F461128

General Info

Members Datasets Scaffolds Average Seq Length
539 199 1078 178

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10000216|Ga0114129_1000021616
Length 199
Sequence VKVRARWLIPLAALPVVGLLAYGFRTDPRAVPSPLVGGPAPAFALTTFDGKAVSLESQRGKVVVLNFWASWCYPACYEEAPVLEAGWRESQAKGMVVLGVAIQDKEPASLEFIRRFGLTFPNAPDPAGKVSIDYGVYGVPETFVIDRRGVIRRKHVGAVTQAVFREWVEPLLRESAATGGARHIAQAEGRPGRRLEAAR

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
132 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
133 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
141 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
142 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
143 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.74
Rhizosphere 99.26
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10000216 3300009147 Bacteria 63856
2 Ga0070690_100212129 3300005330 Bacteria 1352
3 Ga0068869_100016410 3300005334 Bacteria 4991
4 Ga0070680_100022445 3300005336 Bacteria 5028
5 Ga0070682_100027285 3300005337 Bacteria 3425
6 Ga0070660_100076134 3300005339 Bacteria 2628
7 Ga0070689_100305675 3300005340 Bacteria 1325
8 Ga0070689_100821039 3300005340 Bacteria 819
9 Ga0070689_101614992 3300005340 Bacteria 589
10 Ga0070691_10013026 3300005341 Bacteria 3809
11 Ga0070691_10109026 3300005341 Bacteria 1383
12 Ga0070691_10375006 3300005341 Bacteria 796
13 Ga0070661_100003719 3300005344 Bacteria 10514
14 Ga0070692_10075425 3300005345 Bacteria 1806
15 Ga0070669_100308250 3300005353 Bacteria 1275
16 Ga0070688_100204349 3300005365 Bacteria 1384
17 Ga0070659_100026257 3300005366 Bacteria 4479
18 Ga0070701_10448038 3300005438 Bacteria 828
19 Ga0070705_100004541 3300005440 Bacteria 6753
20 Ga0070705_100017889 3300005440 Bacteria 3706
21 Ga0070705_100553227 3300005440 Bacteria 882
22 Ga0070694_100036700 3300005444 Bacteria 3247
23 Ga0070694_100074658 3300005444 Bacteria 2344
24 Ga0070694_100090086 3300005444 Bacteria 2150
25 Ga0070694_100090987 3300005444 Bacteria 2140
26 Ga0070708_100050694 3300005445 Bacteria 3676
27 Ga0070708_100444030 3300005445 Bacteria 1224
28 Ga0070708_100617997 3300005445 Bacteria 1021
29 Ga0070708_100625103 3300005445 Bacteria 1015
30 Ga0070662_100064949 3300005457 Bacteria 2674
31 Ga0068867_100009601 3300005459 Bacteria 6822
32 Ga0068867_100174898 3300005459 Bacteria 1703
33 Ga0070706_100091355 3300005467 Bacteria 2824
34 Ga0070706_100124994 3300005467 Bacteria 2398
35 Ga0070706_100166918 3300005467 Bacteria 2055
36 Ga0070706_100224735 3300005467 Bacteria 1752
37 Ga0070706_100329563 3300005467 Bacteria 1424
38 Ga0070706_100533191 3300005467 Bacteria 1092
39 Ga0070706_100617276 3300005467 Bacteria 1007
40 Ga0070706_100985010 3300005467 Bacteria 778
41 Ga0070707_100005569 3300005468 Bacteria 11764
42 Ga0070707_100044935 3300005468 Bacteria 4228
43 Ga0070707_100216688 3300005468 Bacteria 1865
44 Ga0070707_100947201 3300005468 Bacteria 826
45 Ga0070707_101489258 3300005468 Bacteria 643
46 Ga0070698_100080912 3300005471 Bacteria 3243
47 Ga0070698_100089109 3300005471 Bacteria 3069
48 Ga0070698_100110695 3300005471 Bacteria 2711
49 Ga0070699_100002892 3300005518 Bacteria 15285
50 Ga0070699_100018215 3300005518 Bacteria 6034
51 Ga0070699_100136319 3300005518 Bacteria 2165
52 Ga0070699_100181824 3300005518 Bacteria 1866
53 Ga0070699_100238619 3300005518 Bacteria 1622
54 Ga0070679_100001419 3300005530 Bacteria 21185
55 Ga0070697_100009741 3300005536 Bacteria 7495
56 Ga0070697_100017309 3300005536 Bacteria 5670
57 Ga0070697_100018252 3300005536 Bacteria 5531
58 Ga0070697_100072671 3300005536 Bacteria 2822
59 Ga0070697_100144806 3300005536 Bacteria 1999
60 Ga0068853_100195165 3300005539 Bacteria 1841
61 Ga0070672_100177425 3300005543 Bacteria 1774
62 Ga0070686_100101685 3300005544 Bacteria 1943
63 Ga0070695_100011721 3300005545 Bacteria 5248
64 Ga0070695_100040504 3300005545 Bacteria 2949
65 Ga0070695_100069377 3300005545 Bacteria 2304
66 Ga0070695_100080733 3300005545 Bacteria 2150
67 Ga0070695_100112130 3300005545 Bacteria 1852
68 Ga0070695_100212901 3300005545 Bacteria 1388
69 Ga0070696_100002374 3300005546 Bacteria 12453
70 Ga0070696_100177399 3300005546 Bacteria 1579
71 Ga0070696_100299156 3300005546 Bacteria 1232
72 Ga0070693_100087506 3300005547 Bacteria 1871
73 Ga0070704_100046278 3300005549 Bacteria 3033
74 Ga0070704_100144635 3300005549 Bacteria 1861
75 Ga0068855_100002166 3300005563 Bacteria 24281
76 Ga0070664_100001058 3300005564 Bacteria 21642
77 Ga0068857_100003334 3300005577 Bacteria 13364
78 Ga0068857_100136150 3300005577 Bacteria 2218
79 Ga0068857_100369714 3300005577 Bacteria 1330
80 Ga0068854_100077736 3300005578 Bacteria 2443
81 Ga0068856_100001265 3300005614 Bacteria 26620
82 Ga0068852_101319654 3300005616 Bacteria 743
83 Ga0068859_100039488 3300005617 Bacteria 4735
84 Ga0068859_100136536 3300005617 Bacteria 2525
85 Ga0068859_100954502 3300005617 Bacteria 941
86 Ga0068859_101094330 3300005617 Bacteria 876
87 Ga0068864_100007588 3300005618 Bacteria 8935
88 Ga0068866_10294923 3300005718 Bacteria 1010
89 Ga0068861_100075893 3300005719 Bacteria 2618
90 Ga0068870_10014547 3300005840 Bacteria 3718
91 Ga0068863_100047386 3300005841 Bacteria 4077
92 Ga0068863_100069724 3300005841 Bacteria 3324
93 Ga0068863_100596548 3300005841 Bacteria 1093
94 Ga0068860_100020406 3300005843 Bacteria 6419
95 Ga0068860_100055673 3300005843 Bacteria 3760
96 Ga0068862_100019777 3300005844 Bacteria 5624
97 Ga0068862_100177518 3300005844 Bacteria 1910
98 Ga0068862_100374610 3300005844 Bacteria 1326
99 Ga0070717_10927162 3300006028 Bacteria 793
100 Ga0075432_10256037 3300006058 Bacteria 712
101 Ga0070712_100001268 3300006175 Bacteria 15245
102 Ga0075428_100003079 3300006844 Bacteria 18190
103 Ga0075428_100251957 3300006844 Bacteria 1903
104 Ga0075428_100308146 3300006844 Bacteria 1702
105 Ga0075428_100421531 3300006844 Bacteria 1430
106 Ga0075430_100001340 3300006846 Bacteria 19902
107 Ga0075430_100002045 3300006846 Bacteria 16630
108 Ga0075431_100011066 3300006847 Bacteria 9078
109 Ga0075431_100037939 3300006847 Bacteria 4961
110 Ga0075431_100191636 3300006847 Bacteria 2094
111 Ga0075431_100958788 3300006847 Bacteria 823
112 Ga0075433_10002199 3300006852 Bacteria 14786
113 Ga0075433_10789645 3300006852 Bacteria 830
114 Ga0075434_100002513 3300006871 Bacteria 16177
115 Ga0075434_100004220 3300006871 Bacteria 12884
116 Ga0075434_100707905 3300006871 Bacteria 1024
117 Ga0075429_100001419 3300006880 Bacteria 19650
118 Ga0075429_100003531 3300006880 Bacteria 13321
119 Ga0075429_100582395 3300006880 Bacteria 980
120 Ga0075429_100824876 3300006880 Bacteria 812
121 Ga0075436_100031612 3300006914 Bacteria 3646
122 Ga0097620_100039488 3300006931 Bacteria 4735
123 Ga0097620_100136538 3300006931 Bacteria 2525
124 Ga0097620_100954510 3300006931 Bacteria 941
125 Ga0097620_101094325 3300006931 Bacteria 876
126 Ga0075435_100001368 3300007076 Bacteria 15741
127 Ga0075435_100010993 3300007076 Bacteria 6636
128 Ga0099794_10022751 3300007265 Bacteria 2860
129 Ga0105240_11402790 3300009093 Bacteria 734
130 Ga0111539_10003405 3300009094 Bacteria 20950
131 Ga0111539_10872097 3300009094 Bacteria 1047
132 Ga0111539_11501531 3300009094 Bacteria 781
133 Ga0105247_10626740 3300009101 Bacteria 801
134 Ga0114129_10007742 3300009147 Bacteria 15286
135 Ga0114129_10024080 3300009147 Bacteria 8627
136 Ga0114129_10052158 3300009147 Bacteria 5741
137 Ga0114129_10064104 3300009147 Bacteria 5128
138 Ga0114129_10197188 3300009147 Bacteria 2729
139 Ga0114129_10208091 3300009147 Bacteria 2646
140 Ga0114129_10980917 3300009147 Bacteria 1065
141 Ga0114129_11733700 3300009147 Bacteria 761
142 Ga0105243_10448763 3300009148 Bacteria 1209
143 Ga0105241_10229871 3300009174 Bacteria 1563
144 Ga0105248_10009600 3300009177 Bacteria 10651
145 Ga0105248_10435676 3300009177 Bacteria 1477
146 Ga0105237_10456279 3300009545 Bacteria 1284
147 Ga0105249_10135934 3300009553 Bacteria 2352
148 Ga0105249_10450405 3300009553 Bacteria 1326
149 Ga0105246_10503169 3300011119 Bacteria 1029
150 Ga0105246_10786087 3300011119 Bacteria 843
151 Ga0105246_10847457 3300011119 Bacteria 815
152 Ga0157371_10339387 3300013102 Bacteria 1093
153 Ga0157369_11495955 3300013105 Bacteria 687
154 Ga0163162_10007987 3300013306 Bacteria 10320
155 Ga0163162_10242250 3300013306 Bacteria 1934
156 Ga0157372_10041609 3300013307 Bacteria 5081
157 Ga0157372_10082945 3300013307 Bacteria 3630
158 Ga0157375_10406196 3300013308 Bacteria 1528
159 Ga0157375_10496116 3300013308 Bacteria 1385
160 Ga0157380_10183068 3300014326 Bacteria 1842
161 Ga0157380_10412060 3300014326 Bacteria 1286
162 Ga0157380_11767255 3300014326 Bacteria 677
163 Ga0182008_10057446 3300014497 Bacteria 1921
164 Ga0182007_10007942 3300015262 Bacteria 4398
165 Ga0207653_10090858 3300025885 Bacteria 1069
166 Ga0207643_10006668 3300025908 Bacteria 6190
167 Ga0207684_10016691 3300025910 Bacteria 6305
168 Ga0207684_10029061 3300025910 Bacteria 4709
169 Ga0207684_10043072 3300025910 Bacteria 3826
170 Ga0207684_10060773 3300025910 Bacteria 3209
171 Ga0207684_10065214 3300025910 Bacteria 3092
172 Ga0207684_10071673 3300025910 Bacteria 2944
173 Ga0207684_10193183 3300025910 Bacteria 1756
174 Ga0207684_10403183 3300025910 Bacteria 1176
175 Ga0207654_10137020 3300025911 Bacteria 1556
176 Ga0207707_10000150 3300025912 Bacteria 72859
177 Ga0207671_10335791 3300025914 Bacteria 1197
178 Ga0207693_10005491 3300025915 Bacteria 10561
179 Ga0207663_10052673 3300025916 Bacteria 2539
180 Ga0207660_10053081 3300025917 Bacteria 2888
181 Ga0207662_10135322 3300025918 Bacteria 1557
182 Ga0207657_10072530 3300025919 Bacteria 2912
183 Ga0207649_10031795 3300025920 Bacteria 3140
184 Ga0207652_10002718 3300025921 Bacteria 14831
185 Ga0207646_10001645 3300025922 Bacteria 27312
186 Ga0207646_10021134 3300025922 Bacteria 6020
187 Ga0207646_10032777 3300025922 Bacteria 4700
188 Ga0207646_10064752 3300025922 Bacteria 3263
189 Ga0207681_10071553 3300025923 Bacteria 2419
190 Ga0207681_10074453 3300025923 Bacteria 2379
191 Ga0207650_10017435 3300025925 Bacteria 5029
192 Ga0207690_10003228 3300025932 Bacteria 9788
193 Ga0207690_10054009 3300025932 Bacteria 2699
194 Ga0207706_10050413 3300025933 Bacteria 3678
195 Ga0207670_10169263 3300025936 Bacteria 1637
196 Ga0207670_10238940 3300025936 Bacteria 1399
197 Ga0207670_10691783 3300025936 Bacteria 843
198 Ga0207704_10292333 3300025938 Bacteria 1244
199 Ga0207665_10435467 3300025939 Bacteria 1004
200 Ga0207691_10145941 3300025940 Bacteria 2083
201 Ga0207691_10781264 3300025940 Bacteria 803
202 Ga0207711_10046929 3300025941 Bacteria 3691
203 Ga0207689_10058802 3300025942 Bacteria 3162
204 Ga0207679_10000326 3300025945 Bacteria 35506
205 Ga0207667_10000777 3300025949 Bacteria 41366
206 Ga0207712_10036706 3300025961 Bacteria 3340
207 Ga0207712_10487173 3300025961 Bacteria 1052
208 Ga0207668_10048256 3300025972 Bacteria 2921
209 Ga0207640_10069711 3300025981 Bacteria 2362
210 Ga0207703_10615670 3300026035 Bacteria 1028
211 Ga0207708_10184726 3300026075 Bacteria 1656
212 Ga0207702_10001073 3300026078 Bacteria 28000
213 Ga0207641_10026926 3300026088 Bacteria 4748
214 Ga0207648_10199528 3300026089 Bacteria 1774
215 Ga0207648_10620466 3300026089 Bacteria 998
216 Ga0207676_10008973 3300026095 Bacteria 7115
217 Ga0207674_10001586 3300026116 Bacteria 29261
218 Ga0207674_10121433 3300026116 Bacteria 2580
219 Ga0207674_10824438 3300026116 Bacteria 895
220 Ga0207675_100047650 3300026118 Bacteria 4001
221 Ga0207675_100280155 3300026118 Bacteria 1620
222 Ga0209970_1002377 3300027614 Bacteria 3207
223 Ga0209588_1027977 3300027671 Unclassified 1794
224 Ga0209971_1001693 3300027682 Bacteria 5432
225 Ga0209966_1000963 3300027695 Bacteria 5391
226 Ga0209998_10001611 3300027717 Bacteria 5417
227 Ga0207428_10000176 3300027907 Bacteria 89634
228 Ga0268265_10079770 3300028380 Bacteria 2579
229 Ga0268265_11612497 3300028380 Bacteria 654
230 Ga0268265_11668163 3300028380 Bacteria 643
231 Ga0268264_10301158 3300028381 Bacteria 1509
232 Ga0268264_11268946 3300028381 Bacteria 747
233 Ga0307408_100070434 3300031548 Bacteria 2582
234 Ga0307408_100355565 3300031548 Bacteria 1244
235 Ga0307408_100620123 3300031548 Bacteria 963
236 Ga0307410_10092717 3300031852 Bacteria 2148
237 Ga0307410_10644018 3300031852 Bacteria 888
238 Ga0307412_10053849 3300031911 Bacteria 2669
239 Ga0307409_100244235 3300031995 Bacteria 1637
240 Ga0307416_100160487 3300032002 Bacteria 2077
241 Ga0307416_100215495 3300032002 Bacteria 1836
242 Ga0307411_10006257 3300032005 Bacteria 5939
243 Ga0373940_0041292 3300035088 Bacteria 1268
244 Ga0373949_0015825 3300035090 Bacteria 1688
245 Ga0373939_0013016 3300035114 Bacteria 2132
246 Ga0373939_0024633 3300035114 Bacteria 1678
247 Ga0373939_0260871 3300035114 Bacteria 678
248 Ga0373960_0014533 3300035121 Bacteria 1997
249 Ga0373942_0014390 3300035207 Bacteria 1915
250 Ga0373962_0037545 3300035242 Bacteria 1353
251 Ga0395899_0009796 3300037312 Bacteria 7353
252 Ga0395900_0002079 3300037418 Bacteria 22453
253 Ga0395898_0015665 3300037466 Bacteria 7769
254 Ga0395901_0001177 3300038443 Bacteria 27791
255 Ga0439437_004711 3300042000 Bacteria 1492
256 Ga0439448_0062611 3300042005 Bacteria 1231
257 Ga0439456_107968 3300042013 Bacteria 633
258 Ga0450905_063647 3300042142 Bacteria 620
259 Ga0439434_0154596 3300042435 Bacteria 760
260 Ga0439459_0003020 3300042438 Bacteria 2641
261 Ga0439460_0000973 3300042461 Bacteria 6578
262 Ga0451577_0254683 3300042876 Bacteria 1589
263 Ga0453683_0367914 3300044673 Bacteria 925
264 Ga0453684_0029980 3300044712 Bacteria 7701
265 Ga0453684_0202098 3300044712 Bacteria 2316
266 Ga0453684_0319591 3300044712 Bacteria 1759
267 Ga0451576_0090634 3300045051 Bacteria 3180
268 Ga0451576_0133536 3300045051 Bacteria 2587
269 Ga0451576_0245550 3300045051 Bacteria 1871
270 Ga0451576_0305024 3300045051 Bacteria 1665
271 Ga0451576_0331242 3300045051 Bacteria 1593
272 Ga0451576_0386928 3300045051 Bacteria 1466
273 Ga0451576_0561499 3300045051 Bacteria 1199
274 Ga0451576_0645943 3300045051 Bacteria 1112
275 Ga0495584_0157581 3300046491 Bacteria 1154
276 Ga0495594_0108830 3300046499 Bacteria 1562
277 Ga0495642_0129418 3300046528 Bacteria 1086
278 Ga0495656_0222398 3300046615 Bacteria 944
279 Ga0495669_0002303 3300046684 Bacteria 7821
280 Ga0495636_0148306 3300047318 Bacteria 1051
281 Ga0496102_0012121 3300048905 Bacteria 7450
282 Ga0496107_0380993 3300048910 Bacteria 1049
283 Ga0496107_0668480 3300048910 Bacteria 765
284 Ga0496112_0173032 3300048915 Bacteria 2125
285 Ga0501031_0011845 3300049568 Bacteria 5686
286 Ga0501031_0159869 3300049568 Bacteria 1473
287 Ga0501033_0061746 3300049570 Bacteria 2761
288 Ga0501033_0108936 3300049570 Bacteria 2017
289 Ga0501033_0110899 3300049570 Bacteria 1996
290 Ga0501033_0247631 3300049570 Bacteria 1264
291 Ga0501033_0326514 3300049570 Bacteria 1077
292 Ga0501033_0337583 3300049570 Bacteria 1057
293 Ga0501036_0000853 3300049572 Bacteria 22673
294 Ga0501036_0057407 3300049572 Bacteria 3297
295 Ga0501036_0114847 3300049572 Bacteria 2275
296 Ga0501036_0187015 3300049572 Bacteria 1743
297 Ga0501036_0266160 3300049572 Bacteria 1436
298 Ga0501037_0008116 3300049573 Bacteria 7695
299 Ga0501037_0044956 3300049573 Bacteria 3242
300 Ga0501037_0408168 3300049573 Bacteria 931
301 Ga0501038_0001304 3300049574 Bacteria 22714
302 Ga0501038_0062457 3300049574 Bacteria 3183
303 Ga0501038_0102076 3300049574 Bacteria 2387
304 Ga0501038_0156072 3300049574 Bacteria 1858
305 Ga0501038_0254388 3300049574 Bacteria 1390
306 Ga0501038_0282565 3300049574 Bacteria 1306
307 Ga0501038_0392438 3300049574 Bacteria 1075
308 Ga0501038_0393330 3300049574 Bacteria 1073
309 Ga0501039_0000591 3300049575 Bacteria 26211
310 Ga0501039_0010896 3300049575 Bacteria 6929
311 Ga0501039_0041526 3300049575 Bacteria 3553
312 Ga0501039_0050001 3300049575 Bacteria 3233
313 Ga0501039_0073585 3300049575 Bacteria 2655
314 Ga0501039_0333371 3300049575 Bacteria 1192
315 Ga0501040_0000838 3300049576 Bacteria 19253
316 Ga0501040_0016640 3300049576 Bacteria 4872
317 Ga0501040_0049645 3300049576 Bacteria 2869
318 Ga0501040_0060180 3300049576 Bacteria 2610
319 Ga0501040_0193208 3300049576 Unclassified 1445
320 Ga0501040_0293788 3300049576 Bacteria 1161
321 Ga0501040_0772722 3300049576 Bacteria 695
322 Ga0501040_1282705 3300049576 Bacteria 531
323 Ga0501041_0000046 3300049577 Bacteria 42763
324 Ga0501041_0004585 3300049577 Bacteria 8016
325 Ga0501041_0006377 3300049577 Bacteria 6905
326 Ga0501041_0019426 3300049577 Bacteria 4058
327 Ga0501041_0046870 3300049577 Bacteria 2630
328 Ga0501041_0072135 3300049577 Bacteria 2121
329 Ga0501041_0191435 3300049577 Bacteria 1281
330 Ga0501041_0194977 3300049577 Bacteria 1269
331 Ga0501041_0382983 3300049577 Bacteria 890
332 Ga0501041_0408213 3300049577 Bacteria 861
333 Ga0501042_0000005 3300049578 Bacteria 65451
334 Ga0501042_0010507 3300049578 Bacteria 6211
335 Ga0501042_0029133 3300049578 Bacteria 3894
336 Ga0501042_0053220 3300049578 Bacteria 2888
337 Ga0501042_0087128 3300049578 Bacteria 2240
338 Ga0501042_0104860 3300049578 Bacteria 2034
339 Ga0501042_0105700 3300049578 Bacteria 2026
340 Ga0501042_0193486 3300049578 Bacteria 1467
341 Ga0501042_0281932 3300049578 Bacteria 1200
342 Ga0501042_0545433 3300049578 Bacteria 843
343 Ga0501042_0797670 3300049578 Bacteria 687
344 Ga0501043_0007534 3300049579 Bacteria 8638
345 Ga0501043_0185748 3300049579 Bacteria 1619
346 Ga0501043_0342970 3300049579 Bacteria 1136
347 Ga0501043_0563140 3300049579 Bacteria 845
348 Ga0501046_0000141 3300049580 Bacteria 75571
349 Ga0501046_0000373 3300049580 Bacteria 45356
350 Ga0501046_0058604 3300049580 Bacteria 3018
351 Ga0501046_0373676 3300049580 Bacteria 1033
352 Ga0501046_0403145 3300049580 Bacteria 988
353 Ga0501047_0024996 3300049581 Bacteria 5737
354 Ga0501048_0003890 3300049582 Bacteria 11363
355 Ga0501048_0033021 3300049582 Bacteria 3740
356 Ga0501048_0048263 3300049582 Bacteria 3037
357 Ga0501048_0119286 3300049582 Bacteria 1864
358 Ga0501048_0273201 3300049582 Bacteria 1201
359 Ga0501048_0396522 3300049582 Bacteria 986
360 Ga0501068_0004994 3300049584 Bacteria 7224
361 Ga0501068_0012291 3300049584 Bacteria 4847
362 Ga0501068_0154578 3300049584 Bacteria 1443
363 Ga0501068_0503296 3300049584 Bacteria 786
364 Ga0501068_0641399 3300049584 Bacteria 693
365 Ga0501069_0035223 3300049585 Bacteria 2757
366 Ga0501071_0000085 3300049587 Bacteria 34269
367 Ga0501071_0012073 3300049587 Bacteria 5841
368 Ga0501071_0045796 3300049587 Bacteria 3140
369 Ga0501071_0077026 3300049587 Bacteria 2436
370 Ga0501071_0243796 3300049587 Bacteria 1355
371 Ga0501072_0000073 3300049588 Bacteria 72845
372 Ga0501072_0004739 3300049588 Bacteria 10361
373 Ga0501072_0011014 3300049588 Bacteria 6900
374 Ga0501072_0040487 3300049588 Bacteria 3659
375 Ga0501072_0057018 3300049588 Bacteria 3078
376 Ga0501072_0100889 3300049588 Bacteria 2294
377 Ga0501072_0311419 3300049588 Bacteria 1251
378 Ga0501072_0328070 3300049588 Bacteria 1216
379 Ga0501072_0340422 3300049588 Bacteria 1191
380 Ga0501072_0630522 3300049588 Bacteria 844
381 Ga0501072_0750773 3300049588 Bacteria 765
382 Ga0501074_0026418 3300049590 Bacteria 4210
383 Ga0501074_0045329 3300049590 Bacteria 3182
384 Ga0501074_0062015 3300049590 Bacteria 2694
385 Ga0501074_0515907 3300049590 Bacteria 847
386 Ga0501074_0580915 3300049590 Bacteria 793
387 Ga0501074_0846100 3300049590 Bacteria 644
388 Ga0501075_0000001 3300049591 Bacteria 229051
389 Ga0501075_0000219 3300049591 Bacteria 30396
390 Ga0501075_0014099 3300049591 Bacteria 5725
391 Ga0501075_0154703 3300049591 Bacteria 1748
392 Ga0501075_0168540 3300049591 Bacteria 1671
393 Ga0501075_0196570 3300049591 Bacteria 1538
394 Ga0501075_0276711 3300049591 Bacteria 1279
395 Ga0501075_0317933 3300049591 Bacteria 1186
396 Ga0501075_0373718 3300049591 Bacteria 1086
397 Ga0501075_0545933 3300049591 Bacteria 884
398 Ga0501075_0852374 3300049591 Bacteria 693
399 Ga0501076_0000001 3300049592 Bacteria 173877
400 Ga0501076_0000204 3300049592 Bacteria 35673
401 Ga0501076_0000842 3300049592 Bacteria 19857
402 Ga0501076_0011465 3300049592 Bacteria 6604
403 Ga0501076_0022040 3300049592 Bacteria 4892
404 Ga0501076_0032553 3300049592 Bacteria 4069
405 Ga0501076_0095892 3300049592 Bacteria 2389
406 Ga0501076_0221823 3300049592 Bacteria 1545
407 Ga0501076_0265530 3300049592 Bacteria 1405
408 Ga0501076_0314657 3300049592 Bacteria 1284
409 Ga0501076_0316217 3300049592 Bacteria 1281
410 Ga0501076_0594460 3300049592 Bacteria 913
411 Ga0501077_0000023 3300049593 Bacteria 77383
412 Ga0501077_0004553 3300049593 Bacteria 8429
413 Ga0501077_0035669 3300049593 Bacteria 3167
414 Ga0501077_0040082 3300049593 Bacteria 2984
415 Ga0501077_0085655 3300049593 Bacteria 1998
416 Ga0501077_0099200 3300049593 Bacteria 1846
417 Ga0501077_0203702 3300049593 Bacteria 1257
418 Ga0501077_0265164 3300049593 Bacteria 1092
419 Ga0501077_0283805 3300049593 Bacteria 1054
420 Ga0501216_067479 3300049660 Bacteria 733
421 Ga0501079_0000015 3300049741 Bacteria 67161
422 Ga0501079_0002202 3300049741 Bacteria 14059
423 Ga0501079_0003943 3300049741 Bacteria 10963
424 Ga0501079_0016366 3300049741 Bacteria 5666
425 Ga0501079_0021996 3300049741 Bacteria 4885
426 Ga0501079_0027808 3300049741 Bacteria 4338
427 Ga0501079_0046202 3300049741 Bacteria 3360
428 Ga0501079_0096245 3300049741 Bacteria 2295
429 Ga0501079_0128591 3300049741 Bacteria 1971
430 Ga0501079_0155480 3300049741 Bacteria 1783
431 Ga0501079_0168009 3300049741 Bacteria 1711
432 Ga0501079_0319878 3300049741 Bacteria 1215
433 Ga0501079_1139629 3300049741 Bacteria 614
434 Ga0501080_0000495 3300049742 Bacteria 30778
435 Ga0501080_0014683 3300049742 Bacteria 7211
436 Ga0501080_0038738 3300049742 Bacteria 4449
437 Ga0501080_0060309 3300049742 Bacteria 3531
438 Ga0501080_0143232 3300049742 Bacteria 2210
439 Ga0501080_0206417 3300049742 Bacteria 1802
440 Ga0501080_0236045 3300049742 Bacteria 1670
441 Ga0501080_0505376 3300049742 Bacteria 1080
442 Ga0501081_0000182 3300049743 Bacteria 29938
443 Ga0501081_0001420 3300049743 Bacteria 14651
444 Ga0501081_0002786 3300049743 Bacteria 11086
445 Ga0501081_0003132 3300049743 Bacteria 10508
446 Ga0501081_0018056 3300049743 Bacteria 4680
447 Ga0501081_0021004 3300049743 Bacteria 4357
448 Ga0501081_0024979 3300049743 Bacteria 4017
449 Ga0501081_0173882 3300049743 Bacteria 1556
450 Ga0501081_0237336 3300049743 Bacteria 1329
451 Ga0501081_0387371 3300049743 Bacteria 1033
452 Ga0501081_0396724 3300049743 Bacteria 1021
453 Ga0501081_0540596 3300049743 Bacteria 870
454 Ga0501083_0016105 3300049744 Bacteria 5235
455 Ga0501083_0062638 3300049744 Bacteria 2481
456 Ga0501083_0145728 3300049744 Bacteria 1550
457 Ga0501035_0008834 3300049822 Bacteria 9378
458 Ga0501035_0064452 3300049822 Bacteria 3257
459 Ga0501035_0437130 3300049822 Bacteria 1084
460 Ga0501035_0497026 3300049822 Bacteria 1004
461 Ga0501044_0268592 3300049823 Bacteria 1642
462 Ga0501045_0001141 3300049824 Bacteria 17583
463 Ga0501045_0002341 3300049824 Bacteria 12864
464 Ga0501045_0003038 3300049824 Bacteria 11476
465 Ga0501045_0006123 3300049824 Bacteria 8335
466 Ga0501045_0012899 3300049824 Bacteria 5891
467 Ga0501045_0035961 3300049824 Bacteria 3596
468 Ga0501045_0106015 3300049824 Bacteria 2083
469 Ga0501045_0164804 3300049824 Bacteria 1651
470 Ga0501045_0907192 3300049824 Bacteria 647
471 nmdc:mga05p37_1240038_c1 3300050507 Bacteria 766
472 nmdc:mga05p37_15776_c1 3300050507 Bacteria 9085
473 nmdc:mga05p37_210537_c1 3300050507 Bacteria 2350
474 nmdc:mga05p37_2413_c1 3300050507 Bacteria 21749
475 nmdc:mga05p37_256609_c1 3300050507 Bacteria 2095
476 nmdc:mga05p37_3105_c1 3300050507 Bacteria 19299
477 nmdc:mga05p37_3324_c1 3300050507 Bacteria 18759
478 nmdc:mga05p37_54149_c1 3300050507 Bacteria 4936
479 nmdc:mga05p37_62075_c1 3300050507 Bacteria 4600
480 nmdc:mga09592_264044_c1 3300050508 Bacteria 1493
481 nmdc:mga09592_44881_c1 3300050508 Bacteria 3722
482 nmdc:mga09592_5329_c1 3300050508 Bacteria 10456
483 nmdc:mga0qj67_134086_c1 3300050509 Bacteria 1441
484 nmdc:mga0qj67_15447_c1 3300050509 Bacteria 5781
485 nmdc:mga0qj67_3133_c1 3300050509 Bacteria 11903
486 nmdc:mga06r32_1028856_c1 3300050510 Bacteria 775
487 nmdc:mga06r32_128191_c1 3300050510 Bacteria 2507
488 nmdc:mga06r32_42231_c1 3300050510 Bacteria 4335
489 nmdc:mga06r32_437245_c1 3300050510 Bacteria 1289
490 nmdc:mga06r32_9162_c1 3300050510 Bacteria 8920
491 nmdc:mga08y16_1847194_c1 3300050511 Bacteria 556
492 nmdc:mga08y16_19972_c1 3300050511 Bacteria 7069
493 nmdc:mga08y16_662076_c1 3300050511 Bacteria 1047
494 nmdc:mga08y16_890_c1 3300050511 Bacteria 28805
495 nmdc:mga0n895_33093_c1 3300050512 Bacteria 4967
496 nmdc:mga0n895_45790_c1 3300050512 Bacteria 4271
497 nmdc:mga0n895_579754_c1 3300050512 Bacteria 1126
498 nmdc:mga0rr50_10564_c1 3300050513 Bacteria 5866
499 nmdc:mga0rr50_3653_c1 3300050513 Bacteria 8902
500 nmdc:mga08x19_27868_c1 3300050514 Bacteria 3535
501 nmdc:mga0a205_122070_c1 3300050515 Bacteria 2505
502 nmdc:mga0a205_154340_c2 3300050515 Bacteria 1724
503 nmdc:mga0a205_24194_c1 3300050515 Bacteria 5770
504 nmdc:mga0a205_538515_c1 3300050515 Bacteria 1023
505 nmdc:mga0a205_586826_c1 3300050515 Bacteria 968
506 nmdc:mga0a205_692726_c1 3300050515 Bacteria 869
507 Ga0501084_0000142 3300054114 Bacteria 54295
508 Ga0501084_0028771 3300054114 Bacteria 4646
509 Ga0501084_0039077 3300054114 Bacteria 3969
510 Ga0501084_0044573 3300054114 Bacteria 3713
511 Ga0501084_0108719 3300054114 Bacteria 2329
512 Ga0501084_0321597 3300054114 Bacteria 1307
513 Ga0501084_0370284 3300054114 Bacteria 1211
514 Ga0501084_0372671 3300054114 Bacteria 1206
515 Ga0590077_028156 3300059426 Bacteria 1220
516 Ga0501082_0000146 3300060353 Bacteria 58922
517 Ga0501082_0000718 3300060353 Bacteria 29158
518 Ga0501082_0005631 3300060353 Bacteria 10874
519 Ga0501082_0020684 3300060353 Bacteria 5672
520 Ga0501082_0027952 3300060353 Bacteria 4858
521 Ga0501082_0134400 3300060353 Bacteria 2146
522 Ga0501082_0290515 3300060353 Bacteria 1423
523 Ga0501082_0526502 3300060353 Bacteria 1033
524 Ga0501082_0539155 3300060353 Bacteria 1020
525 Ga0501082_0783289 3300060353 Bacteria 834
526 Ga0501082_0787927 3300060353 Bacteria 832
527 Ga0501082_0865647 3300060353 Bacteria 790
528 Ga0501082_1135632 3300060353 Bacteria 683
529 Ga0530510_0000002 3300061734 Bacteria 284155
530 Ga0530510_0000403 3300061734 Bacteria 28096
531 Ga0530510_0000410 3300061734 Bacteria 27864
532 Ga0530510_0000633 3300061734 Bacteria 22634
533 Ga0530510_0032272 3300061734 Bacteria 3767
534 Ga0530510_0067991 3300061734 Bacteria 2585
535 Ga0530510_0070495 3300061734 Bacteria 2537
536 Ga0530510_0105353 3300061734 Bacteria 2064
537 Ga0530510_0143829 3300061734 Bacteria 1758
538 Ga0530510_0217084 3300061734 Bacteria 1421
539 Ga0530510_0266490 3300061734 Bacteria 1278
540 Ga0114129_10000216
541 Ga0070690_100212129
542 Ga0068869_100016410
543 Ga0070680_100022445
544 Ga0070682_100027285
545 Ga0070660_100076134
546 Ga0070689_100305675
547 Ga0070689_100821039
548 Ga0070689_101614992
549 Ga0070691_10013026
550 Ga0070691_10109026
551 Ga0070691_10375006
552 Ga0070661_100003719
553 Ga0070692_10075425
554 Ga0070669_100308250
555 Ga0070688_100204349
556 Ga0070659_100026257
557 Ga0070701_10448038
558 Ga0070705_100004541
559 Ga0070705_100017889
560 Ga0070705_100553227
561 Ga0070694_100036700
562 Ga0070694_100074658
563 Ga0070694_100090086
564 Ga0070694_100090987
565 Ga0070708_100050694
566 Ga0070708_100444030
567 Ga0070708_100617997
568 Ga0070708_100625103
569 Ga0070662_100064949
570 Ga0068867_100009601
571 Ga0068867_100174898
572 Ga0070706_100091355
573 Ga0070706_100124994
574 Ga0070706_100166918
575 Ga0070706_100224735
576 Ga0070706_100329563
577 Ga0070706_100533191
578 Ga0070706_100617276
579 Ga0070706_100985010
580 Ga0070707_100005569
581 Ga0070707_100044935
582 Ga0070707_100216688
583 Ga0070707_100947201
584 Ga0070707_101489258
585 Ga0070698_100080912
586 Ga0070698_100089109
587 Ga0070698_100110695
588 Ga0070699_100002892
589 Ga0070699_100018215
590 Ga0070699_100136319
591 Ga0070699_100181824
592 Ga0070699_100238619
593 Ga0070679_100001419
594 Ga0070697_100009741
595 Ga0070697_100017309
596 Ga0070697_100018252
597 Ga0070697_100072671
598 Ga0070697_100144806
599 Ga0068853_100195165
600 Ga0070672_100177425
601 Ga0070686_100101685
602 Ga0070695_100011721
603 Ga0070695_100040504
604 Ga0070695_100069377
605 Ga0070695_100080733
606 Ga0070695_100112130
607 Ga0070695_100212901
608 Ga0070696_100002374
609 Ga0070696_100177399
610 Ga0070696_100299156
611 Ga0070693_100087506
612 Ga0070704_100046278
613 Ga0070704_100144635
614 Ga0068855_100002166
615 Ga0070664_100001058
616 Ga0068857_100003334
617 Ga0068857_100136150
618 Ga0068857_100369714
619 Ga0068854_100077736
620 Ga0068856_100001265
621 Ga0068852_101319654
622 Ga0068859_100039488
623 Ga0068859_100136536
624 Ga0068859_100954502
625 Ga0068859_101094330
626 Ga0068864_100007588
627 Ga0068866_10294923
628 Ga0068861_100075893
629 Ga0068870_10014547
630 Ga0068863_100047386
631 Ga0068863_100069724
632 Ga0068863_100596548
633 Ga0068860_100020406
634 Ga0068860_100055673
635 Ga0068862_100019777
636 Ga0068862_100177518
637 Ga0068862_100374610
638 Ga0070717_10927162
639 Ga0075432_10256037
640 Ga0070712_100001268
641 Ga0075428_100003079
642 Ga0075428_100251957
643 Ga0075428_100308146
644 Ga0075428_100421531
645 Ga0075430_100001340
646 Ga0075430_100002045
647 Ga0075431_100011066
648 Ga0075431_100037939
649 Ga0075431_100191636
650 Ga0075431_100958788
651 Ga0075433_10002199
652 Ga0075433_10789645
653 Ga0075434_100002513
654 Ga0075434_100004220
655 Ga0075434_100707905
656 Ga0075429_100001419
657 Ga0075429_100003531
658 Ga0075429_100582395
659 Ga0075429_100824876
660 Ga0075436_100031612
661 Ga0097620_100039488
662 Ga0097620_100136538
663 Ga0097620_100954510
664 Ga0097620_101094325
665 Ga0075435_100001368
666 Ga0075435_100010993
667 Ga0099794_10022751
668 Ga0105240_11402790
669 Ga0111539_10003405
670 Ga0111539_10872097
671 Ga0111539_11501531
672 Ga0105247_10626740
673 Ga0114129_10007742
674 Ga0114129_10024080
675 Ga0114129_10052158
676 Ga0114129_10064104
677 Ga0114129_10197188
678 Ga0114129_10208091
679 Ga0114129_10980917
680 Ga0114129_11733700
681 Ga0105243_10448763
682 Ga0105241_10229871
683 Ga0105248_10009600
684 Ga0105248_10435676
685 Ga0105237_10456279
686 Ga0105249_10135934
687 Ga0105249_10450405
688 Ga0105246_10503169
689 Ga0105246_10786087
690 Ga0105246_10847457
691 Ga0157371_10339387
692 Ga0157369_11495955
693 Ga0163162_10007987
694 Ga0163162_10242250
695 Ga0157372_10041609
696 Ga0157372_10082945
697 Ga0157375_10406196
698 Ga0157375_10496116
699 Ga0157380_10183068
700 Ga0157380_10412060
701 Ga0157380_11767255
702 Ga0182008_10057446
703 Ga0182007_10007942
704 Ga0207653_10090858
705 Ga0207643_10006668
706 Ga0207684_10016691
707 Ga0207684_10029061
708 Ga0207684_10043072
709 Ga0207684_10060773
710 Ga0207684_10065214
711 Ga0207684_10071673
712 Ga0207684_10193183
713 Ga0207684_10403183
714 Ga0207654_10137020
715 Ga0207707_10000150
716 Ga0207671_10335791
717 Ga0207693_10005491
718 Ga0207663_10052673
719 Ga0207660_10053081
720 Ga0207662_10135322
721 Ga0207657_10072530
722 Ga0207649_10031795
723 Ga0207652_10002718
724 Ga0207646_10001645
725 Ga0207646_10021134
726 Ga0207646_10032777
727 Ga0207646_10064752
728 Ga0207681_10071553
729 Ga0207681_10074453
730 Ga0207650_10017435
731 Ga0207690_10003228
732 Ga0207690_10054009
733 Ga0207706_10050413
734 Ga0207670_10169263
735 Ga0207670_10238940
736 Ga0207670_10691783
737 Ga0207704_10292333
738 Ga0207665_10435467
739 Ga0207691_10145941
740 Ga0207691_10781264
741 Ga0207711_10046929
742 Ga0207689_10058802
743 Ga0207679_10000326
744 Ga0207667_10000777
745 Ga0207712_10036706
746 Ga0207712_10487173
747 Ga0207668_10048256
748 Ga0207640_10069711
749 Ga0207703_10615670
750 Ga0207708_10184726
751 Ga0207702_10001073
752 Ga0207641_10026926
753 Ga0207648_10199528
754 Ga0207648_10620466
755 Ga0207676_10008973
756 Ga0207674_10001586
757 Ga0207674_10121433
758 Ga0207674_10824438
759 Ga0207675_100047650
760 Ga0207675_100280155
761 Ga0209970_1002377
762 Ga0209588_1027977
763 Ga0209971_1001693
764 Ga0209966_1000963
765 Ga0209998_10001611
766 Ga0207428_10000176
767 Ga0268265_10079770
768 Ga0268265_11612497
769 Ga0268265_11668163
770 Ga0268264_10301158
771 Ga0268264_11268946
772 Ga0307408_100070434
773 Ga0307408_100355565
774 Ga0307408_100620123
775 Ga0307410_10092717
776 Ga0307410_10644018
777 Ga0307412_10053849
778 Ga0307409_100244235
779 Ga0307416_100160487
780 Ga0307416_100215495
781 Ga0307411_10006257
782 Ga0373940_0041292
783 Ga0373949_0015825
784 Ga0373939_0013016
785 Ga0373939_0024633
786 Ga0373939_0260871
787 Ga0373960_0014533
788 Ga0373942_0014390
789 Ga0373962_0037545
790 Ga0395899_0009796
791 Ga0395900_0002079
792 Ga0395898_0015665
793 Ga0395901_0001177
794 Ga0439437_004711
795 Ga0439448_0062611
796 Ga0439456_107968
797 Ga0450905_063647
798 Ga0439434_0154596
799 Ga0439459_0003020
800 Ga0439460_0000973
801 Ga0451577_0254683
802 Ga0453683_0367914
803 Ga0453684_0029980
804 Ga0453684_0202098
805 Ga0453684_0319591
806 Ga0451576_0090634
807 Ga0451576_0133536
808 Ga0451576_0245550
809 Ga0451576_0305024
810 Ga0451576_0331242
811 Ga0451576_0386928
812 Ga0451576_0561499
813 Ga0451576_0645943
814 Ga0495584_0157581
815 Ga0495594_0108830
816 Ga0495642_0129418
817 Ga0495656_0222398
818 Ga0495669_0002303
819 Ga0495636_0148306
820 Ga0496102_0012121
821 Ga0496107_0380993
822 Ga0496107_0668480
823 Ga0496112_0173032
824 Ga0501031_0011845
825 Ga0501031_0159869
826 Ga0501033_0061746
827 Ga0501033_0108936
828 Ga0501033_0110899
829 Ga0501033_0247631
830 Ga0501033_0326514
831 Ga0501033_0337583
832 Ga0501036_0000853
833 Ga0501036_0057407
834 Ga0501036_0114847
835 Ga0501036_0187015
836 Ga0501036_0266160
837 Ga0501037_0008116
838 Ga0501037_0044956
839 Ga0501037_0408168
840 Ga0501038_0001304
841 Ga0501038_0062457
842 Ga0501038_0102076
843 Ga0501038_0156072
844 Ga0501038_0254388
845 Ga0501038_0282565
846 Ga0501038_0392438
847 Ga0501038_0393330
848 Ga0501039_0000591
849 Ga0501039_0010896
850 Ga0501039_0041526
851 Ga0501039_0050001
852 Ga0501039_0073585
853 Ga0501039_0333371
854 Ga0501040_0000838
855 Ga0501040_0016640
856 Ga0501040_0049645
857 Ga0501040_0060180
858 Ga0501040_0193208
859 Ga0501040_0293788
860 Ga0501040_0772722
861 Ga0501040_1282705
862 Ga0501041_0000046
863 Ga0501041_0004585
864 Ga0501041_0006377
865 Ga0501041_0019426
866 Ga0501041_0046870
867 Ga0501041_0072135
868 Ga0501041_0191435
869 Ga0501041_0194977
870 Ga0501041_0382983
871 Ga0501041_0408213
872 Ga0501042_0000005
873 Ga0501042_0010507
874 Ga0501042_0029133
875 Ga0501042_0053220
876 Ga0501042_0087128
877 Ga0501042_0104860
878 Ga0501042_0105700
879 Ga0501042_0193486
880 Ga0501042_0281932
881 Ga0501042_0545433
882 Ga0501042_0797670
883 Ga0501043_0007534
884 Ga0501043_0185748
885 Ga0501043_0342970
886 Ga0501043_0563140
887 Ga0501046_0000141
888 Ga0501046_0000373
889 Ga0501046_0058604
890 Ga0501046_0373676
891 Ga0501046_0403145
892 Ga0501047_0024996
893 Ga0501048_0003890
894 Ga0501048_0033021
895 Ga0501048_0048263
896 Ga0501048_0119286
897 Ga0501048_0273201
898 Ga0501048_0396522
899 Ga0501068_0004994
900 Ga0501068_0012291
901 Ga0501068_0154578
902 Ga0501068_0503296
903 Ga0501068_0641399
904 Ga0501069_0035223
905 Ga0501071_0000085
906 Ga0501071_0012073
907 Ga0501071_0045796
908 Ga0501071_0077026
909 Ga0501071_0243796
910 Ga0501072_0000073
911 Ga0501072_0004739
912 Ga0501072_0011014
913 Ga0501072_0040487
914 Ga0501072_0057018
915 Ga0501072_0100889
916 Ga0501072_0311419
917 Ga0501072_0328070
918 Ga0501072_0340422
919 Ga0501072_0630522
920 Ga0501072_0750773
921 Ga0501074_0026418
922 Ga0501074_0045329
923 Ga0501074_0062015
924 Ga0501074_0515907
925 Ga0501074_0580915
926 Ga0501074_0846100
927 Ga0501075_0000001
928 Ga0501075_0000219
929 Ga0501075_0014099
930 Ga0501075_0154703
931 Ga0501075_0168540
932 Ga0501075_0196570
933 Ga0501075_0276711
934 Ga0501075_0317933
935 Ga0501075_0373718
936 Ga0501075_0545933
937 Ga0501075_0852374
938 Ga0501076_0000001
939 Ga0501076_0000204
940 Ga0501076_0000842
941 Ga0501076_0011465
942 Ga0501076_0022040
943 Ga0501076_0032553
944 Ga0501076_0095892
945 Ga0501076_0221823
946 Ga0501076_0265530
947 Ga0501076_0314657
948 Ga0501076_0316217
949 Ga0501076_0594460
950 Ga0501077_0000023
951 Ga0501077_0004553
952 Ga0501077_0035669
953 Ga0501077_0040082
954 Ga0501077_0085655
955 Ga0501077_0099200
956 Ga0501077_0203702
957 Ga0501077_0265164
958 Ga0501077_0283805
959 Ga0501216_067479
960 Ga0501079_0000015
961 Ga0501079_0002202
962 Ga0501079_0003943
963 Ga0501079_0016366
964 Ga0501079_0021996
965 Ga0501079_0027808
966 Ga0501079_0046202
967 Ga0501079_0096245
968 Ga0501079_0128591
969 Ga0501079_0155480
970 Ga0501079_0168009
971 Ga0501079_0319878
972 Ga0501079_1139629
973 Ga0501080_0000495
974 Ga0501080_0014683
975 Ga0501080_0038738
976 Ga0501080_0060309
977 Ga0501080_0143232
978 Ga0501080_0206417
979 Ga0501080_0236045
980 Ga0501080_0505376
981 Ga0501081_0000182
982 Ga0501081_0001420
983 Ga0501081_0002786
984 Ga0501081_0003132
985 Ga0501081_0018056
986 Ga0501081_0021004
987 Ga0501081_0024979
988 Ga0501081_0173882
989 Ga0501081_0237336
990 Ga0501081_0387371
991 Ga0501081_0396724
992 Ga0501081_0540596
993 Ga0501083_0016105
994 Ga0501083_0062638
995 Ga0501083_0145728
996 Ga0501035_0008834
997 Ga0501035_0064452
998 Ga0501035_0437130
999 Ga0501035_0497026
1000 Ga0501044_0268592
1001 Ga0501045_0001141
1002 Ga0501045_0002341
1003 Ga0501045_0003038
1004 Ga0501045_0006123
1005 Ga0501045_0012899
1006 Ga0501045_0035961
1007 Ga0501045_0106015
1008 Ga0501045_0164804
1009 Ga0501045_0907192
1010 nmdc:mga05p37_1240038_c1
1011 nmdc:mga05p37_15776_c1
1012 nmdc:mga05p37_210537_c1
1013 nmdc:mga05p37_2413_c1
1014 nmdc:mga05p37_256609_c1
1015 nmdc:mga05p37_3105_c1
1016 nmdc:mga05p37_3324_c1
1017 nmdc:mga05p37_54149_c1
1018 nmdc:mga05p37_62075_c1
1019 nmdc:mga09592_264044_c1
1020 nmdc:mga09592_44881_c1
1021 nmdc:mga09592_5329_c1
1022 nmdc:mga0qj67_134086_c1
1023 nmdc:mga0qj67_15447_c1
1024 nmdc:mga0qj67_3133_c1
1025 nmdc:mga06r32_1028856_c1
1026 nmdc:mga06r32_128191_c1
1027 nmdc:mga06r32_42231_c1
1028 nmdc:mga06r32_437245_c1
1029 nmdc:mga06r32_9162_c1
1030 nmdc:mga08y16_1847194_c1
1031 nmdc:mga08y16_19972_c1
1032 nmdc:mga08y16_662076_c1
1033 nmdc:mga08y16_890_c1
1034 nmdc:mga0n895_33093_c1
1035 nmdc:mga0n895_45790_c1
1036 nmdc:mga0n895_579754_c1
1037 nmdc:mga0rr50_10564_c1
1038 nmdc:mga0rr50_3653_c1
1039 nmdc:mga08x19_27868_c1
1040 nmdc:mga0a205_122070_c1
1041 nmdc:mga0a205_154340_c2
1042 nmdc:mga0a205_24194_c1
1043 nmdc:mga0a205_538515_c1
1044 nmdc:mga0a205_586826_c1
1045 nmdc:mga0a205_692726_c1
1046 Ga0501084_0000142
1047 Ga0501084_0028771
1048 Ga0501084_0039077
1049 Ga0501084_0044573
1050 Ga0501084_0108719
1051 Ga0501084_0321597
1052 Ga0501084_0370284
1053 Ga0501084_0372671
1054 Ga0590077_028156
1055 Ga0501082_0000146
1056 Ga0501082_0000718
1057 Ga0501082_0005631
1058 Ga0501082_0020684
1059 Ga0501082_0027952
1060 Ga0501082_0134400
1061 Ga0501082_0290515
1062 Ga0501082_0526502
1063 Ga0501082_0539155
1064 Ga0501082_0783289
1065 Ga0501082_0787927
1066 Ga0501082_0865647
1067 Ga0501082_1135632
1068 Ga0530510_0000002
1069 Ga0530510_0000403
1070 Ga0530510_0000410
1071 Ga0530510_0000633
1072 Ga0530510_0032272
1073 Ga0530510_0067991
1074 Ga0530510_0070495
1075 Ga0530510_0105353
1076 Ga0530510_0143829
1077 Ga0530510_0217084
1078 Ga0530510_0266490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

36

154

0.96

PF08534

Redoxin

Redoxin

35

166

0.95

PF13905

Thioredoxin_8

Thioredoxin-like

60

151

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nmu-assembly2.cif.gz_B crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor' 0.9527 39 175
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.9507 41 174
2h1b-assembly2.cif.gz_B resa e80q 0.9492 40 174
2h1a-assembly1.cif.gz_A resa c74a variant 0.9401 41 177
3c73-assembly1.cif.gz_A structure of cehc variant resa 0.94 41 177
ID Description Score Start End Superfamily
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9479 40 174 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9365 46 174 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9216 40 174 3.40.30.10
af_O06392_67_205_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9193 45 177 3.40.30.10
2l5oA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8977 43 174 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V7HQ72-F1-model_v4 Thioredoxin domain-containing protein 0.9868 38 174 GO:0016209
GO:0016491
AF-A0A2H5YDY6-F1-model_v4 Thiol-disulfide oxidoreductase ResA 0.9816 42 175 GO:0016209
GO:0016491
AF-A0A382PYB5-F1-model_v4 Thioredoxin domain-containing protein 0.9783 36 175 GO:0016209
GO:0016491
AF-A0A1G0FVZ1-F1-model_v4 Thioredoxin domain-containing protein 0.9772 42 174 GO:0015036
GO:0017004
GO:0030313
AF-A0A2V7HQ72-F1-model_v4 Thioredoxin domain-containing protein 0.9728 38 174 GO:0016209
GO:0016491

Map