006038 Ga0075365_10035354 Ga0075365_100353542 146
261 3300006042 Ga0075368_10232679 Ga0075368_102326792 146
262 3300006048 Ga0075363_100003254 Ga0075363_1000032549 146
263 3300006048 Ga0075363_100044696 Ga0075363_1000446962 146
264 3300006048 Ga0075363_100123306 Ga0075363_1001233063 146
265 3300006048 Ga0075363_100303550 Ga0075363_1003035502 146
266 3300006048 Ga0075363_100379349 Ga0075363_1003793492 146
267 3300006048 Ga0075363_100643812 Ga0075363_1006438122 146
268 3300006051 Ga0075364_10011668 Ga0075364_100116685 146
269 3300006051 Ga0075364_10986687 Ga0075364_109866872 146
270 3300006173 Ga0070716_100018741 Ga0070716_1000187413 146
271 3300006173 Ga0070716_100285609 Ga0070716_1002856092 146
272 3300006175 Ga0070712_100020726 Ga0070712_1000207266 146
273 3300006178 Ga0075367_10048805 Ga0075367_100488052 146
274 3300006178 Ga0075367_10107755 Ga0075367_101077552 146
275 3300006178 Ga0075367_10649486 Ga0075367_106494862 146
276 3300006178 Ga0075367_10729176 Ga0075367_107291762 146
277 3300006186 Ga0075369_10001234 Ga0075369_100012345 146
278 3300006186 Ga0075369_10003471 Ga0075369_100034715 146
279 3300006186 Ga0075369_10163781 Ga0075369_101637812 146
280 3300006186 Ga0075369_10177491 Ga0075369_101774912 146
281 3300006186 Ga0075369_10208753 Ga0075369_102087531 146
282 3300006186 Ga0075369_10233506 Ga0075369_102335061 146
283 3300006186 Ga0075369_10282846 Ga0075369_102828461 146
284 3300006237 Ga0097621_100072991 Ga0097621_1000729915 146
285 3300006353 Ga0075370_10049185 Ga0075370_100491854 146
286 3300006353 Ga0075370_10087459 Ga0075370_100874592 146
287 3300006353 Ga0075370_10125995 Ga0075370_101259952 146
288 3300006353 Ga0075370_10420908 Ga0075370_104209082 146
289 3300006358 Ga0068871_100167479 Ga0068871_1001674792 146
290 3300006844 Ga0075428_100557645 Ga0075428_1005576452 146
291 3300006846 Ga0075430_100456165 Ga0075430_1004561651 146
292 3300006847 Ga0075431_100553023 Ga0075431_1005530231 146
293 3300006880 Ga0075429_100780012 Ga0075429_1007800122 146
294 3300006881 Ga0068865_100000236 Ga0068865_1000002363 146
295 3300006931 Ga0097620_100018270 Ga0097620_1000182704 146
296 3300006931 Ga0097620_101254509 Ga0097620_1012545091 146
297 3300007076 Ga0075435_100952947 Ga0075435_1009529472 146
298 3300009092 Ga0105250_10155846 Ga0105250_101558462 146
299 3300009098 Ga0105245_10000766 Ga0105245_100007665 146
300 3300009101 Ga0105247_10000167 Ga0105247_1000016765 146
301 3300009101 Ga0105247_10064063 Ga0105247_100640632 146
302 3300009147 Ga0114129_10071479 Ga0114129_100714794 146
303 3300009148 Ga0105243_10008152 Ga0105243_100081525 146
304 3300009174 Ga0105241_10088001 Ga0105241_100880013 146
305 3300009176 Ga0105242_10004135 Ga0105242_100041358 146
306 3300009176 Ga0105242_10074893 Ga0105242_100748934 146
307 3300009177 Ga0105248_10019850 Ga0105248_100198504 146
308 3300009545 Ga0105237_10035568 Ga0105237_100355682 146
309 3300009545 Ga0105237_10203719 Ga0105237_102037191 146
310 3300009551 Ga0105238_12656531 Ga0105238_126565311 146
311 3300009553 Ga0105249_10008633 Ga0105249_100086333 146
312 3300009553 Ga0105249_10040990 Ga0105249_100409905 146
313 3300009553 Ga0105249_10488825 Ga0105249_104888251 146
314 3300009553 Ga0105249_10978943 Ga0105249_109789431 146
315 3300010375 Ga0105239_10608368 Ga0105239_106083682 146
316 3300010375 Ga0105239_10722781 Ga0105239_107227812 146
317 3300010375 Ga0105239_11535736 Ga0105239_115357361 146
318 3300010375 Ga0105239_11997248 Ga0105239_119972482 146
319 3300011119 Ga0105246_10033306 Ga0105246_100333065 146
320 3300013102 Ga0157371_10340036 Ga0157371_103400362 146
321 3300013104 Ga0157370_11012243 Ga0157370_110122431 146
322 3300013105 Ga0157369_10902268 Ga0157369_109022681 146
323 3300013105 Ga0157369_11424723 Ga0157369_114247231 146
324 3300013297 Ga0157378_10000337 Ga0157378_1000033746 146
325 3300013297 Ga0157378_10106969 Ga0157378_101069695 146
326 3300013306 Ga0163162_10020441 Ga0163162_100204415 146
327 3300013306 Ga0163162_10176412 Ga0163162_101764124 146
328 3300013306 Ga0163162_10491158 Ga0163162_104911583 146
329 3300013306 Ga0163162_11017431 Ga0163162_110174311 146
330 3300013307 Ga0157372_10142712 Ga0157372_101427122 146
331 3300013307 Ga0157372_10823303 Ga0157372_108233032 146
332 3300013308 Ga0157375_10007277 Ga0157375_100072776 146
333 3300013308 Ga0157375_10279100 Ga0157375_102791002 146
334 3300013308 Ga0157375_11130968 Ga0157375_111309682 146
335 3300014325 Ga0163163_11335507 Ga0163163_113355071 146
336 3300014326 Ga0157380_10005958 Ga0157380_100059583 146
337 3300014326 Ga0157380_10031241 Ga0157380_100312415 146
338 3300014745 Ga0157377_10189498 Ga0157377_101894981 146
339 3300014968 Ga0157379_10016713 Ga0157379_100167135 146
340 3300014969 Ga0157376_10030729 Ga0157376_100307295 146
341 3300014969 Ga0157376_10070364 Ga0157376_100703643 146
342 3300017792 Ga0163161_10001646 Ga0163161_1000164619 146
343 3300017792 Ga0163161_10139082 Ga0163161_101390822 146
344 3300025711 Ga0207696_1046291 Ga0207696_10462911 146
345 3300025898 Ga0207692_10003610 Ga0207692_100036107 146
346 3300025899 Ga0207642_10000213 Ga0207642_1000021317 146
347 3300025900 Ga0207710_10015921 Ga0207710_100159215 146
348 3300025900 Ga0207710_10018428 Ga0207710_100184285 146
349 3300025901 Ga0207688_10003303 Ga0207688_100033038 146
350 3300025901 Ga0207688_10010209 Ga0207688_100102092 146
351 3300025903 Ga0207680_10016094 Ga0207680_100160946 146
352 3300025903 Ga0207680_10438750 Ga0207680_104387502 146
353 3300025904 Ga0207647_10061000 Ga0207647_100610001 146
354 3300025904 Ga0207647_10212527 Ga0207647_102125271 146
355 3300025905 Ga0207685_10010450 Ga0207685_100104503 146
356 3300025906 Ga0207699_10021835 Ga0207699_100218353 146
357 3300025906 Ga0207699_10150966 Ga0207699_101509662 146
358 3300025906 Ga0207699_10843280 Ga0207699_108432801 146
359 3300025907 Ga0207645_10045299 Ga0207645_100452995 146
360 3300025907 Ga0207645_10063817 Ga0207645_100638173 146
361 3300025911 Ga0207654_10049184 Ga0207654_100491845 146
362 3300025911 Ga0207654_10217267 Ga0207654_102172671 146
363 3300025914 Ga0207671_10146995 Ga0207671_101469952 146
364 3300025914 Ga0207671_10812517 Ga0207671_108125171 146
365 3300025915 Ga0207693_10001529 Ga0207693_1000152914 146
366 3300025915 Ga0207693_10001755 Ga0207693_100017555 146
367 3300025916 Ga0207663_10011505 Ga0207663_100115057 146
368 3300025916 Ga0207663_10017273 Ga0207663_100172736 146
369 3300025918 Ga0207662_10717434 Ga0207662_107174341 146
370 3300025919 Ga0207657_10058995 Ga0207657_100589955 146
371 3300025923 Ga0207681_10370492 Ga0207681_103704922 146
372 3300025926 Ga0207659_10136341 Ga0207659_101363411 146
373 3300025927 Ga0207687_10001172 Ga0207687_1000117220 146
374 3300025928 Ga0207700_11199519 Ga0207700_111995192 146
375 3300025931 Ga0207644_10131454 Ga0207644_101314541 146
376 3300025931 Ga0207644_10549846 Ga0207644_105498462 146
377 3300025932 Ga0207690_10061385 Ga0207690_100613852 146
378 3300025932 Ga0207690_10434823 Ga0207690_104348231 146
379 3300025933 Ga0207706_10002731 Ga0207706_1000273110 146
380 3300025934 Ga0207686_10005157 Ga0207686_100051577 146
381 3300025934 Ga0207686_10375676 Ga0207686_103756762 146
382 3300025935 Ga0207709_10027794 Ga0207709_100277945 146
383 3300025936 Ga0207670_10119094 Ga0207670_101190941 146
384 3300025937 Ga0207669_10003717 Ga0207669_100037173 146
385 3300025938 Ga0207704_10012730 Ga0207704_100127306 146
386 3300025938 Ga0207704_10022463 Ga0207704_100224632 146
387 3300025939 Ga0207665_10000902 Ga0207665_1000090214 146
388 3300025939 Ga0207665_10012269 Ga0207665_1001226910 146
389 3300025939 Ga0207665_10162910 Ga0207665_101629102 146
390 3300025940 Ga0207691_10039539 Ga0207691_100395396 146
391 3300025940 Ga0207691_10054079 Ga0207691_100540792 146
392 3300025941 Ga0207711_10002263 Ga0207711_1000226319 146
393 3300025941 Ga0207711_10771479 Ga0207711_107714791 146
394 3300025942 Ga0207689_10012536 Ga0207689_100125369 146
395 3300025942 Ga0207689_10443893 Ga0207689_104438932 146
396 3300025949 Ga0207667_10209977 Ga0207667_102099772 146
397 3300025960 Ga0207651_11087643 Ga0207651_110876431 146
398 3300025960 Ga0207651_11090052 Ga0207651_110900521 146
399 3300025961 Ga0207712_10001400 Ga0207712_100014006 146
400 3300025961 Ga0207712_10187062 Ga0207712_101870622 146
401 3300025961 Ga0207712_10195494 Ga0207712_101954943 146
402 3300025961 Ga0207712_11153194 Ga0207712_111531942 146
403 3300025972 Ga0207668_10018436 Ga0207668_100184366 146
404 3300025972 Ga0207668_10836994 Ga0207668_108369941 146
405 3300025972 Ga0207668_11285062 Ga0207668_112850622 146
406 3300025981 Ga0207640_10059028 Ga0207640_100590281 146
407 3300025986 Ga0207658_10044384 Ga0207658_100443844 146
408 3300025986 Ga0207658_10083656 Ga0207658_100836564 146
409 3300025986 Ga0207658_10085228 Ga0207658_100852283 146
410 3300025986 Ga0207658_10096259 Ga0207658_100962594 146
411 3300025986 Ga0207658_11542663 Ga0207658_115426631 146
412 3300026023 Ga0207677_10074471 Ga0207677_100744713 146
413 3300026035 Ga0207703_10023445 Ga0207703_100234453 146
414 3300026035 Ga0207703_10056177 Ga0207703_100561776 146
415 3300026041 Ga0207639_10167599 Ga0207639_101675992 146
416 3300026067 Ga0207678_10019829 Ga0207678_100198294 146
417 3300026067 Ga0207678_10061878 Ga0207678_100618785 146
418 3300026075 Ga0207708_10000975 Ga0207708_1000097513 146
419 3300026075 Ga0207708_10076943 Ga0207708_100769432 146
420 3300026078 Ga0207702_10090618 Ga0207702_100906185 146
421 3300026078 Ga0207702_10218834 Ga0207702_102188343 146
422 3300026088 Ga0207641_10014004 Ga0207641_100140042 146
423 3300026088 Ga0207641_10056853 Ga0207641_100568532 146
424 3300026089 Ga0207648_10003108 Ga0207648_1000310812 146
425 3300026089 Ga0207648_10018595 Ga0207648_100185957 146
426 3300026118 Ga0207675_100000200 Ga0207675_1000002005 146
427 3300026118 Ga0207675_100121696 Ga0207675_1001216963 146
428 3300026118 Ga0207675_100199143 Ga0207675_1001991431 146
429 3300026118 Ga0207675_100399154 Ga0207675_1003991542 146
430 3300026118 Ga0207675_101234945 Ga0207675_1012349452 146
431 3300026121 Ga0207683_10000437 Ga0207683_1000043725 146
432 3300026142 Ga0207698_10036588 Ga0207698_100365882 146
433 3300028379 Ga0268266_10004557 Ga0268266_100045572 146
434 3300028379 Ga0268266_10019242 Ga0268266_100192427 146
435 3300028379 Ga0268266_10096260 Ga0268266_100962605 146
436 3300028380 Ga0268265_10091939 Ga0268265_100919391 146
437 3300028380 Ga0268265_10650093 Ga0268265_106500932 146
438 3300028380 Ga0268265_10750550 Ga0268265_107505502 146
439 3300028381 Ga0268264_10008081 Ga0268264_1000808111 146
440 3300028381 Ga0268264_10893406 Ga0268264_108934062 146
441 3300028381 Ga0268264_11586863 Ga0268264_115868631 146
442 3300031824 Ga0307413_10024838 Ga0307413_100248384 146
443 3300031852 Ga0307410_10005976 Ga0307410_100059763 146
444 3300031852 Ga0307410_11278852 Ga0307410_112788522 146
445 3300031901 Ga0307406_10061863 Ga0307406_100618634 146
446 3300031903 Ga0307407_10699022 Ga0307407_106990221 146
447 3300031903 Ga0307407_10872538 Ga0307407_108725381 146
448 3300031911 Ga0307412_10361542 Ga0307412_103615421 146
449 3300031995 Ga0307409_100046574 Ga0307409_1000465742 146
450 3300032002 Ga0307416_100012724 Ga0307416_1000127245 146
451 3300032002 Ga0307416_100970933 Ga0307416_1009709332 146
452 3300032005 Ga0307411_10040877 Ga0307411_100408773 146
453 3300032126 Ga0307415_100000828 Ga0307415_10000082813 146
454 3300032126 Ga0307415_100308084 Ga0307415_1003080842 146
455 3300035085 Ga0373929_0129176 Ga0373929_0129176_193_633 146
456 3300035090 Ga0373949_0012365 Ga0373949_0012365_1002_1442 146
457 3300035114 Ga0373939_0039841 Ga0373939_0039841_227_667 146
458 3300035241 Ga0373961_0035174 Ga0373961_0035174_905_1345 146
459 3300035691 Ga0373931_0020072 Ga0373931_0020072_318_758 146
460 3300041410 Ga0439461_0237203 Ga0439461_0237203_24_467 146
461 3300041411 Ga0439466_0004690 Ga0439466_0004690_237_677 146
462 3300041413 Ga0439465_0002119 Ga0439465_0002119_4767_5210 146
463 3300041413 Ga0439465_0016809 Ga0439465_0016809_548_991 146
464 3300041413 Ga0439465_0060902 Ga0439465_0060902_342_782 146
465 3300041512 Ga0451853_0780145 Ga0451853_0780145_18_461 146
466 3300042004 Ga0439445_0011318 Ga0439445_0011318_848_1288 146
467 3300042004 Ga0439445_0014793 Ga0439445_0014793_1445_1888 146
468 3300042435 Ga0439434_0003471 Ga0439434_0003471_3969_4409 146
469 3300044658 Ga0466972_0181634 Ga0466972_0181634_281_721 146
470 3300044683 Ga0466965_0603979 Ga0466965_0603979_90_533 146
471 3300044693 Ga0466961_0087423 Ga0466961_0087423_841_1284 146
472 3300044719 Ga0466971_0017221 Ga0466971_0017221_1592_2035 146
473 3300044765 Ga0466970_0046302 Ga0466970_0046302_781_1224 146
474 3300044765 Ga0466970_0141580 Ga0466970_0141580_96_536 146
475 3300044901 Ga0466960_0007880 Ga0466960_0007880_3156_3596 146
476 3300045049 Ga0466959_0144757 Ga0466959_0144757_92_535 146
477 3300045836 Ga0466958_0373457 Ga0466958_0373457_214_654 146
478 3300045976 Ga0466967_0154390 Ga0466967_0154390_1654_2094 146
479 3300046694 Ga0495649_0180927 Ga0495649_0180927_401_841 146
480 3300046794 Ga0495589_0162442 Ga0495589_0162442_508_948 146
481 3300047320 Ga0495672_0337762 Ga0495672_0337762_103_546 146
482 3300048091 Ga0495626_0258963 Ga0495626_0258963_51_494 146
483 3300048903 Ga0496100_0003167 Ga0496100_0003167_2903_3343 146
484 3300048903 Ga0496100_0137800 Ga0496100_0137800_53_493 146
485 3300048904 Ga0496101_0004704 Ga0496101_0004704_5065_5505 146
486 3300048904 Ga0496101_0247291 Ga0496101_0247291_737_1177 146
487 3300048905 Ga0496102_0000826 Ga0496102_0000826_149_589 146
488 3300048905 Ga0496102_0384683 Ga0496102_0384683_668_1108 146
489 3300048906 Ga0496103_0001339 Ga0496103_0001339_2906_3346 146
490 3300048906 Ga0496103_0048784 Ga0496103_0048784_815_1255 146
491 3300048906 Ga0496103_0441978 Ga0496103_0441978_259_699 146
492 3300048907 Ga0496104_0257487 Ga0496104_0257487_718_1158 146
493 3300048908 Ga0496105_0463516 Ga0496105_0463516_266_706 146
494 3300048909 Ga0496106_0000621 Ga0496106_0000621_12164_12604 146
495 3300048909 Ga0496106_0032820 Ga0496106_0032820_2054_2494 146
496 3300048910 Ga0496107_0039232 Ga0496107_0039232_2771_3211 146
497 3300048911 Ga0496108_0184372 Ga0496108_0184372_292_732 146
498 3300048912 Ga0496109_0048473 Ga0496109_0048473_1755_2195 146
499 3300048912 Ga0496109_0754064 Ga0496109_0754064_38_478 146
500 3300048915 Ga0496112_0007702 Ga0496112_0007702_3938_4378 146
501 3300048915 Ga0496112_0021941 Ga0496112_0021941_107_547 146
502 3300048916 Ga0496113_0069107 Ga0496113_0069107_872_1312 146
503 3300048916 Ga0496113_0154942 Ga0496113_0154942_1352_1792 146
504 3300048917 Ga0496114_0003036 Ga0496114_0003036_6932_7372 146
505 3300048918 Ga0496115_0045063 Ga0496115_0045063_522_962 146
506 3300048921 Ga0496118_0160484 Ga0496118_0160484_212_652 146
507 3300049571 Ga0501034_0025129 Ga0501034_0025129_5407_5853 146
508 3300050489 nmdc:mga03683_89389_c1 nmdc:mga03683_89389_c1_647_1087 146
509 3300050490 nmdc:mga03n38_31123_c1 nmdc:mga03n38_31123_c1_381_821 146
510 3300050490 nmdc:mga03n38_355582_c1 nmdc:mga03n38_355582_c1_307_747 146
511 3300050491 nmdc:mga00v17_1662_c1 nmdc:mga00v17_1662_c1_5276_5716 146
512 3300050491 nmdc:mga00v17_899437_c1 nmdc:mga00v17_899437_c1_43_483 146
513 3300050494 nmdc:mga06z11_246112_c1 nmdc:mga06z11_246112_c1_99_539 146
514 3300050494 nmdc:mga06z11_47464_c1 nmdc:mga06z11_47464_c1_1523_1963 146
515 3300050496 nmdc:mga07m45_126565_c1 nmdc:mga07m45_126565_c1_490_930 146
516 3300050496 nmdc:mga07m45_211933_c1 nmdc:mga07m45_211933_c1_116_556 146
517 3300050496 nmdc:mga07m45_42909_c1 nmdc:mga07m45_42909_c1_1222_1662 146
518 3300050496 nmdc:mga07m45_76011_c1 nmdc:mga07m45_76011_c1_836_1276 146
519 3300050507 nmdc:mga05p37_278708_c1 nmdc:mga05p37_278708_c1_1463_1903 146
520 3300050509 nmdc:mga0qj67_486713_c1 nmdc:mga0qj67_486713_c1_485_925 146
521 3300050509 nmdc:mga0qj67_78158_c1 nmdc:mga0qj67_78158_c1_1774_2217 146
522 3300050516 nmdc:mga0sz30_11024_c1 nmdc:mga0sz30_11024_c1_500_940 146
523 3300050516 nmdc:mga0sz30_157995_c1 nmdc:mga0sz30_157995_c1_465_905 146
524 3300050516 nmdc:mga0sz30_17011_c1 nmdc:mga0sz30_17011_c1_2194_2637 146
525 3300050516 nmdc:mga0sz30_356049_c1 nmdc:mga0sz30_356049_c1_115_555 146
526 3300050516 nmdc:mga0sz30_5566_c1 nmdc:mga0sz30_5566_c1_2250_2693 146
527 3300059490 Ga0587066_140733 Ga0587066_140733_11_454 146
528 3300059505 Ga0587083_0183475 Ga0587083_0183475_119_559 146
529 3300059506 Ga0587085_053465 Ga0587085_053465_134_577 146
530 3300059506 Ga0587085_104160 Ga0587085_104160_125_565 146
531 3300059511 Ga0587091_150864 Ga0587091_150864_130_573 146
532 3300059625 Ga0587113_012298 Ga0587113_012298_130_573 146
533 3300059630 Ga0587128_101590 Ga0587128_101590_35_478 146
534 3300059630 Ga0587128_107821 Ga0587128_107821_130_570 146
535 3300059639 Ga0587062_025301 Ga0587062_025301_134_577 146
536 3300059642 Ga0587069_091994 Ga0587069_091994_138_581 146
537 3300059647 Ga0587079_237705 Ga0587079_237705_19_462 146
538 3300059652 Ga0587107_097925 Ga0587107_097925_125_565 146
539 3300060346 Ga0587111_0173390 Ga0587111_0173390_134_577 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

27

128

0.96

PF13466

STAS_2

STAS domain

38

116

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vc1-assembly1.cif.gz_B crystal structure of the tm1442 protein from thermotoga maritima, a homolog of the bacillus subtilis general stress response anti-anti-sigma factor rsbv 0.8921 22 127
3if5-assembly1.cif.gz_A-2 crystal structure analysis of mglu 0.8918 26 99
6m36-assembly1.cif.gz_H the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8876 22 120
4qtp-assembly3.cif.gz_C crystal structure of an anti-sigma factor antagonist from mycobacterium paratuberculosis 0.8809 22 133
1til-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii 0.8807 22 131
ID Description Score Start End Superfamily
3if5A02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8918 26 99 3.30.750.24
af_O33361_34_143_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8862 30 132 3.30.750.24
af_Q55FJ8_836_995_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8805 29 133 3.30.750.24
4qtpB00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8791 20 133 3.30.750.24
af_A0A1D6Q0R8_688_836_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8683 30 132 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A7W8CB57-F1-model_v4 Anti-anti-sigma regulatory factor 0.9711 23 132
AF-A0A6S6P5T1-F1-model_v4 STAS domain-containing protein 0.9692 19 122
AF-A0A0I9TJF6-F1-model_v4 deleted 0.9672 23 133
AF-A0A1A3TN29-F1-model_v4 STAS domain-containing protein 0.9656 38 132
AF-A0A0J6W684-F1-model_v4 STAS domain protein 0.9638 36 121

Feature Viewer

pLDDT pTM Quality
86.17 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map