F461111

General Info

Members Datasets Scaffolds Average Seq Length
539 330 1078 150

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100642419|Ga0070705_1006424191
Length 181
Sequence MVERGLGVKVAADGDWDYSAGFPTGMSSMSLRAKINDDLKAAMKAGDKRKVSALRLMNAAIKDKDINSRTDGHDSMLTADAGLIELFAKMVTQRQESLGMYEQGGRPELAQQEREEIEVIQSYMPKQLSEDEAKKAVAAVIAAVGATSVKDMGKVMAELKARYAGQMDMAKAGGIVKGVLG

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
162 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
163 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
178 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
189 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
190 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
191 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
192 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
227 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
263 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
266 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
271 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
301 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
302 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
303 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
304 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
305 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
306 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
307 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
308 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
309 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
310 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
311 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
312 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
313 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
314 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
315 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
316 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
317 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
318 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
319 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
320 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
321 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
324 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
325 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
326 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
327 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
328 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
329 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
330 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0.37
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.76
Nodule 0
Rhizoplane 5.19
Rhizosphere 77.37
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100642419 3300005440 Bacteria 826
2 JGI24741J21665_1001343 3300001915 Bacteria 7134
3 JGI24741J21665_1016365 3300001915 Bacteria 1211
4 JGI24747J21853_1039958 3300001978 Bacteria 555
5 JGI24740J21852_10044474 3300001979 Bacteria 1318
6 JGI24740J21852_10047532 3300001979 Bacteria 1252
7 JGI24740J21852_10052507 3300001979 Bacteria 1160
8 JGI24737J22298_10029642 3300001990 Bacteria 1715
9 JGI24737J22298_10181254 3300001990 Bacteria 622
10 JGI25153J46596_10000006 3300003215 Bacteria 447760
11 Ga0055525_1000051 3300003759 Bacteria 240942
12 Ga0055542_1000020 3300003762 Bacteria 335745
13 Ga0055529_1000016 3300003763 Bacteria 364775
14 Ga0055530_10000978 3300003791 Bacteria 23058
15 Ga0055531_10001645 3300003794 Bacteria 16155
16 Ga0065165_1039706 3300005262 Bacteria 1408
17 Ga0065704_10070209 3300005289 Bacteria 78459
18 Ga0065704_10288184 3300005289 Bacteria 899
19 Ga0070658_10001558 3300005327 Bacteria 19439
20 Ga0070658_10514482 3300005327 Bacteria 1035
21 Ga0070676_10537856 3300005328 Bacteria 835
22 Ga0070676_11024555 3300005328 Bacteria 621
23 Ga0070683_100105670 3300005329 Bacteria 2654
24 Ga0070683_100361830 3300005329 Bacteria 1382
25 Ga0070690_100452281 3300005330 Bacteria 952
26 Ga0070680_100025291 3300005336 Bacteria 4744
27 Ga0070680_100105728 3300005336 Bacteria 2340
28 Ga0070680_101088607 3300005336 Bacteria 691
29 Ga0070660_100616784 3300005339 Bacteria 908
30 Ga0070691_10143677 3300005341 Bacteria 1218
31 Ga0070661_100001207 3300005344 Bacteria 18191
32 Ga0070661_100227527 3300005344 Bacteria 1432
33 Ga0070661_100241612 3300005344 Bacteria 1391
34 Ga0070661_100514733 3300005344 Bacteria 959
35 Ga0070661_100624656 3300005344 Bacteria 873
36 Ga0070668_100437766 3300005347 Bacteria 1122
37 Ga0070668_100750172 3300005347 Bacteria 864
38 Ga0070668_101477547 3300005347 Bacteria 621
39 Ga0070669_101168684 3300005353 Unclassified 664
40 Ga0070675_100083570 3300005354 Bacteria 2665
41 Ga0070671_100167790 3300005355 Bacteria 1856
42 Ga0070674_100003705 3300005356 Bacteria 8611
43 Ga0070673_100105514 3300005364 Bacteria 2328
44 Ga0070688_100268431 3300005365 Bacteria 1221
45 Ga0070659_100010912 3300005366 Bacteria 6704
46 Ga0070659_100037913 3300005366 Bacteria 3758
47 Ga0070659_100135769 3300005366 Bacteria 2000
48 Ga0070659_100852005 3300005366 Bacteria 794
49 Ga0070701_10847703 3300005438 Bacteria 627
50 Ga0070694_101797019 3300005444 Bacteria 522
51 Ga0070663_100015002 3300005455 Bacteria 4985
52 Ga0070663_100131892 3300005455 Bacteria 1898
53 Ga0070663_100529178 3300005455 Bacteria 982
54 Ga0070678_100002746 3300005456 Bacteria 9719
55 Ga0070678_100355077 3300005456 Bacteria 1261
56 Ga0070662_100079444 3300005457 Bacteria 2439
57 Ga0070662_100102735 3300005457 Bacteria 2166
58 Ga0070662_100179222 3300005457 Bacteria 1669
59 Ga0070681_10051662 3300005458 Bacteria 4100
60 Ga0070681_10508080 3300005458 Bacteria 1118
61 Ga0070681_10830435 3300005458 Bacteria 841
62 Ga0068867_100164780 3300005459 Bacteria 1751
63 Ga0070679_100116995 3300005530 Bacteria 2650
64 Ga0070679_100311193 3300005530 Bacteria 1525
65 Ga0070684_100245445 3300005535 Bacteria 1636
66 Ga0068853_100277896 3300005539 Bacteria 1543
67 Ga0068853_101154062 3300005539 Bacteria 747
68 Ga0070695_100107393 3300005545 Bacteria 1889
69 Ga0070695_101871363 3300005545 Bacteria 504
70 Ga0070693_100160888 3300005547 Bacteria 1430
71 Ga0070665_100000086 3300005548 Bacteria 178229
72 Ga0068855_100014403 3300005563 Bacteria 9520
73 Ga0068855_100056391 3300005563 Bacteria 4610
74 Ga0068855_100153248 3300005563 Bacteria 2619
75 Ga0068855_102113559 3300005563 Bacteria 567
76 Ga0070664_100127003 3300005564 Bacteria 2238
77 Ga0070664_101227536 3300005564 Bacteria 707
78 Ga0068857_100113850 3300005577 Bacteria 2432
79 Ga0068857_100262150 3300005577 Bacteria 1586
80 Ga0068857_100330325 3300005577 Bacteria 1409
81 Ga0068857_100516176 3300005577 Bacteria 1123
82 Ga0068857_100703105 3300005577 Bacteria 960
83 Ga0068857_101457618 3300005577 Bacteria 666
84 Ga0068854_100007023 3300005578 Bacteria 7184
85 Ga0068854_100263108 3300005578 Bacteria 1382
86 Ga0068854_100762176 3300005578 Bacteria 840
87 Ga0068854_100912930 3300005578 Bacteria 772
88 Ga0068856_100039275 3300005614 Bacteria 4646
89 Ga0068856_100044943 3300005614 Bacteria 4347
90 Ga0068852_100294333 3300005616 Bacteria 1569
91 Ga0068852_100414429 3300005616 Bacteria 1328
92 Ga0068852_100956688 3300005616 Bacteria 874
93 Ga0068852_101261386 3300005616 Bacteria 760
94 Ga0068864_100004572 3300005618 Bacteria 11360
95 Ga0068866_11080001 3300005718 Bacteria 574
96 Ga0068858_100003942 3300005842 Bacteria 14653
97 Ga0068858_100004671 3300005842 Bacteria 13425
98 Ga0081540_1058576 3300005983 Bacteria 1854
99 Ga0075364_10000558 3300006051 Bacteria 19112
100 Ga0075364_10144158 3300006051 Bacteria 1603
101 Ga0075362_10033788 3300006177 Bacteria 2226
102 Ga0075369_10168819 3300006186 Bacteria 1004
103 Ga0075369_10355187 3300006186 Bacteria 688
104 Ga0075366_10440412 3300006195 Bacteria 804
105 Ga0075370_10064180 3300006353 Bacteria 2094
106 Ga0068871_100120143 3300006358 Bacteria 2219
107 Ga0075428_100157408 3300006844 Bacteria 2467
108 Ga0075436_100887794 3300006914 Bacteria 666
109 Ga0105240_10877559 3300009093 Bacteria 966
110 Ga0111539_10043887 3300009094 Bacteria 5358
111 Ga0105245_10001264 3300009098 Bacteria 22840
112 Ga0114129_10097405 3300009147 Bacteria 4073
113 Ga0105243_10000876 3300009148 Bacteria 28409
114 Ga0105243_10090243 3300009148 Bacteria 2521
115 Ga0105243_10378055 3300009148 Bacteria 1309
116 Ga0105241_10005567 3300009174 Bacteria 9302
117 Ga0105241_11039065 3300009174 Bacteria 768
118 Ga0105242_10315579 3300009176 Bacteria 1432
119 Ga0105242_12462550 3300009176 Bacteria 568
120 Ga0105248_10032166 3300009177 Bacteria 5863
121 Ga0105237_10572783 3300009545 Bacteria 1136
122 Ga0105237_11171168 3300009545 Bacteria 775
123 Ga0105237_11393989 3300009545 Bacteria 707
124 Ga0105238_10078871 3300009551 Bacteria 3283
125 Ga0105238_10759244 3300009551 Bacteria 984
126 Ga0105249_10129555 3300009553 Bacteria 2407
127 Ga0105249_10186603 3300009553 Bacteria 2021
128 Ga0105249_10254844 3300009553 Bacteria 1741
129 Ga0105239_10281371 3300010375 Bacteria 1873
130 Ga0105239_10552011 3300010375 Bacteria 1312
131 Ga0105239_10580702 3300010375 Bacteria 1278
132 Ga0105239_11409832 3300010375 Bacteria 804
133 Ga0105239_11573566 3300010375 Bacteria 760
134 Ga0105239_12362118 3300010375 Bacteria 619
135 Ga0105246_10087502 3300011119 Bacteria 2236
136 Ga0105246_11019284 3300011119 Bacteria 751
137 Ga0105246_11432129 3300011119 Bacteria 646
138 Ga0157326_1005102 3300012513 Bacteria 1383
139 Ga0157373_10039441 3300013100 Bacteria 3381
140 Ga0157373_10139492 3300013100 Bacteria 1705
141 Ga0157373_10429590 3300013100 Bacteria 949
142 Ga0157371_10000030 3300013102 Bacteria 241585
143 Ga0157371_10002409 3300013102 Bacteria 17899
144 Ga0157370_10019186 3300013104 Bacteria 6873
145 Ga0157370_10229647 3300013104 Bacteria 1718
146 Ga0157369_11226738 3300013105 Bacteria 765
147 Ga0157374_10452704 3300013296 Bacteria 1285
148 Ga0157374_11915949 3300013296 Bacteria 619
149 Ga0157378_10097664 3300013297 Bacteria 2677
150 Ga0163162_10007973 3300013306 Bacteria 10326
151 Ga0163162_11932419 3300013306 Bacteria 676
152 Ga0157372_10559031 3300013307 Bacteria 1334
153 Ga0157372_10583815 3300013307 Bacteria 1302
154 Ga0157372_10893478 3300013307 Bacteria 1031
155 Ga0157372_11171676 3300013307 Bacteria 888
156 Ga0157372_11475709 3300013307 Bacteria 783
157 Ga0157375_10594570 3300013308 Bacteria 1266
158 Ga0182008_10983098 3300014497 Bacteria 502
159 Ga0157376_10133664 3300014969 Bacteria 2217
160 Ga0157376_11117040 3300014969 Bacteria 814
161 Ga0163161_10040465 3300017792 Bacteria 3348
162 Ga0213876_10111727 3300021384 Bacteria 1450
163 Ga0209563_100019 3300025230 Bacteria 697828
164 Ga0209148_1000017 3300025254 Bacteria 787064
165 Ga0209233_1000154 3300025261 Bacteria 169616
166 Ga0209233_1006001 3300025261 Bacteria 3962
167 Ga0209455_1000005 3300025272 Bacteria 1416756
168 Ga0209758_1000001 3300025297 Bacteria 1981790
169 Ga0209050_1000026 3300025298 Bacteria 499134
170 Ga0209257_1000009 3300025304 Bacteria 1205047
171 Ga0207697_10051021 3300025315 Bacteria 1709
172 Ga0207688_10098205 3300025901 Bacteria 1688
173 Ga0207647_10028951 3300025904 Bacteria 3591
174 Ga0207685_10367945 3300025905 Bacteria 729
175 Ga0207699_10101340 3300025906 Bacteria 1828
176 Ga0207645_10063405 3300025907 Bacteria 2361
177 Ga0207645_10226838 3300025907 Bacteria 1232
178 Ga0207705_10000531 3300025909 Bacteria 32288
179 Ga0207654_10000190 3300025911 Bacteria 37976
180 Ga0207707_10025034 3300025912 Bacteria 5222
181 Ga0207707_10052670 3300025912 Bacteria 3542
182 Ga0207695_10042726 3300025913 Bacteria 4837
183 Ga0207695_10271977 3300025913 Bacteria 1590
184 Ga0207671_10003175 3300025914 Bacteria 16591
185 Ga0207671_10966219 3300025914 Bacteria 672
186 Ga0207657_10071975 3300025919 Bacteria 2926
187 Ga0207657_10264374 3300025919 Bacteria 1368
188 Ga0207657_10427421 3300025919 Bacteria 1041
189 Ga0207649_10011496 3300025920 Bacteria 4882
190 Ga0207649_10199092 3300025920 Bacteria 1414
191 Ga0207649_10395839 3300025920 Bacteria 1033
192 Ga0207649_10453742 3300025920 Bacteria 968
193 Ga0207652_10048264 3300025921 Bacteria 3639
194 Ga0207694_10081519 3300025924 Bacteria 2542
195 Ga0207694_10094568 3300025924 Bacteria 2361
196 Ga0207694_10097248 3300025924 Bacteria 2329
197 Ga0207694_10466872 3300025924 Bacteria 1055
198 Ga0207694_10704448 3300025924 Bacteria 852
199 Ga0207659_10013104 3300025926 Bacteria 5301
200 Ga0207687_10003410 3300025927 Bacteria 10718
201 Ga0207690_10001685 3300025932 Bacteria 13618
202 Ga0207690_10285531 3300025932 Bacteria 1286
203 Ga0207706_10001012 3300025933 Bacteria 28668
204 Ga0207706_10052514 3300025933 Bacteria 3599
205 Ga0207686_10730249 3300025934 Bacteria 789
206 Ga0207709_10000031 3300025935 Bacteria 329046
207 Ga0207709_10220463 3300025935 Bacteria 1368
208 Ga0207669_10000077 3300025937 Bacteria 49918
209 Ga0207669_10029565 3300025937 Bacteria 3032
210 Ga0207711_10017656 3300025941 Bacteria 5926
211 Ga0207689_10191169 3300025942 Bacteria 1689
212 Ga0207689_11728374 3300025942 Bacteria 518
213 Ga0207661_10239584 3300025944 Bacteria 1609
214 Ga0207661_10318223 3300025944 Bacteria 1398
215 Ga0207679_10180840 3300025945 Bacteria 1744
216 Ga0207667_10000004 3300025949 Bacteria 737718
217 Ga0207667_10121091 3300025949 Bacteria 2696
218 Ga0207651_10030156 3300025960 Bacteria 3449
219 Ga0207712_10079964 3300025961 Bacteria 2376
220 Ga0207668_10221701 3300025972 Bacteria 1519
221 Ga0207640_10029437 3300025981 Bacteria 3371
222 Ga0207640_10416612 3300025981 Bacteria 1098
223 Ga0207658_10071753 3300025986 Bacteria 2623
224 Ga0207677_11010558 3300026023 Bacteria 754
225 Ga0207677_11201815 3300026023 Bacteria 694
226 Ga0207703_10001326 3300026035 Bacteria 22701
227 Ga0207703_10002565 3300026035 Bacteria 15695
228 Ga0207703_11384412 3300026035 Bacteria 677
229 Ga0207639_10037912 3300026041 Bacteria 3583
230 Ga0207639_10097153 3300026041 Bacteria 2371
231 Ga0207678_10171549 3300026067 Bacteria 1852
232 Ga0207678_10311323 3300026067 Bacteria 1354
233 Ga0207678_10758873 3300026067 Bacteria 855
234 Ga0207702_10000642 3300026078 Bacteria 38293
235 Ga0207648_10040752 3300026089 Bacteria 4080
236 Ga0207648_10404454 3300026089 Bacteria 1237
237 Ga0207676_10007867 3300026095 Bacteria 7580
238 Ga0207674_10087556 3300026116 Bacteria 3108
239 Ga0207674_10307914 3300026116 Bacteria 1533
240 Ga0207674_10394029 3300026116 Bacteria 1338
241 Ga0207674_10400558 3300026116 Bacteria 1326
242 Ga0207698_10105894 3300026142 Bacteria 2344
243 Ga0207698_10749307 3300026142 Bacteria 975
244 Ga0207698_10999615 3300026142 Bacteria 847
245 Ga0207698_11011503 3300026142 Bacteria 842
246 Ga0210002_1032920 3300027617 Bacteria 866
247 Ga0209971_1154517 3300027682 Bacteria 566
248 Ga0209998_10011875 3300027717 Bacteria 1808
249 Ga0268266_10000002 3300028379 Bacteria 3059047
250 Ga0307517_10035306 3300028786 Bacteria 5665
251 Ga0265338_11035185 3300028800 Bacteria 555
252 Ga0316182_1308535 3300030745 Bacteria 568
253 Ga0265327_10123173 3300031251 Bacteria 1226
254 Ga0307513_10235409 3300031456 Bacteria 1641
255 Ga0307513_10371019 3300031456 Bacteria 1173
256 Ga0307513_10480595 3300031456 Bacteria 962
257 Ga0307509_10623807 3300031507 Bacteria 749
258 Ga0307408_100076682 3300031548 Bacteria 2487
259 Ga0316579_10006704 3300031691 Bacteria 4713
260 Ga0316579_10417458 3300031691 Bacteria 649
261 Ga0265314_10008944 3300031711 Bacteria 8529
262 Ga0316576_10435361 3300031727 Bacteria 969
263 Ga0316576_10650699 3300031727 Bacteria 766
264 Ga0316576_10681855 3300031727 Bacteria 746
265 Ga0316578_10023162 3300031728 Bacteria 3473
266 Ga0316578_10188511 3300031728 Bacteria 1242
267 Ga0307516_10536883 3300031730 Bacteria 823
268 Ga0307405_10316380 3300031731 Bacteria 1190
269 Ga0307405_10759391 3300031731 Bacteria 809
270 Ga0307405_10798462 3300031731 Bacteria 790
271 Ga0316577_10179788 3300031733 Bacteria 1194
272 Ga0307413_10186022 3300031824 Bacteria 1486
273 Ga0307413_10599412 3300031824 Bacteria 901
274 Ga0307410_10346822 3300031852 Bacteria 1185
275 Ga0307410_10991444 3300031852 Bacteria 724
276 Ga0307412_10023153 3300031911 Bacteria 3818
277 Ga0307412_10076349 3300031911 Bacteria 2301
278 Ga0307412_10513923 3300031911 Bacteria 999
279 Ga0307416_100311290 3300032002 Bacteria 1571
280 Ga0307416_100661116 3300032002 Bacteria 1131
281 Ga0307414_11019294 3300032004 Bacteria 762
282 Ga0307411_10540412 3300032005 Bacteria 992
283 Ga0307415_100167809 3300032126 Bacteria 1709
284 Ga0307415_100238801 3300032126 Bacteria 1468
285 Ga0307415_101740959 3300032126 Bacteria 602
286 Ga0316583_10018558 3300032133 Bacteria 2497
287 Ga0316585_10272369 3300032137 Bacteria 561
288 Ga0316580_10030556 3300032139 Bacteria 1668
289 Ga0307510_10195604 3300033180 Bacteria 1564
290 Ga0373926_0028754 3300035083 Bacteria 1952
291 Ga0373932_0122345 3300035112 Bacteria 869
292 Ga0373943_0049186 3300035170 Bacteria 2068
293 Ga0373946_0184367 3300035171 Bacteria 992
294 Ga0373961_0164171 3300035241 Bacteria 765
295 Ga0316574_0701526 3300035398 Bacteria 620
296 Ga0373924_0514666 3300035410 Bacteria 538
297 Ga0373931_0017764 3300035691 Bacteria 3524
298 Ga0373935_0227642 3300035692 Bacteria 1297
299 Ga0373935_0770095 3300035692 Bacteria 710
300 Ga0373927_0012254 3300035695 Bacteria 5705
301 Ga0373933_0306367 3300035724 Bacteria 1029
302 Ga0373947_0013628 3300035725 Bacteria 4656
303 Ga0316582_0858058 3300036647 Bacteria 621
304 Ga0316584_0036331 3300036712 Bacteria 3655
305 Ga0373925_0054302 3300037068 Bacteria 2996
306 Ga0373925_0096599 3300037068 Unclassified 2265
307 Ga0395899_0316674 3300037312 Bacteria 1052
308 Ga0395905_0081929 3300037471 Bacteria 3024
309 Ga0395905_0082380 3300037471 Bacteria 3015
310 Ga0395905_0271644 3300037471 Bacteria 1581
311 Ga0395905_0365844 3300037471 Bacteria 1335
312 Ga0316581_0053247 3300037588 Bacteria 1240
313 Ga0395901_0078158 3300038443 Bacteria 3455
314 Ga0395901_0133979 3300038443 Bacteria 2604
315 Ga0395901_1404846 3300038443 Bacteria 656
316 Ga0400483_118183 3300039062 Bacteria 7064
317 Ga0436365_0451774 3300039437 Bacteria 987
318 Ga0436365_1683674 3300039437 Bacteria 1837
319 Ga0436363_1555732 3300039450 Bacteria 776
320 Ga0436362_1224760 3300039453 Bacteria 1040
321 Ga0451791_0405096 3300041451 Bacteria 1034
322 Ga0451793_0536722 3300041452 Bacteria 739
323 Ga0451797_0626230 3300041453 Bacteria 856
324 Ga0451845_0355435 3300041501 Bacteria 677
325 Ga0451855_0355703 3300041511 Bacteria 669
326 Ga0451853_1144479 3300041512 Bacteria 674
327 Ga0439448_0076338 3300042005 Bacteria 1121
328 Ga0451576_0000007 3300045051 Bacteria 782228
329 Ga0495627_001497 3300046453 Bacteria 13504
330 Ga0495603_0002724 3300046455 Bacteria 10418
331 Ga0495629_0000907 3300046459 Bacteria 23785
332 Ga0495638_0007575 3300046460 Bacteria 7766
333 Ga0495650_0000340 3300046471 Bacteria 83278
334 Ga0495580_0013222 3300046472 Bacteria 6309
335 Ga0495582_0018038 3300046473 Bacteria 3859
336 Ga0495639_0004636 3300046475 Bacteria 5901
337 Ga0495584_0015856 3300046491 Bacteria 3844
338 Ga0495584_0630224 3300046491 Bacteria 547
339 Ga0495594_0001129 3300046499 Bacteria 13930
340 Ga0495596_0052404 3300046500 Bacteria 1597
341 Ga0495583_0019131 3300046506 Bacteria 3583
342 Ga0495583_0019651 3300046506 Bacteria 3520
343 Ga0495583_0034397 3300046506 Bacteria 2427
344 Ga0495583_0148538 3300046506 Bacteria 972
345 Ga0495606_0000824 3300046507 Bacteria 47072
346 Ga0495630_0211328 3300046517 Bacteria 1481
347 Ga0495631_0208054 3300046518 Bacteria 836
348 Ga0495632_0083915 3300046519 Bacteria 1517
349 Ga0495637_0014507 3300046520 Bacteria 3718
350 Ga0495643_0008432 3300046522 Bacteria 6522
351 Ga0495643_0012592 3300046522 Bacteria 5096
352 Ga0495643_0013731 3300046522 Bacteria 4837
353 Ga0495643_0051552 3300046522 Bacteria 2213
354 Ga0495643_0382958 3300046522 Bacteria 623
355 Ga0495643_0384346 3300046522 Bacteria 622
356 Ga0495643_0434514 3300046522 Bacteria 574
357 Ga0495644_0073745 3300046523 Bacteria 1284
358 Ga0495648_0000303 3300046524 Bacteria 54717
359 Ga0495663_0014875 3300046525 Bacteria 2186
360 Ga0495666_0144415 3300046526 Bacteria 1108
361 Ga0495642_0106863 3300046528 Bacteria 1194
362 Ga0495609_0014516 3300046538 Bacteria 3701
363 Ga0495622_0018094 3300046557 Bacteria 3282
364 Ga0495622_0032906 3300046557 Bacteria 2420
365 Ga0495633_0007722 3300046558 Bacteria 6152
366 Ga0495633_0043068 3300046558 Bacteria 2142
367 Ga0495633_0091765 3300046558 Bacteria 1412
368 Ga0495633_0103301 3300046558 Bacteria 1322
369 Ga0495668_0000007 3300046616 Bacteria 552902
370 Ga0495634_0047892 3300046642 Bacteria 2879
371 Ga0495611_0150263 3300046648 Bacteria 1087
372 Ga0495625_0001479 3300046660 Bacteria 28402
373 Ga0495625_0009233 3300046660 Bacteria 8278
374 Ga0495625_0013066 3300046660 Bacteria 6691
375 Ga0495625_0025766 3300046660 Bacteria 4453
376 Ga0495625_0144593 3300046660 Bacteria 1602
377 Ga0495625_0214403 3300046660 Bacteria 1264
378 Ga0495625_0284306 3300046660 Bacteria 1063
379 Ga0495625_0789239 3300046660 Bacteria 553
380 Ga0495661_0086288 3300046665 Bacteria 1797
381 Ga0495588_0026414 3300046674 Bacteria 2898
382 Ga0495669_0000507 3300046684 Bacteria 17678
383 Ga0495669_0396514 3300046684 Bacteria 669
384 Ga0495613_0006945 3300046689 Bacteria 8444
385 Ga0495624_0102958 3300046690 Bacteria 1757
386 Ga0495670_0049902 3300046691 Bacteria 2094
387 Ga0495670_0052447 3300046691 Bacteria 2042
388 Ga0495671_0080673 3300046692 Bacteria 1594
389 Ga0495671_0424616 3300046692 Bacteria 636
390 Ga0495600_0013303 3300046809 Bacteria 5167
391 Ga0495660_0157130 3300046810 Bacteria 1118
392 Ga0495581_0017676 3300047315 Bacteria 4143
393 Ga0495676_0448560 3300047321 Bacteria 851
394 Ga0495680_0418595 3300047322 Bacteria 922
395 Ga0495683_0030887 3300047323 Bacteria 2731
396 Ga0495683_0204867 3300047323 Bacteria 887
397 Ga0495687_004439 3300047443 Bacteria 9474
398 Ga0495687_013793 3300047443 Bacteria 4194
399 Ga0495677_0006691 3300047445 Bacteria 4339
400 Ga0495681_0000011 3300047470 Bacteria 201843
401 Ga0495681_0150222 3300047470 Bacteria 978
402 Ga0495684_0544525 3300047471 Bacteria 791
403 Ga0495686_0052596 3300047472 Bacteria 2553
404 Ga0495593_0004291 3300047673 Bacteria 8477
405 Ga0495614_0015186 3300048089 Bacteria 3359
406 Ga0496101_0459223 3300048904 Bacteria 1005
407 Ga0496102_0011729 3300048905 Bacteria 7563
408 Ga0496102_0177808 3300048905 Bacteria 2004
409 Ga0496102_0779161 3300048905 Bacteria 879
410 Ga0496102_1407386 3300048905 Bacteria 616
411 Ga0496102_1609536 3300048905 Bacteria 568
412 Ga0496103_0000836 3300048906 Bacteria 22508
413 Ga0496103_0121314 3300048906 Bacteria 1665
414 Ga0496104_0033295 3300048907 Bacteria 4800
415 Ga0496104_0831456 3300048907 Bacteria 829
416 Ga0496105_0052177 3300048908 Bacteria 3376
417 Ga0496105_0196454 3300048908 Bacteria 1648
418 Ga0496105_0343701 3300048908 Bacteria 1193
419 Ga0496106_0288845 3300048909 Bacteria 1315
420 Ga0496107_0141097 3300048910 Bacteria 1781
421 Ga0496107_0754666 3300048910 Bacteria 714
422 Ga0496110_0501370 3300048913 Bacteria 1105
423 Ga0496111_0007641 3300048914 Bacteria 7105
424 Ga0496112_0011677 3300048915 Bacteria 8035
425 Ga0496113_0163203 3300048916 Bacteria 1762
426 Ga0496113_1172694 3300048916 Bacteria 601
427 Ga0496114_0137219 3300048917 Bacteria 2115
428 Ga0496114_0195286 3300048917 Bacteria 1771
429 Ga0496115_0000597 3300048918 Bacteria 27647
430 Ga0496115_0002445 3300048918 Bacteria 13344
431 Ga0496116_0017799 3300048919 Bacteria 5501
432 Ga0496117_0000182 3300048920 Bacteria 128076
433 Ga0496117_0179801 3300048920 Bacteria 1217
434 Ga0496118_0000125 3300048921 Bacteria 136422
435 Ga0496118_0073182 3300048921 Bacteria 2456
436 Ga0496119_0010214 3300048922 Bacteria 7921
437 Ga0496120_0033907 3300048923 Bacteria 3063
438 Ga0496121_0000367 3300048924 Bacteria 92745
439 Ga0496121_0007290 3300048924 Bacteria 13381
440 Ga0496121_0034537 3300048924 Bacteria 4551
441 Ga0496121_0129749 3300048924 Bacteria 1889
442 Ga0496122_0023643 3300048925 Bacteria 5406
443 Ga0496122_0036059 3300048925 Bacteria 4009
444 Ga0496123_0024694 3300048926 Bacteria 4559
445 Ga0496123_0041016 3300048926 Bacteria 3215
446 Ga0496124_0000082 3300048927 Bacteria 208248
447 Ga0496125_0002269 3300048928 Bacteria 25512
448 Ga0496126_0000221 3300048929 Bacteria 124193
449 Ga0496126_0633262 3300048929 Bacteria 839
450 Ga0495678_226482 3300049459 Bacteria 565
451 Ga0501031_0475813 3300049568 Bacteria 806
452 Ga0501036_0300804 3300049572 Bacteria 1342
453 Ga0501036_0698343 3300049572 Bacteria 838
454 Ga0501037_0130539 3300049573 Bacteria 1802
455 Ga0501037_0419393 3300049573 Bacteria 916
456 Ga0501038_0024065 3300049574 Bacteria 5435
457 Ga0501038_0162203 3300049574 Bacteria 1816
458 Ga0501038_0272083 3300049574 Bacteria 1335
459 Ga0501039_0121841 3300049575 Bacteria 2044
460 Ga0501039_0590748 3300049575 Bacteria 870
461 Ga0501040_0053816 3300049576 Bacteria 2758
462 Ga0501041_0163729 3300049577 Bacteria 1391
463 Ga0501042_0090173 3300049578 Bacteria 2200
464 Ga0501042_0140537 3300049578 Bacteria 1741
465 Ga0501042_0281248 3300049578 Bacteria 1202
466 Ga0501046_0171634 3300049580 Bacteria 1627
467 Ga0501046_0356179 3300049580 Bacteria 1062
468 Ga0501046_0886504 3300049580 Bacteria 623
469 Ga0501068_0082693 3300049584 Bacteria 1973
470 Ga0501070_0582583 3300049586 Bacteria 893
471 Ga0501071_0014849 3300049587 Bacteria 5335
472 Ga0501072_0207638 3300049588 Bacteria 1561
473 Ga0501073_0913935 3300049589 Bacteria 604
474 Ga0501074_0561793 3300049590 Bacteria 808
475 Ga0501074_1062612 3300049590 Bacteria 569
476 Ga0501075_0084906 3300049591 Bacteria 2398
477 Ga0501076_0099355 3300049592 Bacteria 2344
478 Ga0501076_0107757 3300049592 Bacteria 2250
479 Ga0501077_0321028 3300049593 Bacteria 987
480 Ga0501079_0074851 3300049741 Bacteria 2618
481 Ga0501080_0510921 3300049742 Bacteria 1073
482 Ga0501081_0058001 3300049743 Bacteria 2678
483 Ga0501081_0136410 3300049743 Bacteria 1756
484 Ga0501081_0688437 3300049743 Bacteria 767
485 Ga0501081_1150548 3300049743 Bacteria 587
486 Ga0501044_0327664 3300049823 Bacteria 1455
487 Ga0501045_0304397 3300049824 Bacteria 1186
488 Ga0501045_0782595 3300049824 Bacteria 703
489 nmdc:mga03683_7580_c1 3300050489 Bacteria 3774
490 nmdc:mga00v17_302228_c1 3300050491 Bacteria 1039
491 nmdc:mga00v17_5943_c1 3300050491 Bacteria 6454
492 nmdc:mga0k408_214869_c1 3300050493 Bacteria 1148
493 nmdc:mga0k408_53081_c1 3300050493 Bacteria 2349
494 nmdc:mga07m45_41377_c1 3300050496 Bacteria 2580
495 nmdc:mga08y16_142307_c1 3300050511 Bacteria 1523
496 nmdc:mga08y16_821233_c1 3300050511 Bacteria 921
497 nmdc:mga0a205_699074_c1 3300050515 Bacteria 864
498 nmdc:mga0sz30_18727_c2 3300050516 Bacteria 886
499 Ga0495612_0128142 3300053078 Bacteria 1095
500 Ga0500610_0000140 3300053079 Bacteria 21620
501 Ga0495619_0004011 3300053085 Bacteria 9435
502 Ga0500643_000001 3300053087 Bacteria 1440111
503 Ga0500643_009771 3300053087 Bacteria 3637
504 Ga0500643_009963 3300053087 Bacteria 3581
505 Ga0500643_059905 3300053087 Bacteria 1070
506 Ga0500647_0253708 3300053091 Bacteria 772
507 Ga0500651_0497353 3300053093 Bacteria 673
508 Ga0500641_0040456 3300053096 Bacteria 1883
509 Ga0500555_002842 3300053103 Bacteria 4971
510 Ga0500562_011833 3300053108 Bacteria 2217
511 Ga0500562_070644 3300053108 Bacteria 942
512 Ga0500595_010172 3300053119 Bacteria 3750
513 Ga0500642_0000804 3300053130 Bacteria 9202
514 Ga0500559_0103072 3300053136 Bacteria 1316
515 Ga0500559_0183075 3300053136 Bacteria 987
516 Ga0500559_0322299 3300053136 Bacteria 724
517 Ga0500573_0239100 3300053140 Bacteria 943
518 Ga0500616_0007018 3300053153 Bacteria 7233
519 Ga0500616_0081604 3300053153 Bacteria 1624
520 Ga0500616_0133312 3300053153 Bacteria 1171
521 Ga0500619_176045 3300053154 Bacteria 723
522 Ga0500624_000666 3300053157 Bacteria 8884
523 Ga0500636_0033551 3300053177 Bacteria 3038
524 Ga0500636_0088068 3300053177 Bacteria 1781
525 Ga0500645_000080 3300053730 Bacteria 76756
526 Ga0500645_142269 3300053730 Bacteria 663
527 Ga0500596_004831 3300053735 Bacteria 2435
528 Ga0500661_026348 3300055283 Bacteria 1027
529 Ga0500661_085737 3300055283 Bacteria 587
530 Ga0587101_048128 3300059623 Bacteria 726
531 Ga0587111_0089978 3300060346 Bacteria 748
532 Ga0530510_0020509 3300061734 Bacteria 4699
533 2512032812 2511231221 Bacteria 6846400
534 2753764448 2751185897 Bacteria 5322941
535 2879165714 2879163058 Bacteria 4223965
536 2882807873 2882806704 Bacteria 3007728
537 2928527570 2928526807 Bacteria 4760224
538 3000865972 3000865235 Bacteria 3106258
539 8054006304 8054002106 Bacteria 7987183
540 Ga0070705_100642419
541 JGI24741J21665_1001343
542 JGI24741J21665_1016365
543 JGI24747J21853_1039958
544 JGI24740J21852_10044474
545 JGI24740J21852_10047532
546 JGI24740J21852_10052507
547 JGI24737J22298_10029642
548 JGI24737J22298_10181254
549 JGI25153J46596_10000006
550 Ga0055525_1000051
551 Ga0055542_1000020
552 Ga0055529_1000016
553 Ga0055530_10000978
554 Ga0055531_10001645
555 Ga0065165_1039706
556 Ga0065704_10070209
557 Ga0065704_10288184
558 Ga0070658_10001558
559 Ga0070658_10514482
560 Ga0070676_10537856
561 Ga0070676_11024555
562 Ga0070683_100105670
563 Ga0070683_100361830
564 Ga0070690_100452281
565 Ga0070680_100025291
566 Ga0070680_100105728
567 Ga0070680_101088607
568 Ga0070660_100616784
569 Ga0070691_10143677
570 Ga0070661_100001207
571 Ga0070661_100227527
572 Ga0070661_100241612
573 Ga0070661_100514733
574 Ga0070661_100624656
575 Ga0070668_100437766
576 Ga0070668_100750172
577 Ga0070668_101477547
578 Ga0070669_101168684
579 Ga0070675_100083570
580 Ga0070671_100167790
581 Ga0070674_100003705
582 Ga0070673_100105514
583 Ga0070688_100268431
584 Ga0070659_100010912
585 Ga0070659_100037913
586 Ga0070659_100135769
587 Ga0070659_100852005
588 Ga0070701_10847703
589 Ga0070694_101797019
590 Ga0070663_100015002
591 Ga0070663_100131892
592 Ga0070663_100529178
593 Ga0070678_100002746
594 Ga0070678_100355077
595 Ga0070662_100079444
596 Ga0070662_100102735
597 Ga0070662_100179222
598 Ga0070681_10051662
599 Ga0070681_10508080
600 Ga0070681_10830435
601 Ga0068867_100164780
602 Ga0070679_100116995
603 Ga0070679_100311193
604 Ga0070684_100245445
605 Ga0068853_100277896
606 Ga0068853_101154062
607 Ga0070695_100107393
608 Ga0070695_101871363
609 Ga0070693_100160888
610 Ga0070665_100000086
611 Ga0068855_100014403
612 Ga0068855_100056391
613 Ga0068855_100153248
614 Ga0068855_102113559
615 Ga0070664_100127003
616 Ga0070664_101227536
617 Ga0068857_100113850
618 Ga0068857_100262150
619 Ga0068857_100330325
620 Ga0068857_100516176
621 Ga0068857_100703105
622 Ga0068857_101457618
623 Ga0068854_100007023
624 Ga0068854_100263108
625 Ga0068854_100762176
626 Ga0068854_100912930
627 Ga0068856_100039275
628 Ga0068856_100044943
629 Ga0068852_100294333
630 Ga0068852_100414429
631 Ga0068852_100956688
632 Ga0068852_101261386
633 Ga0068864_100004572
634 Ga0068866_11080001
635 Ga0068858_100003942
636 Ga0068858_100004671
637 Ga0081540_1058576
638 Ga0075364_10000558
639 Ga0075364_10144158
640 Ga0075362_10033788
641 Ga0075369_10168819
642 Ga0075369_10355187
643 Ga0075366_10440412
644 Ga0075370_10064180
645 Ga0068871_100120143
646 Ga0075428_100157408
647 Ga0075436_100887794
648 Ga0105240_10877559
649 Ga0111539_10043887
650 Ga0105245_10001264
651 Ga0114129_10097405
652 Ga0105243_10000876
653 Ga0105243_10090243
654 Ga0105243_10378055
655 Ga0105241_10005567
656 Ga0105241_11039065
657 Ga0105242_10315579
658 Ga0105242_12462550
659 Ga0105248_10032166
660 Ga0105237_10572783
661 Ga0105237_11171168
662 Ga0105237_11393989
663 Ga0105238_10078871
664 Ga0105238_10759244
665 Ga0105249_10129555
666 Ga0105249_10186603
667 Ga0105249_10254844
668 Ga0105239_10281371
669 Ga0105239_10552011
670 Ga0105239_10580702
671 Ga0105239_11409832
672 Ga0105239_11573566
673 Ga0105239_12362118
674 Ga0105246_10087502
675 Ga0105246_11019284
676 Ga0105246_11432129
677 Ga0157326_1005102
678 Ga0157373_10039441
679 Ga0157373_10139492
680 Ga0157373_10429590
681 Ga0157371_10000030
682 Ga0157371_10002409
683 Ga0157370_10019186
684 Ga0157370_10229647
685 Ga0157369_11226738
686 Ga0157374_10452704
687 Ga0157374_11915949
688 Ga0157378_10097664
689 Ga0163162_10007973
690 Ga0163162_11932419
691 Ga0157372_10559031
692 Ga0157372_10583815
693 Ga0157372_10893478
694 Ga0157372_11171676
695 Ga0157372_11475709
696 Ga0157375_10594570
697 Ga0182008_10983098
698 Ga0157376_10133664
699 Ga0157376_11117040
700 Ga0163161_10040465
701 Ga0213876_10111727
702 Ga0209563_100019
703 Ga0209148_1000017
704 Ga0209233_1000154
705 Ga0209233_1006001
706 Ga0209455_1000005
707 Ga0209758_1000001
708 Ga0209050_1000026
709 Ga0209257_1000009
710 Ga0207697_10051021
711 Ga0207688_10098205
712 Ga0207647_10028951
713 Ga0207685_10367945
714 Ga0207699_10101340
715 Ga0207645_10063405
716 Ga0207645_10226838
717 Ga0207705_10000531
718 Ga0207654_10000190
719 Ga0207707_10025034
720 Ga0207707_10052670
721 Ga0207695_10042726
722 Ga0207695_10271977
723 Ga0207671_10003175
724 Ga0207671_10966219
725 Ga0207657_10071975
726 Ga0207657_10264374
727 Ga0207657_10427421
728 Ga0207649_10011496
729 Ga0207649_10199092
730 Ga0207649_10395839
731 Ga0207649_10453742
732 Ga0207652_10048264
733 Ga0207694_10081519
734 Ga0207694_10094568
735 Ga0207694_10097248
736 Ga0207694_10466872
737 Ga0207694_10704448
738 Ga0207659_10013104
739 Ga0207687_10003410
740 Ga0207690_10001685
741 Ga0207690_10285531
742 Ga0207706_10001012
743 Ga0207706_10052514
744 Ga0207686_10730249
745 Ga0207709_10000031
746 Ga0207709_10220463
747 Ga0207669_10000077
748 Ga0207669_10029565
749 Ga0207711_10017656
750 Ga0207689_10191169
751 Ga0207689_11728374
752 Ga0207661_10239584
753 Ga0207661_10318223
754 Ga0207679_10180840
755 Ga0207667_10000004
756 Ga0207667_10121091
757 Ga0207651_10030156
758 Ga0207712_10079964
759 Ga0207668_10221701
760 Ga0207640_10029437
761 Ga0207640_10416612
762 Ga0207658_10071753
763 Ga0207677_11010558
764 Ga0207677_11201815
765 Ga0207703_10001326
766 Ga0207703_10002565
767 Ga0207703_11384412
768 Ga0207639_10037912
769 Ga0207639_10097153
770 Ga0207678_10171549
771 Ga0207678_10311323
772 Ga0207678_10758873
773 Ga0207702_10000642
774 Ga0207648_10040752
775 Ga0207648_10404454
776 Ga0207676_10007867
777 Ga0207674_10087556
778 Ga0207674_10307914
779 Ga0207674_10394029
780 Ga0207674_10400558
781 Ga0207698_10105894
782 Ga0207698_10749307
783 Ga0207698_10999615
784 Ga0207698_11011503
785 Ga0210002_1032920
786 Ga0209971_1154517
787 Ga0209998_10011875
788 Ga0268266_10000002
789 Ga0307517_10035306
790 Ga0265338_11035185
791 Ga0316182_1308535
792 Ga0265327_10123173
793 Ga0307513_10235409
794 Ga0307513_10371019
795 Ga0307513_10480595
796 Ga0307509_10623807
797 Ga0307408_100076682
798 Ga0316579_10006704
799 Ga0316579_10417458
800 Ga0265314_10008944
801 Ga0316576_10435361
802 Ga0316576_10650699
803 Ga0316576_10681855
804 Ga0316578_10023162
805 Ga0316578_10188511
806 Ga0307516_10536883
807 Ga0307405_10316380
808 Ga0307405_10759391
809 Ga0307405_10798462
810 Ga0316577_10179788
811 Ga0307413_10186022
812 Ga0307413_10599412
813 Ga0307410_10346822
814 Ga0307410_10991444
815 Ga0307412_10023153
816 Ga0307412_10076349
817 Ga0307412_10513923
818 Ga0307416_100311290
819 Ga0307416_100661116
820 Ga0307414_11019294
821 Ga0307411_10540412
822 Ga0307415_100167809
823 Ga0307415_100238801
824 Ga0307415_101740959
825 Ga0316583_10018558
826 Ga0316585_10272369
827 Ga0316580_10030556
828 Ga0307510_10195604
829 Ga0373926_0028754
830 Ga0373932_0122345
831 Ga0373943_0049186
832 Ga0373946_0184367
833 Ga0373961_0164171
834 Ga0316574_0701526
835 Ga0373924_0514666
836 Ga0373931_0017764
837 Ga0373935_0227642
838 Ga0373935_0770095
839 Ga0373927_0012254
840 Ga0373933_0306367
841 Ga0373947_0013628
842 Ga0316582_0858058
843 Ga0316584_0036331
844 Ga0373925_0054302
845 Ga0373925_0096599
846 Ga0395899_0316674
847 Ga0395905_0081929
848 Ga0395905_0082380
849 Ga0395905_0271644
850 Ga0395905_0365844
851 Ga0316581_0053247
852 Ga0395901_0078158
853 Ga0395901_0133979
854 Ga0395901_1404846
855 Ga0400483_118183
856 Ga0436365_0451774
857 Ga0436365_1683674
858 Ga0436363_1555732
859 Ga0436362_1224760
860 Ga0451791_0405096
861 Ga0451793_0536722
862 Ga0451797_0626230
863 Ga0451845_0355435
864 Ga0451855_0355703
865 Ga0451853_1144479
866 Ga0439448_0076338
867 Ga0451576_0000007
868 Ga0495627_001497
869 Ga0495603_0002724
870 Ga0495629_0000907
871 Ga0495638_0007575
872 Ga0495650_0000340
873 Ga0495580_0013222
874 Ga0495582_0018038
875 Ga0495639_0004636
876 Ga0495584_0015856
877 Ga0495584_0630224
878 Ga0495594_0001129
879 Ga0495596_0052404
880 Ga0495583_0019131
881 Ga0495583_0019651
882 Ga0495583_0034397
883 Ga0495583_0148538
884 Ga0495606_0000824
885 Ga0495630_0211328
886 Ga0495631_0208054
887 Ga0495632_0083915
888 Ga0495637_0014507
889 Ga0495643_0008432
890 Ga0495643_0012592
891 Ga0495643_0013731
892 Ga0495643_0051552
893 Ga0495643_0382958
894 Ga0495643_0384346
895 Ga0495643_0434514
896 Ga0495644_0073745
897 Ga0495648_0000303
898 Ga0495663_0014875
899 Ga0495666_0144415
900 Ga0495642_0106863
901 Ga0495609_0014516
902 Ga0495622_0018094
903 Ga0495622_0032906
904 Ga0495633_0007722
905 Ga0495633_0043068
906 Ga0495633_0091765
907 Ga0495633_0103301
908 Ga0495668_0000007
909 Ga0495634_0047892
910 Ga0495611_0150263
911 Ga0495625_0001479
912 Ga0495625_0009233
913 Ga0495625_0013066
914 Ga0495625_0025766
915 Ga0495625_0144593
916 Ga0495625_0214403
917 Ga0495625_0284306
918 Ga0495625_0789239
919 Ga0495661_0086288
920 Ga0495588_0026414
921 Ga0495669_0000507
922 Ga0495669_0396514
923 Ga0495613_0006945
924 Ga0495624_0102958
925 Ga0495670_0049902
926 Ga0495670_0052447
927 Ga0495671_0080673
928 Ga0495671_0424616
929 Ga0495600_0013303
930 Ga0495660_0157130
931 Ga0495581_0017676
932 Ga0495676_0448560
933 Ga0495680_0418595
934 Ga0495683_0030887
935 Ga0495683_0204867
936 Ga0495687_004439
937 Ga0495687_013793
938 Ga0495677_0006691
939 Ga0495681_0000011
940 Ga0495681_0150222
941 Ga0495684_0544525
942 Ga0495686_0052596
943 Ga0495593_0004291
944 Ga0495614_0015186
945 Ga0496101_0459223
946 Ga0496102_0011729
947 Ga0496102_0177808
948 Ga0496102_0779161
949 Ga0496102_1407386
950 Ga0496102_1609536
951 Ga0496103_0000836
952 Ga0496103_0121314
953 Ga0496104_0033295
954 Ga0496104_0831456
955 Ga0496105_0052177
956 Ga0496105_0196454
957 Ga0496105_0343701
958 Ga0496106_0288845
959 Ga0496107_0141097
960 Ga0496107_0754666
961 Ga0496110_0501370
962 Ga0496111_0007641
963 Ga0496112_0011677
964 Ga0496113_0163203
965 Ga0496113_1172694
966 Ga0496114_0137219
967 Ga0496114_0195286
968 Ga0496115_0000597
969 Ga0496115_0002445
970 Ga0496116_0017799
971 Ga0496117_0000182
972 Ga0496117_0179801
973 Ga0496118_0000125
974 Ga0496118_0073182
975 Ga0496119_0010214
976 Ga0496120_0033907
977 Ga0496121_0000367
978 Ga0496121_0007290
979 Ga0496121_0034537
980 Ga0496121_0129749
981 Ga0496122_0023643
982 Ga0496122_0036059
983 Ga0496123_0024694
984 Ga0496123_0041016
985 Ga0496124_0000082
986 Ga0496125_0002269
987 Ga0496126_0000221
988 Ga0496126_0633262
989 Ga0495678_226482
990 Ga0501031_0475813
991 Ga0501036_0300804
992 Ga0501036_0698343
993 Ga0501037_0130539
994 Ga0501037_0419393
995 Ga0501038_0024065
996 Ga0501038_0162203
997 Ga0501038_0272083
998 Ga0501039_0121841
999 Ga0501039_0590748
1000 Ga0501040_0053816
1001 Ga0501041_0163729
1002 Ga0501042_0090173
1003 Ga0501042_0140537
1004 Ga0501042_0281248
1005 Ga0501046_0171634
1006 Ga0501046_0356179
1007 Ga0501046_0886504
1008 Ga0501068_0082693
1009 Ga0501070_0582583
1010 Ga0501071_0014849
1011 Ga0501072_0207638
1012 Ga0501073_0913935
1013 Ga0501074_0561793
1014 Ga0501074_1062612
1015 Ga0501075_0084906
1016 Ga0501076_0099355
1017 Ga0501076_0107757
1018 Ga0501077_0321028
1019 Ga0501079_0074851
1020 Ga0501080_0510921
1021 Ga0501081_0058001
1022 Ga0501081_0136410
1023 Ga0501081_0688437
1024 Ga0501081_1150548
1025 Ga0501044_0327664
1026 Ga0501045_0304397
1027 Ga0501045_0782595
1028 nmdc:mga03683_7580_c1
1029 nmdc:mga00v17_302228_c1
1030 nmdc:mga00v17_5943_c1
1031 nmdc:mga0k408_214869_c1
1032 nmdc:mga0k408_53081_c1
1033 nmdc:mga07m45_41377_c1
1034 nmdc:mga08y16_142307_c1
1035 nmdc:mga08y16_821233_c1
1036 nmdc:mga0a205_699074_c1
1037 nmdc:mga0sz30_18727_c2
1038 Ga0495612_0128142
1039 Ga0500610_0000140
1040 Ga0495619_0004011
1041 Ga0500643_000001
1042 Ga0500643_009771
1043 Ga0500643_009963
1044 Ga0500643_059905
1045 Ga0500647_0253708
1046 Ga0500651_0497353
1047 Ga0500641_0040456
1048 Ga0500555_002842
1049 Ga0500562_011833
1050 Ga0500562_070644
1051 Ga0500595_010172
1052 Ga0500642_0000804
1053 Ga0500559_0103072
1054 Ga0500559_0183075
1055 Ga0500559_0322299
1056 Ga0500573_0239100
1057 Ga0500616_0007018
1058 Ga0500616_0081604
1059 Ga0500616_0133312
1060 Ga0500619_176045
1061 Ga0500624_000666
1062 Ga0500636_0033551
1063 Ga0500636_0088068
1064 Ga0500645_000080
1065 Ga0500645_142269
1066 Ga0500596_004831
1067 Ga0500661_026348
1068 Ga0500661_085737
1069 Ga0587101_048128
1070 Ga0587111_0089978
1071 Ga0530510_0020509
1072 2512032812
1073 2753764448
1074 2879165714
1075 2882807873
1076 2928527570
1077 3000865972
1078 8054006304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

32

180

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.774 4 150
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7515 4 150
7dgu-assembly1.cif.gz_A de novo designed protein h4a1r 0.5093 2 92
4uer-assembly1.cif.gz_a 40s-eif1-eif1a-eif3-eif3j translation initiation complex from lachancea kluyveri 0.4453 6 109
7dgu-assembly1.cif.gz_A de novo designed protein h4a1r 0.4359 2 92
ID Description Score Start End Superfamily
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9274 1 93 1.10.1510.10
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9174 1 93 1.10.1510.10
af_Q12032_29_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.917 4 93 1.10.1510.10
1ng6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9117 94 150 1.10.10.410
af_Q12032_29_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.8977 4 93 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A653J3S8-F1-model_v4 GatB protein 0.9771 1 150 GO:0016884
AF-A0A3D1U4K6-F1-model_v4 Glutamyl-tRNA amidotransferase 0.9377 2 150 GO:0016740
GO:0016884
AF-A0A6J4BTS0-F1-model_v4 Aspartyl-tRNA amidotransferase 0.9307 1 150 GO:0016740
GO:0016884
AF-A0A502FIE2-F1-model_v4 GatB/YqeY domain-containing protein 0.9287 1 150 GO:0016884
AF-A0A7C1DUB5-F1-model_v4 GatB/YqeY domain-containing protein 0.9282 1 150 GO:0016884

Map